Cysteine engineered antibody drug conjugates
11364303 · 2022-06-21
Assignee
Inventors
- Madan Katragadda (Acton, MA, US)
- Russell Dushin (Old Lyme, CT, US)
- Lawrence Nathan Tumey (Vestal, NY, US)
Cpc classification
A61K47/6889
HUMAN NECESSITIES
A61P31/00
HUMAN NECESSITIES
C07K2317/72
CHEMISTRY; METALLURGY
A61K47/6851
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
A61K47/6803
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
A61P31/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The invention relates to polypeptides, antibodies, and antigen-binding fragments thereof, that comprise an engineered cysteine for site-specific conjugation.
Claims
1. An antibody drug conjugate of formula Ab-(L-D), wherein: (a) Ab is an antibody that binds to CD33, or an antigen binding fragment thereof, comprising an antibody heavy chain constant domain containing an engineered cysteine residue at position 334, according to the numbering of the Eu index of Kabat, wherein the antibody light chain comprises the amino acid sequence of SEQ ID NO:23 and the antibody heavy chain comprises the amino acid sequence of SEQ ID NO:32; and (b) L-D is a linker-drug moiety that is attached to the Ab via the engineered cysteine residue, wherein L is a linker comprising vc, mc, MalPeg6, PABC, DMAE, m(H20)c, m(H20)cvc, or a combination thereof; and wherein D is a CPI dimer selected from the group consisting of: ##STR00052##
2. The antibody drug conjugate of claim 1, wherein the linker is MalPeg6-vc-PABC-DMAE.
3. The antibody drug conjugate of claim 1, wherein the CPI dimer is selected from the group consisting of: ##STR00053##
4. An antibody drug conjugate of claim 3 wherein L is MalPeg6-vc-PABC-DMAE.
5. A pharmaceutical composition comprising the antibody drug conjugate of claim 1 and a pharmaceutically acceptable carrier.
6. A method of treating cancer, an autoimmune disease, an inflammatory disease, or an infectious disease, comprising administering to a subject in need thereof a therapeutically effective amount of the antibody drug conjugate of claim 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
DETAILED DESCRIPTION OF THE INVENTION
(8) The invention relates to polypeptides, antibodies, and antigen-binding fragments thereof, that comprise an engineered (substituted) cysteine for site-specific conjugation. In particular, it was discovered position 334 and/or position 392 in the antibody heavy chain constant region (according to the numbering of the Eu index of Kabat) can be used for site specific conjugation to make antibody drug conjugates (ADCs) with antibodies to various targets (including but not limited to CD33 and HER2). Data exemplified herein demonstrate that ADC constructs conjugated at position 334 and/or position 392 show superior in vivo properties, as compared to other conjugation sites.
(9) A number of potential cysteine conjugation sites are known in the art (e.g., heavy chain 290 or 347, light chain 183; see WO 2017/093845). However, as shown in the Examples, the site of conjugation can have a dramatic impact on different ADC characteristics, such as biophysical properties (e.g., hydrophobicity), biological stability and ADC efficacy (e.g., ADC metabolism).
(10) In particular, the inventors observed that the site of conjugation plays a critical role in plasma stability and in vivo efficacy. ADCs conjugated with CPI dimers at position 334 and/or at position 392 surprisingly showed superior plasma stability and in vivo efficacy as compared to ADCs conjugated at other positions, which makes these conjugation sites more advantageous for clinical use. These surprising effects could not have been predicted based on the linker payload.
(11) In addition to favorable biological stability in vivo efficacy, engineered cysteine antibody variants (K334C and K334C/K392C double mutants) contained low levels of fragments or half molecules. These results indicate that these engineered cysteines do not impact integrity of the antibody intended for site-specific conjugation. Moreover, both K334C and K334C/K392C ADCs demonstrated excellent thermal stability post conjugation indicating that the antibody is not perturbed during conjugation.
1. Antibody-Drug Conjugates (ADCs)
(12) ADCs comprise an antibody component conjugated to a drug payload, typically through the use of a linker. Conventional conjugation strategies for ADCs rely on randomly conjugating the drug payload to the antibody through lysines or cysteines that are endogenously found on the antibody heavy and/or light chain. Accordingly, such ADCs are a heterogeneous mixture of species showing different drug:antibody ratios (DAR). In contrast, the ADCs disclosed herein are site specific ADCs that conjugate the drug payload to the antibody at particular engineered residues on the antibody heavy and/or light chain. As such, the site specific ADCs are a homogeneous population of ADCs comprised of a species with a defined drug:antibody ratio (DAR). Thus, the site specific ADCs demonstrate uniform stoichiometry resulting in improved pharmacokinetics, biodistribution and safety profile of the conjugate. ADCs of the invention include antibodies and polypeptides of the invention conjugated to linkers and/or payloads.
(13) The present invention provides antibody drug conjugates of the formula Ab-(L-D), wherein (a) Ab is an antibody, or antigen-binding fragment thereof, that binds an antigen, and (b) L-D is a linker-drug moiety, wherein L is a linker, and D is a drug.
(14) Also encompassed by the present invention are antibody drug conjugates of the formula Ab-(L-D).sub.p, wherein (a) Ab is an antibody, or antigen-binding fragment thereof, that binds to CD33 or HER2, (b) L-D is a linker-drug moiety, wherein L is a linker, and D is a drug and (c) p is the number of linker/drug moieties are attached to the antibody. For site specific ADCs, p is a whole number due to the homogeneous nature of the ADC. In some embodiments, p is 4. In other embodiments, p is 3. In other embodiments, p is 2. In other embodiments, p is 1. In other embodiments, p is greater than 4.
(15) A. Antibodies and Conjugation Sites
(16) The polypeptides and antibodies of the invention are conjugated to the payload in a site specific manner. To accommodate this type of conjugation, the constant domain is modified to provide for a reactive cysteine residue engineered at one or more specific sites (sometimes referred to as “Cys mutants”).
(17) In general, the regions of an antibody heavy or light chain are defined as “constant” (C) region or “variable” (V) regions, based on the relative lack of sequence variation within the regions of various class members. A constant region of an antibody may refer to the constant region of the antibody light chain or the constant region of the antibody heavy chain, either alone or in combination. The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as Fc receptor (FcR) binding, participation of the antibody in antibody-dependent cellular toxicity (ADCC), opsonization, initiation of complement dependent cytotoxicity, and mast cell degranulation.
(18) The constant and variable regions of an antibody heavy and light chains are folded into domains. Constant region on the light chain of an immunoglobulin is generally referred to as “CL domain.” Constant domains on the heavy chain (e.g. hinge, CH1, CH2 or CH3 domains) are referred to as “CH domains.” The constant regions of the polypeptide or antibody (or fragment thereof) of the invention may be derived from constant regions of any one of IgA, IgD, IgE, IgG, IgM, or any isotypes thereof as well as subclasses (e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1 and IgA.sub.2) and mutated versions thereof.
(19) CH1 domain includes the first (most amino terminal) constant region domain of an immunoglobulin heavy chain that extends, e.g., from about positions 118-215 according to the numbering of the Eu index of Kabat. The CH1 domain is adjacent to the VH domain and amino terminal to the hinge region of an immunoglobulin heavy chain molecule, and does not form a part of the Fc region of an immunoglobulin heavy chain.
(20) The hinge region includes the portion of a heavy chain molecule that joins the CH1 domain to the CH2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains.
(21) CH2 domain includes the portion of a heavy chain immunoglobulin molecule that extends, e.g., from about positions 231-340 according to the numbering of the Eu index of Kabat. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. In certain embodiments, the polypeptide or antibody (or fragment thereof) of the invention comprises a CH2 domain derived from an IgG molecule, such as IgG1, IgG2, IgG3, or IgG4. In certain embodiments, the IgG is a human IgG.
(22) CH3 domain includes the portion of a heavy chain immunoglobulin molecule that extends approximately 110 residues from N-terminus of the CH2 domain, e.g., from about positions 341-447 according to the numbering of the EU index of Kabat. The CH3 domain typically forms the C-terminal portion of the antibody. In some immunoglobulins, however, additional domains may extend from CH3 domain to form the C-terminal portion of the molecule (e.g. the CH4 domain in the p chain of IgM and the s chain of IgE). In certain embodiments, the polypeptide or antibody (or fragment thereof) of the invention comprises a CH3 domain derived from an IgG molecule, such as IgG1, IgG2, IgG3, or IgG4. In certain embodiments, the IgG is a human IgG.
(23) CL domain includes the constant region domain of an immunoglobulin light chain that extends, e.g. from about positions 108-214 according to the numbering of the EU index of Kabat. The CL domain is adjacent to the VL domain. In certain embodiments, the polypeptide or antibody (or fragment thereof) of the invention comprises a kappa light chain constant domain (CLκ). In certain embodiments, the polypeptide or antibody (or fragment thereof) of the invention comprises a lambda light chain constant domain (CLλ). CLκ has known polymorphic loci CLκ-V/A45 and CLκ-L/V83 (using Kabat numbering) thus allowing for polymorphisms Km(1): CLκ-V45/L83; Km(1,2): CLκ-A45/L83; and Km(3): CLκ-A45/V83. Polypeptides, antibodies and ADCs of the invention can have antibody components with any of these light chain constant regions.
(24) The Fc region generally comprises a CH2 domain and a CH3 domain. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230 (according to the numbering of the Eu index of Kabat), to the carboxyl-terminus thereof. A Fc region of the invention may be a native sequence Fc region or a variant Fc region.
(25) In one aspect, the invention provides a polypeptide comprising an antibody heavy chain constant domain that comprises an engineered cysteine residue at position 334, according to the numbering of the Eu index of Kabat. As disclosed and exemplified herein, conjugation at position 334 provided surprisingly desirable plasma stability and in vivo efficacy.
(26) In one aspect, the invention provides a polypeptide comprising an antibody heavy chain constant domain that comprises an engineered cysteine residue at position 392, according to the numbering of the Eu index of Kabat. As disclosed and exemplified herein, conjugation at position 392 provided surprisingly desirable plasma stability and in vivo efficacy.
(27) In some aspects, the invention provides a polypeptide comprising an antibody heavy chain constant domain that comprises engineered cysteine residues at position 334 and position 392, according to the numbering of the Eu index of Kabat. As disclosed and exemplified herein, conjugation at positions 334 and 392 provided surprisingly desirable plasma stability and in vivo efficacy.
(28) Additional cysteine substitution may also be introduced, such as at positions 118, 246, 249, 265, 267, 270, 276, 278, 283, 290, 292, 293, 294, 300, 302, 303, 314, 315, 318, 320, 332, 333, 336, 345, 347, 354, 355, 358, 360, 362, 370, 373, 375, 376, 378, 380, 382, 386, 388, 390, 393, 401, 404, 411, 413, 414, 416, 418, 419, 421, 428, 431, 432, 437, 438, 439, 443, 444, or any combination thereof, according to the numbering of the Eu index of Kabat. In particular, additional positions 290 and 347, or any combination thereof may be used. Residue 118 is also referred to as A114, A114C, C114, or 114C in the examples because the initial publication of this site used Kabat numbering (114) instead of Eu index (118), and has since been generally referred in the art as the 114 site.
(29) In another aspect, the invention provides an antibody or antigen binding fragment thereof comprising (a) a polypeptide disclosed herein and (b) an antibody light chain constant region comprising (i) an engineered cysteine residue at position 183, according to the numbering of the Eu index of Kabat; or (ii) an engineered cysteine residue at a position corresponding to residue 76 of SEQ ID NO:30, when said constant domain is aligned with SEQ ID NO:30.
(30) In another aspect, the invention provides an antibody or antigen binding fragment thereof comprising (a) a polypeptide disclosed herein and (b) an antibody light chain constant region comprising (i) an engineered cysteine residue at position 110, 111, 125, 149, 155, 158, 161, 185, 188, 189, 191, 197, 205, 206, 207, 208, 210, or any combination thereof, according to the numbering of Kabat; (ii) an engineered cysteine residue at a position corresponding to residue 4, 42, 81, 100, 103, or any combination thereof, of SEQ ID NO:30, when said constant domain is aligned with SEQ ID NO:30 (kappa light chain); or (iii) an engineered cysteine residue at a position corresponding to residue 4, 5, 19, 43, 49, 52, 55, 78, 81, 82, 84, 90, 96, 97, 98, 99, 101, or any combination thereof, of SEQ ID NO:31, when said constant domain is aligned with SEQ ID NO:31 (lambda light chain).
(31) In another aspect, the invention provides an antibody or antigen binding fragment thereof comprising (a) a polypeptide disclosed herein and (b) an antibody kappa light chain constant region comprising (i) an engineered cysteine residue at position 111, 149, 188, 207, 210, or any combination thereof (preferably 111 or 210), according to the numbering of Kabat; or (ii) an engineered cysteine residue at a position corresponding to residue 4, 42, 81, 100, 103, or any combination thereof, of SEQ ID NO:30 (preferably residue 4 or 103), when said constant domain is aligned with SEQ ID NO:30.
(32) In another aspect, the invention provides an antibody or antigen binding fragment thereof comprising (a) a polypeptide disclosed herein and (b) an antibody lambda light chain constant region comprising (i) an engineered cysteine residue at position 110, 111, 125, 149, 155, 158, 161, 185, 188, 189, 191, 197, 205, 206, 207, 208, 210, or any combination thereof (preferably 110, 111, 125, 149, or 155), according to the numbering of Kabat; or (ii) an engineered cysteine residue at a position corresponding to residue 4, 5, 19, 43, 49, 52, 55, 78, 81, 82, 84, 90, 96, 97, 98, 99, 101, or any combination thereof of SEQ ID NO:31 (preferably residue 4, 5, 19, 43, or 49), when said constant domain is aligned with SEQ ID NO:31.
(33) Amino acid modifications can be made by any method known in the art and many such methods are well known and routine for the skilled artisan. For example, but not by way of limitation, amino acid substitutions, deletions and insertions may be accomplished using any well-known PCR-based technique. Amino acid substitutions may be made by site-directed mutagenesis (see, for example, Zoller and Smith, 1982, Nucl. Acids Res. 10:6487-6500; and Kunkel, 1985, PNAS 82:488).
(34) In applications where retention of antigen binding is required, such modifications should be at sites that do not disrupt the antigen binding capability of the antibody. In preferred embodiments, the one or more modifications are made in the constant region of the heavy and/or light chains.
(35) Typically, the K.sub.D for the antibody with respect to the target will be 2-fold, preferably 5-fold, more preferably 10-fold less than the K.sub.D with respect to another, non-target molecule such as, but not limited to, unrelated material or accompanying material in the environment. More preferably, the K.sub.D will be 50-fold less, such as 100-fold less or 200-fold less; even more preferably 500-fold less, such as 1,000-fold less, or 10,000-fold less than the K.sub.D with respect the non-target molecule.
(36) The value of this dissociation constant can be determined directly by well-known methods, and can be computed even for complex mixtures by methods such as those, for example, set forth in Caceci et al., 1984, Byte 9: 340-362. For example, the K.sub.D may be established using a double-filter nitrocellulose filter binding assay such as that disclosed by Wong and Lohman, 1993, Proc. Natl. Acad. Sci. USA 90: 5428-5432. Other standard assays to evaluate the binding ability of ligands such as antibodies towards targets are known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis. The binding kinetics and binding affinity of the antibody also can be assessed by standard assays known in the art, such as Surface Plasmon Resonance (SPR), e.g. by using a Biacore™ system.
(37) A competitive binding assay can be conducted in which the binding of the antibody to the target is compared to the binding of the target by another ligand of that target, such as another antibody. The concentration at which 50 percent binding inhibition occurs is known as the K.sub.i. Under ideal conditions, the K.sub.i is equivalent to K.sub.D. The K.sub.i value will never be less than the K.sub.D, so measurement of K.sub.i can conveniently be substituted to provide an upper limit for K.sub.D.
(38) An antibody of the invention may have a K.sub.D for its target of no more than about 1×10.sup.−3 M, such as no more than about 1×10.sup.−3 M, no more than about 9×10.sup.−4 M, no more than about 8×10.sup.−4 M, no more than about 7×10.sup.−4 M, no more than about 6×10.sup.−4 M, no more than about 5×10.sup.−4 M, no more than about 4×10.sup.−4 M, no more than about 3×10.sup.−4 M, no more than about 2×10.sup.−4 M, no more than about 1×10.sup.−4 M, no more than about 9×10.sup.−5 M, no more than about 8×10.sup.−5 M, no more than about 7×10.sup.−5 M, no more than about 6×10.sup.−5 M, no more than about 5×10.sup.−5 M, no more than about 4×10.sup.−5 M, no more than about 3×10.sup.−5 M, no more than about 2×10.sup.−5 M, no more than about 1×10.sup.−5 M, no more than about 9×10.sup.−6 M, no more than about 8×10.sup.−6 M, no more than about 7×10.sup.−6 M, no more than about 6×10.sup.−6 M, no more than about 5×10.sup.−6 M, no more than about 4×10.sup.−6 M, no more than about 3×10.sup.−6 M, no more than about 2×10.sup.−6 M, no more than about 1×10.sup.−6 M, no more than about 9×10.sup.−7 M, no more than about 8×10.sup.−7 M, no more than about 7×10.sup.−7 M, no more than about 6×10.sup.−7 M, no more than about 5×10.sup.−7 M, no more than about 4×10.sup.−7 M, no more than about 3×10.sup.−7 M, no more than about 2×10.sup.−7 M, no more than about 1×10.sup.−7 M, no more than about 9×10.sup.−8 M, no more than about 8×10.sup.−8 M, no more than about 7×10.sup.−8 M, no more than about 6×10.sup.−8 M, no more than about 5×10.sup.−8 M, no more than about 4×10.sup.−8 M, no more than about 3×10.sup.−8 M, no more than about 2×10.sup.−8 M, no more than about 1×10.sup.−8 M, no more than about 9×10.sup.−9 M, no more than about 8×10.sup.−9 M, no more than about 7×10.sup.−9 M, no more than about 6×10.sup.−9 M, no more than about 5×10.sup.−9 M, no more than about 4×10.sup.−9 M, no more than about 3×10.sup.−9 M, no more than about 2×10.sup.−9 M, no more than about 1×10.sup.−9 M, from about 1×10.sup.−9 M to about 1×10.sup.−13 M, 1×10.sup.−4M to about 1×10.sup.−13 M, 1×10.sup.−5 M to about 1×10.sup.−13 M, from about 1×10.sup.−6 M to about 1×10.sup.−13 M, from about 1×10.sup.−7 M to about 1×10.sup.−13 M, from about 1×10.sup.−8 M to about 1×10.sup.−13 M, from about 1×10.sup.−9 M to about 1×10.sup.−13 M, 1×10.sup.−3 M to about 1×10.sup.−12 M, 1×10.sup.−4 M to about 1×10.sup.−12 M, from about 1×10.sup.−5 M to about 1×10.sup.−12 M, from about 1×10.sup.−6 M to about 1×10.sup.−12 M, from about 1×10.sup.−7M to about 1×10.sup.−12 M, from about 1×10.sup.−8 M to about 1×10.sup.−12 M, from about 1×10.sup.−9 M to about 1×10.sup.−12 M, 1×10.sup.−3 M to about 1×10.sup.−11 M, 1×10.sup.−4 M to about 1×10.sup.−11 M, from about 1×10.sup.−5 M to about 1×10.sup.−11 M, from about 1×10.sup.−6 M to about 1×10.sup.−11 M, from about 1×10.sup.−7 M to about 1×10.sup.−11 M, from about 1×10.sup.−8 M to about 1×10.sup.−11 M, from about 1×10.sup.−9 M to about 1×10.sup.−11 M, 1×10.sup.−3 M to about 1×10.sup.−10 M, 1×10.sup.−4 M to about 1×10.sup.−10 M, from about 1×10.sup.−5 M to about 1×10.sup.−10 M, from about 1×10.sup.−6M to about 1×10.sup.−10 M, from about 1×10.sup.−7 M to about 1×10.sup.−10 M, from about 1×10.sup.−8 M to about 1×10.sup.−10 M, or from about 1×10.sup.−9 M to about 1×10.sup.−10 M.
(39) Although in general, K.sub.D at nanomolar range is desired, in certain embodiments, low affinity antibodies may be preferred, for example, for targeting highly expressed receptors in compartments and avoiding off-target binding. Further, some therapeutic applications may benefit from an antibody with lower binding affinity to facilitate antibody recycling.
(40) Antibodies of the disclosure should retain the antigen binding capability of their native counterparts. In one embodiment, the antibodies of the disclosure exhibit essentially the same affinity as compared to an antibody prior to Cys substitution. In another embodiment, antibodies of the disclosure exhibit a reduced affinity as compared to an antibody prior to Cys substitution. In another embodiment, antibodies of the disclosure exhibit an enhanced affinity as compared to an antibody prior to Cys substitution.
(41) In one embodiment, an antibody of the disclosure may have a dissociation constant (K.sub.D) about equal to the K.sub.D of the antibody prior to Cys substitution. In one embodiment, an antibody of the disclosure may have a dissociation constant (K.sub.D) about 1-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 10-fold, about 20-fold, about 50-fold, about 100-fold about 150-fold, about 200-fold, about 250-fold, about 300-fold, about 400-fold, about 500-fold, about 600-fold, about 700-fold, about 800-fold, about 900-fold, or about 1000-fold greater for its cognate antigen compared with the K.sub.D of the antibody prior to Cys substitution.
(42) In yet another embodiment, an antibody of the disclosure may have a K.sub.D about 1-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 10-fold, about 20-fold, about 50-fold, about 100-fold, about 150-fold, about 200-fold, about 250-fold, about 300-fold, about 400-fold, about 500-fold, about 600-fold, about 700-fold, about 800-fold, about 900-fold, or about 1000-fold lower for its cognate antigen compared with the K.sub.D of the antibody prior to Cys substitution.
(43) Nucleic acids encoding the heavy and light chains of the antibodies used to make the ADCs of the invention can be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
(44) ADCs can be made with an antibody component directed to any antigen using site specific conjugation through an engineered cysteine at position 334 and/or position 392 (according to Eu index of Kabat) either alone or in combination with other positions disclosed herein (e.g., positions 290 and 347 according to Eu index of Kabat).
(45) In some embodiments, the antibody or antigen binding fragment thereof is selected from the group consisting of: abagovomab, abatacept (ORENCIA®), abciximab (REOPRO®, c7E3 Fab), adalimumab (HUMIRA®), adecatumumab, alemtuzumab (CAMPATH®, MabCampath or Campath-1H), altumomab, afelimomab, anatumomab mafenatox, anetumumab, anrukizumab, apolizumab, arcitumomab, aselizumab, atlizumab, atorolimumab, bapineuzumab, basiliximab (SIMULECT®), bavituximab, bectumomab (LYMPHOSCAN®), belimumab (LYMPHO-STAT-B®), bertilimumab, besilesomab, βcept (ENBREL®), bevacizumab (AVASTIN®), biciromab brallobarbital, bivatuzumab mertansine, brentuximab vedotin (ADCETRIS®), canakinumab (ACZ885), cantuzumab mertansine, capromab (PROSTASCINT®), catumaxomab (REMOV AB®), cedelizumab (CIMZIA®), certolizumab pegol, cetuximab (ERBITUX®), clenoliximab, dacetuzumab, dacliximab, daclizumab (ZENAP AX(®), denosumab (AMG 162), detumomab, dorlimomab aritox, dorlixizumab, duntumumab, durimulumab, durmulumab, ecromeximab, eculizumab (SOLIRIS®), edobacomab, edrecolomab (Mabl7-1A, PANOREX®), efalizumab (RAPTIVA®), efungumab (MYCOGRAB®), elsilimomab, enlimomab pegol, epitumomab cituxetan, efalizumab, epitumomab, epratuzumab, erlizumab, ertumaxomab (REXOMUN®), etaracizumab (etaratuzumab, VITAXI N®, ABEGRIN™), exbivirumab, fanolesomab (NEUTROSPEC®), faralimomab, felvizumab, fontolizumab (HUZAF®), galiximab, gantenerumab, gavilimomab (ABX-CBL®), gemtuzumab ozogamicin (MYLOTARG®), golimumab (CNTO 148), gomiliximab, ibalizumab (TNX-355), ibritumomab tiuxetan (ZEVALIN®), igovomab, imciromab, infliximab (REMICAD E®), inolimomab, inotuzumab ozogamicin, ipilimumab (YERVOY®, MDX-010), iratumumab, keliximab, labetuzumab, lemalesomab, lebrilizumab, lerdelimumab, lexatumumab (HGS-ETR2, ETR2-ST01), lexitumumab, libivirumab, lintuzumab, lucatumumab, lumiliximab, mapatumumab (HGS-ETRI, TRM-I), maslimomab, matuzumab (EMD72000), mepolizumab (BOSATRIA®), metelimumab, milatuzumab, minretumomab, mitumomab, morolimumab, motavizumab (NUMAX™), muromonab (OKT3), nacolomab tafenatox, naptumomab estafenatox, natalizumab (TYSABRI®, ANTEGREN®), nebacumab, nerelimomab, nimotuzumab (THERACIM hR3®, THERA-CIM-hR3®, THERALOC®), nofetumomab merpentan (VERLUMA®), ocrelizumab, odulimomab, ofatumumab, omalizumab (XOLAIR®), oregovomab (OVAREX®), otelixizumab, pagibaximab, palivizumab (SYNAGIS®), panitumumab (ABX-EGF, VECTIBIX®), pascolizumab, pemtumomab (THERAGYN®), pertuzumab (2C4, OMNITARG®), pexelizumab, pintumomab, ponezumab, priliximab, pritumumab, ranibizumab (LUCENTIS®), raxibacumab, regavirumab, reslizumab, rituximab (RITUXAN®, MabTHERA®), rovelizumab, ruplizumab, satumomab, sevirumab, sibrotuzumab, siplizumab (MEDI-507), sontuzumab, stamulumab (Myo-029), sulesomab (LEUKOSCAN®), tacatuzumab tetraxetan, tadocizumab, talizumab, taplitumomab paptox, tefibazumab (AUREXIS®), telimomab aritox, teneliximab, teplizumab, ticilimumab, tocilizumab (ACTEMRA®), toralizumab, tositumomab, trastuzumab, tremelimumab (CP-675,206), tucotuzumab celmoleukin, tuvirumab, urtoxazumab, ustekinumab (CNTO 1275), vapaliximab, veltuzumab, vepalimomab, visilizumab (NUVION®), volociximab (M200), votumumab (HUMASPECT®), zalutumumab, zanolimumab (HuMAX-CD4), ziralimumab, or zolimomab aritox.
(46) In some embodiments the antigen binding domain comprises a heavy and light chain variable domain having six CDRs, and/or competes for binding with an antibody selected from the preceding list. In some embodiments the antigen binding domain binds to the same epitope as the antibodies in the preceding list. In some embodiments the antigen binding domain comprises a heavy and light chain variable domain having six total CDRs, and binds to the same antigen as the antibodies in the preceding list.
(47) In some embodiments the antigen binding domain comprises a heavy and light chain variable domain having six (6) total CDRs, and specifically binds to an antigen selected from the group consisting of: PDGFRα, PDGFRβ, PDGF, VEGF, VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, VEGF-F, VEGFR1, VEGFR2, VEGFR3, FGF, FGF2, HGF, KDR, FLT-1, FLK-1, Ang-2, Ang-1, PLGF, CEA, CXCL13, BAFF, IL-21, CCL21, TNF-α, CXCL12, SDF-I, bFGF, MAC-I, IL23p19, FPR, IGFBP4, CXCR3, TLR4, CXCR2, EphA2, EphA4, EphrinB2, EGFR(ErbBI), HER2(ErbB2 or pl85neu), HER3(ErbB3), HER4 ErbB4 or tyro2), SCI, LRP5, LRP6, RAGE, s100A8, s100A9, Navl.7, GLPI, RSV, RSV F protein, Influenza HA protein, Influenza NA protein, HMGBI, CD16, CD19, CD20, CD21, CD28, CD32, CD32b, CD64, CD79, CD22, ICAM-I, FGFRI, FGFR2, HDGF, EphB4, GITR, β-amyloid, hMPV, PIV-I, PIV-2, OX40L, IGFBP3, cMet, PD-I, PLGF, Neprolysin, CTD, IL-18, IL-6, CXCL-13, IL-IRI, IL-15, IL-4R, IgE, PAI-I, NGF, EphA2, uPARt, DLL-4, avβ5, avβ6, α5β1, a3β1, interferon receptor type I and type II, CD 19, ICOS, IL-17, Factor II, Hsp90, IGF, IGF-I, IGF-II, CD 19, GM-CSFR, PIV-3, CMV, IL-13, IL-9, and EBV.
(48) In some embodiments the antigen binding domain specifically binds to a member (receptor or ligand) of the TNF superfamily. The TNF superfamily member may be selected from the group including, but not limited to, Tumor Necrosis Factor-α (“TNF-α”), Tumor Necrosis Factor-β (“TNF-β”), Lymphotoxin-α (“LT-α”), CD30 ligand, CD27 ligand, CD40 ligand, 4-1 BB ligand, Apo-1 ligand (also referred to as Fas ligand or CD95 ligand), Apo-2 ligand (also referred to as TRAIL), Apo-3 ligand (also referred to as TWEAK), osteoprotegerin (OPG), APRIL, RANK ligand (also referred to as TRANCE), TALL-I (also referred to as BlyS, BAFF or THANK), DR4, DR5 (also known as Apo-2, TRAIL-R2, TR6, Tango-63, hAPO8, TRICK2, or KILLER), DR6, DcRI, DcR2, DcR3 (also known as TR6 or M68), CARI, HVEM (also known as ATAR or TR2), GITR, ZTNFR-5, NTR-I, TNFLI, CD30, LTBr, 4-1BB receptor and TR9.
(49) In some embodiments the antigen binding domain is capable of binding one or more targets chosen from the group including, but not limited to, 5T4, ABL, ABCB5, ABCFI, ACVRI, ACVRIB, ACVR2, ACVR2B, ACVRLI, ADORA2A, Aggrecan, AGR2, AICDA, AIFI, AIGI, AKAPI, AKAP2, AMH, AMHR2, angiogenin (ANG), ANGPTI, ANGPT2, ANGPTL3, ANGPTL4, Annexin A2, ANPEP, APC, APOCI, AR, aromatase, ATX, AXI, AZGPI (zinc-a-glycoprotein), B7.1, B7.2, B7-H1, BAD, BAFF, BAG1, BAll, BCR, BCL2, BCL6, BDNF, BLNK, BLRI (MDR15), BlyS, BMP1, BMP2, BMP3B (GDFIO), BMP4, BMP6, BMP7, BMP8, BMP9, BMP11, BMP12, BMPR1A, BMPR1B, BMPR2, BPAGI (plectin), BRCAI, C19orflO (IL27w), C3, C4A, C5, C5R1, CANTI, CASPI, CASP4, CAVI, CCBP2 (D6/JAB61), CCLI (1-309), CCLI 1 (eotaxin), CCL13 (MCP-4), CCL15 (MIP-Id), CCL16 (HCC-4), CCL17 (TARC), CCL18 (PARC), CCL19 (MIP-3b), CCL2 (MCP-1), MCAF, CCL20 (MIP-3a), CCL21 (MEP-2), SLC, exodus-2, CCL22(MDC/STC-I), CCL23 (MPIF-1), CCL24 (MPIF-2/eotaxin-2), CCL25 (TECK), CCL26(eotaxin-3), CCL27 (CTACK/ILC), CCL28, CCL3 (MIP-Ia), CCL4 (MIP-Ib), CCL5(RANTES), CCL7 (MCP-3), CCL8 (mcp-2), CCNAI, CCNA2, CCNDI, CCNEI, CCNE2, CCRI (CKRI/HM145), CCR2 (mcp-IRB/RA), CCR3 (CKR3/CMKBR3), CCR4, CCR5(CMKBR5/ChemR13), CCR6 (CMKBR6/CKR-L3/STRL22/DRY6), CCR7 (CKR7/EBI1), CCR8 (CMKBR8/TERI/CKR-LI), CCR9 (GPR-9-6), CCRLI (VSHKI), CCRL2 (L-CCR), CD164, CD19, CDIC, CD20, CD200, CD-22, CD24, CD28, CD3, CD33, CD35, CD37, CD38, CD3E, CD3G, CD3Z, CD4, CD40, CD40L, CD44, CD45RB, CD46, CD52, CD69, CD72, CD74, CD79A, CD79B, CD8, CD80, CD81, CD83, CD86, CD105, CD137, CDHI (E-cadherin), CDCP1CDH10, CDH12, CDH13, CDH18, CDH19, CDH20, CDH5, CDH7, CDH8, CDH9, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK9, CDKNIA (p21WapI/CipI), CDKNIB (p27KipI), CDKNIC, CDKN2A (pl6INK4a), CDKN2B, CDKN2C, CDKN3, CEBPB, CERI, CHGA, CHGB, Chitinase, CHSTIO, CKLFSF2, CKLFSF3, CKLFSF4, CKLFSF5, CKLFSF6, CKLFSF7, CKLFSF8, CLDN3, CLDN7 (claudin-7), CLN3, CLU (clusterin), CMKLRI, CMKORI (RDCI), CNRI, COLI 8AI, COL1A1.COL4A3, COL6A1, CR2, Cripto, CRP, CSF1 (M-CSF), CSF2 (GM-CSF), CSF3 (GCSF), CTLA4, CTL8, CTNNBI (b-catenin), CTSB (cathepsin B), CX3CL1 (SCYDI), CX3CR1 (V28), CXCLI(GROI), CXCLIO (IP-IO), CXCL11 (1-TAC/IP-9), CXCL12 (SDFI), CXCL13, CXCL 14, CXCL 16, CXCL2 (GR02), CXCL3 (GR03), CXCL5 (ENA-78/LIX), CXCL6 (GCP-2), CXCL9 (MIG), CXCR3 (GPR9/CKR-L2), CXCR4, CXCR6 (TYMSTR/STRL33/Bonzo), CYB5, CYCI, Cyr61, CYSLTRI, c-Met, DAB21P, DES, DKFZp451J0118, DNCLI, DPP4, E2F1, ECGFI5EDGI, EFNAI, EFNA3, EFNB2, EGF, ELAC2, ENG, endoglin, ENOI, EN02, EN03, EPHAI, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6, EPHA7, EPHA8, EPHA9, EPHAIO, EPHBI, EPHB2, EPHB3, EPHB4, EPHB5, EPHB6, EPHRIN-AI, EPHRIN-A2, EPHRIN-A3, EPHRIN-A4, EPHRIN-A5, EPHRIN-A6, EPHRIN-BI, EPHRIN-B2, EPHRTN-B3, EPHB4, EPG, ERBB2 (Her-2), EREG, ERK8, Estrogen receptor, ESRI, ESR2, F3 (TF), FADD, farnesyltransferase, FasL, FASNf, FCER1A, FCER2, FCGR3A, FGF, FGF1 (aFGF), FGF10, FGF11, FGF12, FGF12B, FGF13, FGF14, FGF16, FGF17, FGF18, FGF19, FGF2 (bFGF), FGF20, FGF21 (such as mimAbl), FGF22, FGF23, FGF3 (int-2), FGF4 (HST), FGF5, FGF6 (HST-2), FGF7 (KGF), FGF8, FGF9, FGFR3, FIGF (VEGFD), FILI(EPSILON), FBLI (ZETA), FLJ12584, FLJ25530, FLRTI (fibronectin), FLTI, FLT-3, FOS, FOSLI(FRA-I), FY (DARC), GABRP (GABAa), GAGEBI, GAGECI, GALNAC4S-6ST, GATA3, GD2, GD3, GDF5, GDF8, GFII, GGTI, GM-CSF, GNASI, GNRHI, GPR2 (CCRIO), GPR31, GPR44, GPR81 (FKSG80), GRCCIO (CIO), gremlin, GRP, GSN (Gelsolin), GSTPI, HAVCR2, HDAC, HDAC4, HDAC5, HDAC7A, HDAC9, Hedgehog, HGF, HIFIA, HIPI, histamine and histamine receptors, HLA-A, HLA-DRA, HM74, HMOXI, HSP90, HUMCYT2A, ICEBERG, ICOSL, ID2, IFN-a, IFNAI, IFNA2, IFNA4, IFNA5, EFNA6, BFNA7, IFNB1, IFNgamma, IFNWI, IGBPI, IGF1, IGF1R, IGF2, IGFBP2, IGFBP3, IGFBP6, DL-I, ILIO, ILIORA, ILIORB, IL-1, ILIRI (CD121a), ILIR2(CD121b), IL-IRA, IL-2, IL2RA (CD25), IL2RB(CD122), IL2RG(CD132), IL-4, IL-4R(CD123), IL-5, IL5RA(CD125), IL3RB(CD131), IL-6, IL6RA (CD126), IR6RB(CD130), IL-7, IL7RA(CD127), IL-8, CXCRI (IL8RA), CXCR2 (IL8RB/CD128), IL-9, IL9R (CD129), IL-10, IL10RA(CD210), IL10RB(CDW210B), IL-11, ILI IRA, IL-12, IL-12A, IL-12B, IL-12RB1, IL-12RB2, IL-13, IL13RA1, IL13RA2, IL14, IL15, IL15RA, 1L16, IL17, IL17A, IL17B, IL17C, IL17R, IL18, IL18BP, IL18R1, IL18RAP, IL19, IL1A, IL1B, IL1F10, IL1F5, IL1F6, IL1F7, IL1F8, DL1F9, IL1HYI, IL1R1, IL1R2, IL1RAP, IL1RAPL1, IL1RAPL2, IL1RL1, IL1RL2, IL1RN, IL2, IL20, IL20RA, IL21R, IL22, IL22R, IL22RA2, IL23, DL24, IL25, IL26, IL27, IL28A, IL28B, IL29, IL2RA, IL2RB, IL2RG, IL3, IL30, IL3RA, IL4, IL4R, IL6ST (glycoprotein 130), ILK, INHA, INHBA, INSL3, INSL4, IRAKI, IRAK2, ITGA1, ITGA2, ITGA3, ITGA6 (α 6 integrin), ITGAV, ITGB3, ITGB4 (β 4 integrin), JAK1, JAK3, JTB, JUN, K6HF, KAII, KDR, KIM-1, KITLG, KLF5 (GC Box BP), KLF6, KLK10, KLK12, KLK13, KLK14, KLK15, KLK3, KLK4, KLK5, KLK6, KLK9, KRT1, KRT19 (Keratin 19), KRT2A, KRTHB6 (hair-specific type II keratin), LAMA5, LEP (leptin), Lingo-p75, Lingo-Troy, LPS, LRP5, LRP6, LTA (TNF-b), LTB, LTB4R (GPR16), LTB4R2, LTBR, MACMARCKS, MAG or Omgp, MAP2K7 (c-Jun), MCP-I, MDK, MIBI, midkine, MIF, MISRII, MJP-2, MK, MK167 (Ki-67), MMP2, MMP9, MS4A1, MSMB, MT3 (metallothionectin-Ui), mTOR, MTSSI, MUCI (mucin), MYC, MYD88, NCK2, neurocan, neuregulin-1, neuropilin-1, NFKBI, NFKB2, NGFB (NGF), NGFR, NgR-Lingo, NgR-Nogo66 (Nogo), NgR-p75, NgR-Troy, NMEI (NM23A), NOTCH, NOTCH1, N0X5, NPPB, NROBI, NROB2, NRIDI, NR1D2, NR1H2, NR1H3, NR1H4, NR1I2, NR1I3, NR2C1, NR2C2, NR2E1, NR2E3, NR2F1, NR2F2, NR2F6, NR3C1, NR3C2, NR4A1, NR4A2, NR4A3, NR5A1, NR5A2, NR6A1, NRPI, NRP2, NT5E, NTN4, OCT-1, ODZ1, OPN1, OPN2, OPRDI, P2RX7, PAP, PARTI, PATE, PAWR, PCA3, PCDGF, PCNA, PDGFA, PDGFB, PDGFRA, PDGFRB, PECAMI, peg-asparaginase, PF4 (CXCL4), Plexin B2 (PLXNB2), PGF, PGR, phosphacan, PIAS2, PI3 Kinase, PIK3CG, PLAU (uPA), PLG5PLXDCI, PKC, PKC-β, PPBP (CXCL7), PPID, PRI, PRKCQ, PRKDI, PRL, PROC, PROK2, pro-NGF, prosaposin, PSAP, PSCA, PTAFR, PTEN, PTGS2 (COX-2), PTN, RAC2 (P21Rac2), RANK, RANK ligand, RARE, RGSI, RGS13, RGS3, RNFI10 (ZNF144), Ron, ROB02, RXR, selectin, S100A2, S100A8, S100A9, SCGB 1D2 (lipophilin B), SCGB2A1 (mammaglobin 2), SCGB2A2 (mammaglobin 1), SCYEI (endothelial Monocyte-activating cytokine), SDF2, SERPENA1, SERPINA3, SERPINB5 (maspin), SERPINEI (PAI-I), SERPINFI, SHIP-I, SHIP-2, SHBI, SHB2, SHBG, SfcAZ, SLC2A2, SLC33A1, SLC43A1, SLIT2, SPPI, SPRRIB (Sprl), ST6GAL1, STABI, STAT6, STEAP, STEAP2, SULF-1, Sulf-2, TB4R2, TBX21, TCPIO, TDGFI, TEK, TGFA, TGFB1, TGFBIII, TGFB2, TGFB3, TGFBI, TGFBRI, TGFBR2, TGFBR3, THIL, THBSI (thrombospondin-1), THBS2/THBS4, THPO, TIE (Tie-1), TIMP3, tissue factor, TIKI2, TLR10, TLR2, TLR3, TLR4, TLR5, TLR6JLR7, TLR8, TLR9, TM4SF1, TNF, TNF-a, TNFAIP2 (B94), TNFAIP3, TNFRSFIIA, TNFRSFIA, TNFRSFIB, TNFRSF21, TNFRSF5, TNFRSF6 (Fas), TNFRSF7, TNFRSF8, TNFRSF9, TNFSFIO (TRAIL), TNFSFI 1 (TRANCE), TNFSF12 (AP03L), TNFSF13 (April), TNFSF13B, TNFSF14 (HVEM-L), TNFSF15 (VEGI), TNFSF 18, TNFSF4 (OX40 ligand), TNFSF5 (CD40 ligand), TNFSF6 (FasL), TNFSF7 (CD27 ligand), TNFSF8 (CD30 ligand), TNFSF9 (4-1BB ligand), TOLLIP, Toll-like receptors, TLR2, TLR4, TLR9, TOP2A (topoisomerase lia), TP53, TPMI, TPM2, TRADD, TRAFI, TRAF2, TRAF3, TRAF4, TRAF5, TRAF6, TRKA, TREMI, TREM2, TRPC6, TROY, TSLP, TWEAK, Tyrosinase, uPAR, VEGF, VEGFB, VEGFC, versican, VHL C5, VLA-4, Wnt-1, XCLI (lymphotactin), XCL2 (SCM-Ib), XCRI (GPR5/CCXCRI), YYI, and ZFPM2.
(50) In some embodiments, the antibody, or antigen-binding fragment thereof, binds to extra-domain B (EDB) of fibronectin (FN). FN-EDB is a small domain of 91 amino acids, which can be inserted into fibronectin molecules by a mechanism of alternative splicing. The amino acid sequence of FN-EDB is 100% conserved between human, cynomolgus monkey, rat and mouse. FN-EDB is overexpressed during embryonic development and broadly expressed in human cancers, but virtually undetectable in normal adult except female reproductive tissues.
(51) In some embodiments, the antibody or antigen binding fragment thereof binds to an antigen selected from the group consisting of: HER2, HER3, HER4, CD22, and CD33. In some embodiments, the antibody or antigen binding fragment thereof binds to Her2. In some embodiments, the antibody comprises trastuzumab. In some embodiments, the antibody or antigen binding fragment thereof binds to CD33.
(52) Table 18 provides the amino acid (protein) and nucleic acid sequences of CD33 antibody used in constructing exemplary site specific ADCs of the invention. The CDRs shown are defined by Kabat and Chothia numbering. The heavy chain constant region and light chain constant region were altered to contain on or more modifications to allow for site specific conjugation when making the exemplary ADCs of the invention. Modifications to the amino acid sequences in the antibody constant region to allow for site specific conjugation (positions 334 and 392) are underlined and bolded. In the instant disclosure, the nomenclature for the modified antibodies is the antigen (e.g., CD33 or Her2) followed by a dash and then the position of the amino acid of modification flanked by the single letter amino acid code for the wild type residue and the single letter amino acid code for the residue that is now in that position in the modified antibody (e.g., CD33-K334C or Her2-K392C).
(53) In certain embodiments, the antibody, or antigen-binding fragment thereof, described herein comprises the following heavy chain CDR sequences: (i) a VH complementarity determining region one (CDR-H1) sharing at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95% identity to SEQ ID NO: 5 or 6, a CDR-H2 sharing at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95% identity with SEQ ID NO: 9 or 10, and a CDR-H3 sharing at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95% identity with SEQ ID NO: 13; and/or (ii) the following light chain CDR sequences: a VL complementarity determining region one (CDR-L1) sharing at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95% identity with SEQ ID NO: 17, a CDR-L2 sharing at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95% identity with SEQ ID NO: 19, and a CDR-L3 sharing at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, or at least 95% identity with SEQ ID NO: 21.
(54) In certain embodiments, the antibody or antigen-binding fragment thereof described herein comprises (i) a heavy chain variable region (VH) comprising an amino acid sequence that is at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 1, and/or (ii) light chain variable region (VL) comprising an amino acid sequence that is at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 3. Any combination of these VL and VH sequences is also encompassed by the invention.
(55) In certain embodiments, the antibody or antigen-binding fragment thereof described herein comprises an Fc domain. The Fc domain can be derived from IgA (e.g., IgA.sub.1 or IgA.sub.2), IgG, IgE, or IgG (e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4).
(56) In certain embodiments, the antibody or antigen-binding fragment thereof described herein comprises (i) a heavy chain comprising an amino acid sequence that is at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 15, 32, 33 or 34 and/or (ii) a light chain comprising an amino acid sequence that is at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 23. The heavy chain constant domain comprises an engineered cysteine at position 334 and/or position 392 (according to Eu index of Kabat) either alone or in combination with other positions. Any combination of these heavy chain and light chain sequences is also encompassed by the invention.
(57) The invention provides a nucleic acid encoding an engineered polypeptide described herein. The invention also provides a nucleic acid encoding an antibody comprising an engineered polypeptide described herein.
(58) The invention also provides a host cell comprising a nucleic acid encoding the engineered polypeptide described herein. The invention also provides a host cell comprising a nucleic acid encoding an antibody comprising the engineered polypeptide described herein.
(59) The invention provides a nucleic acid encoding an antibody, or antigen-binding fragment thereof, of any one of the CD33 antibodies disclosed herein, and a host cell comprising such a nucleic acid.
(60) The invention provides a method of producing an engineered polypeptide described herein, or antibody, or antigen-binding portion thereof, comprising such an engineered polypeptide. The method comprises culturing the host cell under suitable conditions for expressing the polypeptide, the antibody, or antigen-binding portion thereof, and isolating the polypeptide, or the antibody or antigen-binding fragment.
(61) B. Drugs
(62) Drugs useful in preparation of the site specific ADCs of the invention include any therapeutic agent useful in the treatment of cancer including, but not limited to, cytotoxic agents, cytostatic agents, immunomodulating agents and chemotherapeutic agents. A cytotoxic effect refers to the depletion, elimination and/or the killing of a target cells (i.e., tumor cells). A cytotoxic agent refers to an agent that has a cytotoxic effect on a cell. A cytostatic effect refers to the inhibition of cell proliferation. A cytostatic agent refers to an agent that has a cytostatic effect on a cell, thereby inhibiting the growth and/or expansion of a specific subset of cells (i.e., tumor cells). An immunomodulating agent refers to an agent that stimulates the immune response though the production of cytokines and/or antibodies and/or modulating T cell function thereby inhibiting or reducing the growth of a subset of cells (i.e., tumor cells) either directly or indirectly by allowing another agent to be more efficacious. A chemotherapeutic agent refers to an agent that is a chemical compound useful in the treatment of cancer. A drug may also be a drug derivative, wherein a drug has been functionalized to enable conjugation with an antibody of the invention.
(63) In some embodiments the drug is a membrane permeable drug. In such embodiments, the payload can elicit a bystander effect wherein cells surrounding the cell that initially internalized the ADC are killed by the payload. This occurs when the payload is released from the antibody (i.e., by cleaving of a cleavable linker) and crosses the cellular membrane and, upon diffusion, induces the killing of surrounding cells.
(64) In accordance with the disclosed methods, the drugs are used to prepare antibody drug conjugates of the formula Ab-(L-D), wherein (a) Ab is an antibody that binds to a specific target; and (b) L-D is a linker-drug moiety, wherein L is a linker, and D is a drug.
(65) The drug-to-antibody ratio (DAR) or drug loading indicates the number of drug (D) molecules that are conjugated per antibody. The antibody drug conjugates of the present invention use site specific conjugation such that there is essentially a homogeneous population of ADCs having one DAR in a composition of ADCs. In some embodiments, the DAR is about 1, 2, 3, 4, or greater. In some embodiments, the DAR is 1. In some embodiments, the DAR is 2. In other embodiments, the DAR is 3. In other embodiments, the DAR is 4. In other embodiments, the DAR is greater than 4.
(66) Using conventional conjugation (rather than site specific conjugation) results in a heterogeneous population of different species of ADCs, each of which with a different individual DAR. Compositions of ADCs prepared in this way include a plurality of antibodies, each antibody conjugated to a particular number of drug molecules. As such, the compositions have an average DAR. T-DM1 (Kadcyla®) uses conventional conjugation on lysine residues and has an average DAR of around 4 with a broad distribution including ADCs loaded with 0, 1, 2, 3, 4, 5, 6, 7 or 8 drug molecules (Kim et al., 2014, Bioconj Chem 25(7):1223-32).
(67) DAR can be determined by various conventional means such as UV spectroscopy, mass spectroscopy, ELISA assay, radiometric methods, hydrophobic interaction chromatography (HIC), electrophoresis and HPLC.
(68) In one embodiment, the drug component of the ADCs of the invention is a DNA alkylating agent. In some embodiments, the DNA alkylating agent is a DNA minor groove binding alkylating agent. In some embodiments, the DNA minor groove binding alkylating agent is a CPI, a CTI, or a CBI dimer.
(69) As used herein, CPI refers to 1,2,8,8a-tetrahydrocyclopropa[c]pyrrolo[3,2-e]indol-4(5H)-one or a substituted or a derivatized form thereof. CPI can also refer to the seco form of CPI, or seco-CPI, which is also known as 8-(chloromethyl)-1-methyl-3,6,7,8-tetrahydropyrrolo[3,2-e]indol-4-ol, or a substituted or derivatized form (or forms) thereof. CPI dimers induce inter-strand DNA crosslinking and potent cytotoxicity.
(70) As used herein, CBI refers to 1,2,9,9a-tetrahydro-4H-benzo[e]cyclopropa[c]indol-4-one, or a substituted or a derivatized form thereof. CBI can also refer to the seco form of CBI, or seco-CBI, which is also known as 1-(chloromethyl)-2,3-dihydro-1H-benzo[e]indol-5-ol, or a substituted or derivatized form (or forms) thereof.
(71) As used herein, CTI refers to 1,2,8,8a-tetrahydro-4H-cyclopropa[c]thieno[3,2-e]indol-4-one, or a substituted or a derivatized form thereof. CTI can also refer to the seco form of CTI, or seco-CTI, which is also known as 8-(chloromethyl)-1-methyl-7,8-dihydro-6H-thieno[3,2-e]indol-4-01, or a substituted or derivatized form (or forms) thereof.
(72) Two CBI and/or CPI and/or CTI cores may be linked together to form a dimeric species (so called CBI dimers, CPI dimers, CTI dimers, CBI/CPI dimers, CBI/CTI dimers, or CPI/CTI dimers).
(73) PCT International Publication No. WO2015/110935, which is incorporated herein by reference in its entirety, discloses CPI and CBI dimers that are useful in the ADCs of the present invention and provides methods of producing the CPI and CBI dimers. PCT International Publication No. WO2016/151432, which is incorporated herein by reference in its entirety, discloses CTI dimers that are useful in the ADCs of the present invention and provides methods of producing the CTI dimers.
(74) In some embodiments, the drug component of the ADCs of the present disclosure is a compound of Formula I:
F.sub.1-DL-F.sub.2 (Formula I),
or a pharmaceutically acceptable salt or solvate thereof, wherein:
F.sub.1 is a CPI monomer comprising:
(75) ##STR00011##
wherein
R.sub.1 is H, —OH, —O-acyl, azido, halo (F, Cl, Br, I), sulfonate (—OSO.sub.2R), cyanate, thiocyanate, isocyanate, or thioisocyanate;
R.sub.2 is R.sub.2 is H, —OH, —SH, NHR, acyl, acetate, phosphate, glucuronide, or galactoside;
R.sub.3 is H, —C.sub.1-C.sub.5 substituted or unsubstituted alkyl, substituted or unsubstituted phenyl, —C(O)OR, —C(O)SR, —C(O)NHN(R).sub.2, or —C(O)N(R).sub.2;
F.sub.2 is a CPI monomer comprising:
(76) ##STR00012##
wherein
R.sub.4 is H, —OH, —O-acyl, azido, halo (F, Cl, Br, I), sulfonate (—OSO.sub.2R), cyanate, thiocyanate, isocyanate, or thioisocyanate;
R.sub.5 is H, —OH, —SH, NHR, acyl, acetate, phosphate, glucuronide, or galactoside;
R.sub.6 is H, —C.sub.1-C.sub.5 substituted or unsubstituted alkyl, substituted or unsubstituted phenyl, —C(O)OR, —C(O)SR, —C(O)NHN(R).sub.2, or —C(O)N(R).sub.2;
R is selected from the group consisting of H, —C.sub.1-C.sub.20 alkyl, —C.sub.2-C.sub.6 alkenyl, —C.sub.2-C.sub.6 alkynyl, halo, hydroxyl, alkoxy, —NH.sub.2, —NH(C.sub.1-C.sub.8 alkyl), —N(C.sub.1-C.sub.8 alkyl).sub.2, —NO.sub.2, —C.sub.6-C.sub.14 aryl and —C.sub.6-C.sub.14 heteroaryl, wherein two or more R optionally join to form a ring or rings, and wherein said —C.sub.6-C.sub.14 aryl and —C.sub.6-C.sub.14 heteroaryl are optionally substituted with 1 to 5 substituents independently from —C.sub.1-C.sub.10 alkyl, —C.sub.1-C.sub.10 alkoxy, halo, —C.sub.1-C.sub.10 alkylthio, trifluoromethyl, —NH.sub.2, —NH(C.sub.1-C.sub.8 alkyl), —N(C.sub.1-C.sub.8 alkyl).sub.2, —C.sub.1-C.sub.10 alkyl-N(C.sub.1-C.sub.8 alkyl).sub.2, —C.sub.1-C.sub.3 alkylthio, —NO.sub.2, or —C.sub.1-C.sub.10 heterocyclyl for each ring system in which R appears;
DL is a dimer-linker comprising: R.sub.7—X—R.sub.8, wherein
R.sub.7 and R.sub.8 are each independently selected from a direct bond, carbonyl, or a carbonyl acyl group bonded to F.sub.1 or F.sub.2 at the free nitrogen atom of the saturated five-membered ring; and
X is a —C.sub.1-C.sub.20 substituted or unsubstituted alkyl chain, a —C.sub.1-C.sub.20 substituted or unsubstituted fused or bridged cycloalkyl, or a substituted or unsubstituted saturated or aromatic heterocyclic ring comprised of from 3-20 atoms selected from C, N, O, and/or S.
(77) In some embodiments, the drug component of the ADCs of the invention is:
(78) ##STR00013##
(79) In some embodiments, R.sub.1 is a halo (F, Cl, Br, I) or suphonate (—OSO.sub.2R), R.sub.2 is —OH, phosphate, glucuronide or galactoside, R.sub.3 is a C.sub.1-C.sub.5 unsubstituted or substituted alkyl, R.sub.4 is a halo (F, Cl, Br, I) or suphonate (—OSO.sub.2R), R.sub.5 is —OH, phosphate glucuronide or galactoside, and R.sub.6 is a C.sub.1-C.sub.5 unsubstituted or substituted alkyl. In some embodiments, R.sub.1 is halo. In some embodiments, R.sub.1 is Cl. In some embodiments, R.sub.1 is sulfonate. In some embodiments, R.sub.2 is —OH. In some embodiments, R.sub.2 is a phosphate group. In some embodiments, R.sub.3 is a C.sub.3 or C.sub.5 unsubstituted or substituted alkyl group. In some embodiments, R.sub.3 is a methyl group. In some embodiments, R.sub.4 is halo. In some embodiments, R.sub.4 is Cl. In some embodiments, R.sub.4 is sulfonate. In some embodiments, R.sub.5 is —OH. In some embodiments, R.sub.5 is a phosphate group. In some embodiments, R.sub.6 is a C.sub.3 or C.sub.5 unsubstituted or substituted alkyl group. In some embodiments, R.sub.6 is a methyl group.
(80) In some embodiments, R.sub.1 is Cl, R.sub.2 is phosphate, R.sub.3 is methyl, R.sub.4 is Cl, R.sub.5 is —OH, and R.sub.6 is methyl. In some embodiments, R, is Cl, R.sub.2 is —OH, R.sub.3 is methyl, R.sub.4 is Cl, R.sub.5 is phosphate group, and R.sub.6 is methyl. In some embodiments, the drug component of the ADCs of the invention is selected from the group consisting of:
(81) ##STR00014##
(82) In some embodiments, R.sub.7 and R.sub.8 of the dimer-linker (DL) each independently is a carbonyl. In some embodiments, X is C.sub.1-C.sub.20 substituted or unsubstituted alkyl chain, a C.sub.1-C.sub.20 substituted or unsubstituted fused or bridged cycloalkyl, or a substituted or unsubstituted saturated or aromatic heterocyclic ring comprised of from 3-20 atoms selected from C, N, O, and/or S. In some embodiments, R.sub.7 and R.sub.8each independently is a carbonyl, and X is a —C.sub.5-C.sub.10 substituted or unsubstituted alkyl chain, a —C.sub.5-C.sub.10 substituted or unsubstituted fused or bridged cycloalkyl, or a substituted or unsubstituted saturated or aromatic heterocyclic ring comprised of from 5-10 atoms selected from C, N, O, and/or S. In some embodiments, R.sub.7 and R.sub.8 each independently is a carbonyl, and X is a C.sub.5 or a C.sub.8 substituted or unsubstituted alkyl chain, a C.sub.5 or a C.sub.8 substituted or unsubstituted fused or bridged cycloalkyl, or a substituted or unsubstituted saturated or aromatic heterocyclic ring comprised of 5 or 8 atoms selected from C, N, O, and/or S.
(83) In some embodiments, the drug component of the ADCs of the invention is selected from the group consisting of:
(84) ##STR00015##
(85) In some embodiments, the CPI dimer is selected from the group consisting of:
(86) ##STR00016##
(87) In some embodiments, the drug/payload is selected from the group disclosed in Table 1.
(88) TABLE-US-00001 TABLE 1 Drugs Payload ID Structure IUPAC Name P1
(89) In some embodiments, the drug is P5 ((8S)-8-(chloromethyl)-6-[(3-{[(1S)-1-(chloromethyl)-5-hydroxy-8-methyl-1,6-dihydropyrrolo[3,2-e]indol-3(2H)-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-1-methyl-3,6,7,8-tetrahydropyrrolo[3,2-e]indol-4-yl dihydrogen phosphate).
(90) In some aspects of the invention, the cytotoxic agent can be made using a liposome or biocompatible polymer. The antibodies as described herein can be conjugated to the biocompatible polymer to increase serum half-life and bioactivity, and/or to extend in vivo half-lives. Examples of biocompatible polymers include water-soluble polymer, such as polyethylene glycol (PEG) or its derivatives thereof and zwitterion-containing biocompatible polymers (e.g., a phosphorylcholine containing polymer).
(91) C. Linkers
(92) Site specific ADCs of the invention are prepared using a linker to link or conjugate a drug to an antibody. A linker is a bifunctional compound which can be used to link a drug and an antibody to form an antibody drug conjugate (ADC). Such conjugates allow the selective delivery of drugs to tumor cells. Suitable linkers include, for example, cleavable and non-cleavable linkers. A cleavable linker is typically susceptible to cleavage under intracellular conditions. Major mechanisms by which a conjugated drug is cleaved from an antibody include hydrolysis in the acidic pH of the lysosomes (hydrazones, acetals, and cis-aconitate-like amides), peptide cleavage by lysosomal enzymes (the cathepsins and other lysosomal enzymes), and reduction of disulfides. As a result of these varying mechanisms for cleavage, mechanisms of linking the drug to the antibody also vary widely and any suitable linker can be used.
(93) Suitable cleavable linkers include, but are not limited to, a peptide linker, such as mc-vc, MalPeg6-vc, and m(H20)c-vc, cleavable by an intracellular protease (Table 2 infra). In specific embodiments, the linker is a cleavable linker such that the payload can induce a bystander effect once the linker is cleaved. The bystander effect is when a membrane permeable drug is released from the antibody (i.e., by cleaving of a cleavable liner) and crosses the cellular membrane and, upon diffusion, induce killing of cells surrounding the cell that initially internalized the ADC.
(94) Suitable non-cleavable linkers include, but are not limited to, mc, MalPeg6, Mal-PEG2, Mal-PEG3 and m(H20)c (Table 2 infra).
(95) Other suitable linkers include linkers hydrolyzable at a specific pH or a pH range, such as a hydrazone linker. Additional suitable cleavable linkers include disulfide linkers. The linker may be covalently bound to the antibody to such an extent that the antibody must be degraded intracellularly in order for the drug to be released e.g. the mc linker and the like.
(96) In particular aspects of the invention, the linker in the site specific ADCs of the invention are cleavable and may be vc, MalPeg6-vc-PABC or MalPeg6-vc-PABC-DMAE.
(97) Many of the therapeutic agents conjugated to antibodies have little, if any, solubility in water and that can limit drug loading on the conjugate due to aggregation of the conjugate. One approach to overcoming this is to add solublizing groups to the linker. Conjugates made with a linker consisting of PEG and a dipeptide can been used, including those having a PEG di-acid, thiol-acid, or maleimide-acid attached to the antibody, a dipeptide spacer, and an amide bond to the amine of an anthracycline or a duocarmycin analogue. Another example is a conjugate prepared with a PEG-containing linker disulfide bonded to a cytotoxic agent and amide bonded to an antibody. Approaches that incorporate PEG groups may be beneficial in overcoming aggregation and limits in drug loading.
(98) TABLE-US-00002 TABLE 2 Linkers Name Structure vc (MC-vc-PAB)
(99) Linkers are attached to the monoclonal antibody via the left side of the molecule and the drug via the right side of the molecule as depicted in Table 2.
(100) Additional non-limiting examples of linkers are provided in Table 3.
(101) TABLE-US-00003 TABLE 3 Additional Linkers LP1- link- er
(102) In certain embodiments, the antibody drug conjugates comprise linkers LP1, LP2, LP3 or LP4 (Table 3).
(103) In certain embodiment, the antibody of the invention is conjugated to a thiol-reactive agent in which the reactive group is, for example, a maleimide, an iodoacetamide, a pyridyl disulfide, or other thiol-reactive conjugation partner (Haugland, 2003, Molecular Probes Handbook of Fluorescent Probes and Research Chemicals, Molecular Probes, Inc.; Brinkley, 1992, Bioconjugate Chem. 3:2; Garman, 1997, Non-Radioactive Labelling: A Practical Approach, Academic Press, London; Means (1990) Bioconjugate Chem. 1:2; Hermanson, G. in Bioconjugate Techniques (1996) Academic Press, San Diego, pp. 40-55, 643-671).
(104) PCT publication no. WO 2018/025168, which is incorporated herein by reference in its entirety, discloses non-maleimide based linkers and linker components that are useful in the ADCs of the present invention and provides methods of preparing these linkers.
(105) In certain embodiments, the invention provides an antibody drug conjugate of the formula Ab-(L-D), wherein (a) Ab is an antibody that binds to a specific target; and (b) L-D is a linker-drug moiety, wherein L is a linker, and D is a drug.
(106) In certain embodiments, the Ab-(L-D) comprises a succinimide group, a maleimide group, a hydrolyzed succinimide group, or a hydrolyzed maleimide group.
(107) In certain embodiments, the Ab-(L-D) comprises a maleimide group, a hydrolyzed maleimide group or hydrolyzed Peg-maleimides. Maleimides such as N-ethylmaleimide are considered to be specific to sulfhydryl groups, especially at pH values below 7, where other groups are protonated.
(108) In certain embodiments, the Ab-(L-D) comprises 6-maleimidocaproyl (MC), maleimidopropanoyl (MP), valine-citrulline (val-cit; vc), methoxy-polyethylene glycol maleimide 6 (MalPeg6), p-aminobenzylcarbamate (PABC), dimethylaminoethanol (DMAE), alanine-phenylalanine (ala-phe), p-aminobenzyloxycarbonyl (PAB), N-Succinimidyl (4-iodo-acetyl) aminobenzoate (SIAB), or 6-maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (MC-vc-PAB) or a combination thereof. In some embodiments, the linker comprises a combination of MalPeg6, vc, PABC, and DMAE. In some embodiments, the linker comprises MalPeg6-vc-PABC-DMAE.
(109) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(110) ##STR00037##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(1S)-1-(chloromethyl)-3-[(5-{[(1S)-1-(chloromethyl)-5-(phosphonooxy)-1,2-dihydro-3H-benzo[e]indol-3-yl]carbonyl}thiophen-2-yl)carbonyl]-2,3-dihydro-1H-benzo[e]indol-5-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
(111) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(112) ##STR00038##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(1S)-1-(chloromethyl)-3-[(5-{[(1S)-1-(chloromethyl)-5-(phosphonooxy)-1,2-dihydro-3H-benzo[e]indol-3-yl]carbonyl}thiophen-2-yl)carbonyl]-2,3-dihydro-1H-benzo[e]indol-5-yl}oxy)carbonyl](ethyl)amino}ethyl)(ethyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
(113) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(114) ##STR00039##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N.sup.5-(4-{7-[({(1S)-1-(chloromethyl)-3-[(5-{[(1S)-1-(chloromethyl)-5-(phosphonooxy)-1,2-dihydro-3H-benzo[e]indol-3-yl]carbonyl}thiophen-2-yl)carbonyl]-2,3-dihydro-1H-benzo[e]indol-5-yl}oxy)carbonyl]-4-(2-methoxyethyl)-3-oxo-2,10-dioxa-4,7-diazaundec-1-yl}phenyl)-L-ornithinamide).
(115) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(116) ##STR00040##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N-(4-{7-[({(1S)-1-(chloromethyl)-3-[(5-{[(1S)-1-(chloromethyl)-5-(phosphonooxy)-1,2-dihydro-3H-benzo[e]indol-3-yl]carbonyl}thiophen-2-yl)carbonyl]-2,3-dihydro-1H-benzo[e]indol-5-yl}oxy)carbonyl]-4-(2-methoxyethyl)-3-oxo-2,10-dioxa-4,7-diazaundec-1-yl}phenyl)-L-alaninamide).
(117) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(118) ##STR00041##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(1S)-1-(chloromethyl)-3-[(4-{[(1S)-1-(chloromethyl)-5-(phosphonooxy)-1,2-dihydro-3H-benzo[e]indol-3-yl]carbonyl}pentacyclo[4.2.0.0.sup.2,5.0.sup.3,8.0.sup.4,7]oct-1-yl)carbonyl]-2,3-dihydro-1H-benzo[e]indol-5-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
(119) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(120) ##STR00042##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(1S)-1-(chloromethyl)-3-[(3-{[(1S)-1-(chloromethyl)-5-(phosphonooxy)-1,2-dihydro-3H-benzo[e]indol-3-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-2,3-dihydro-1H-benzo[e]indol-5-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
(121) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(122) ##STR00043##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N-carbamoyl-N-[4-({[(2-{[({(8S)-8-(chloromethyl)-6-[(3-{[(1S)-1-(chloromethyl)-8-methyl-5-(phosphonooxy)-1,6-dihydropyrrolo[3,2-e]indol-3(2H)-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-1-methyl-3,6,7,8-tetrahydropyrrolo[3,2-e]indol-4-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
(123) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(124) ##STR00044##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(8S)-8-(chloromethyl)-6-[(3-{[(8S)-8-(chloromethyl)-1-methyl-4-(phosphonooxy)-7,8-dihydro-6H-thieno[3,2-e]indol-6-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-1-methyl-7,8-dihydro-6H-thieno[3,2-e]indol-4-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)-phenyl]-L-ornithinamide).
(125) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(126) ##STR00045##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[{2-[({[(8S)-8-(chloromethyl)-6-{5-[(8S)-8-(chloromethyl)-1-methyl-4-(phosphonooxy)-7,8-dihydro-6H-thieno[3,2-e]indol-6-yl]-5-oxopentanoyl}-1-methyl-7,8-dihydro-6H-thieno[3,2-e]indol-4-yl]oxy}carbonyl)(methyl)amino]ethyl}(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
(127) In certain embodiments, the linker-drug (L-D) component of the ADC comprises:
(128) ##STR00046##
(N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[{2-[({[(8S)-8-(chloromethyl)-6-{5-[(8S)-8-(chloromethyl)-4-(beta-D-glucopyranuronosyloxy)-1-methyl-7,8-dihydro-6H-thieno[3,2-e]indol-6-yl]-5-oxopentanoyl}-1-methyl-7,8-dihydro-6H-thieno[3,2-e]indol-4-yl]oxy}carbonyl)(methyl)amino]ethyl}(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide).
D. Methods of Preparing Site Specific ADCs
(129) Also provided are methods for preparing antibody drug conjugates of the present invention. For example, a process for producing a site specific ADC as disclosed herein can include (a) linking the linker to the drug; (b) conjugating the linker drug moiety to the antibody; and (c) purifying the antibody drug conjugate.
(130) The ADCs of the present invention use site specific methods to conjugate the antibody to the drug payload.
(131) In one embodiment, the site specific conjugation occurs through one or more cysteine residues that have been engineered into an antibody constant region. Methods of preparing antibodies for site specific conjugation through cysteine residues can be performed as described in PCT Publication No. WO2013/093809, which is incorporated by reference in its entirety. The engineered cysteine can be at position 334 and/or position 392 (according to the numbering of the Eu index of Kabat). Additionally, one or more of the following positions can be altered to be a cysteine and thus also serve as a site for conjugation: a) on the heavy chain constant region, residues 246, 249, 265, 267, 270, 276, 278, 283, 290, 292, 293, 294, 300, 302, 303, 314, 315, 318, 320, 327, 332, 333, 336, 345, 347, 354, 355, 358, 360, 362, 370, 373, 376, 378, 380, 382, 386, 388, 390, 393, 401, 404, 411, 413, 414, 416, 418, 419, 421, 428, 431, 432, 437, 438, 439, 443, and 444 (according to the Eu index of Kabat for the heavy chain) and/or b) on the light chain constant region, residues 110, 111, 125, 149, 155, 158, 161, 183, 185, 188, 189, 191, 197, 205, 206, 207, 208, and 210 (according to the Kabat numbering for light chain).
(132) In certain embodiments, the one or more positions that may be altered to be a cysteine on the heavy chain constant region are 334 or 392 (according to the Eu index of Kabat for the heavy chain). In a more specific embodiment, positions 334 and 392 on the heavy chain constant region according to the Eu index of Kabat are altered to cysteine for conjugation.
(133) In certain embodiments, the one or more positions that may be altered to be a cysteine a) on the heavy chain constant region are 290, 334, 392 and/or 347 (according to the Eu index of Kabat for the heavy chain) and/or b) on the light chain constant region is 183 (according to the Kabat numbering for the light chain).
(134) Optimal reaction conditions for formation of a conjugate may be empirically determined by variation of reaction variables such as temperature, pH, linker-payload moiety input, and additive concentration. Conditions suitable for conjugation of other drugs may be determined by those skilled in the art without undue experimentation. Site specific conjugation through engineered cysteine residues is exemplified in Examples 1 and 3 infra.
(135) To further increase the number of drug molecules per antibody drug conjugate, the drug may be conjugated to polyethylene glycol (PEG), including straight or branched polyethylene glycol polymers and monomers. A PEG monomer is of the formula: —(CH.sub.2CH.sub.2O)—. Drugs and/or peptide analogs may be bound to PEG directly or indirectly, i.e. through appropriate spacer groups such as sugars. A PEG-antibody drug composition may also include additional lipophilic and/or hydrophilic moieties to facilitate drug stability and delivery to a target site in vivo. Representative methods for preparing PEG-containing compositions may be found in, e.g., U.S. Pat. Nos. 6,461,603; 6,309,633; and 5,648,095.
(136) Following conjugation, the conjugates may be separated and purified from unconjugated reactants and/or aggregated forms of the conjugates by conventional methods. This can include processes such as size exclusion chromatography (SEC), ultrafiltration/diafiltration, ion exchange chromatography (IEC), chromatofocusing (CF) HPLC, FPLC, or Sephacryl S-200 chromatography. The separation may also be accomplished by hydrophobic interaction chromatography (HIC). Suitable HIC media includes Phenyl Sepharose 6 Fast Flow chromatographic medium, Butyl Sepharose 4 Fast Flow chromatographic medium, Octyl Sepharose 4 Fast Flow chromatographic medium, Toyopearl Ether-650M chromatographic medium, Macro-Prep methyl HIC medium or Macro-Prep t-Butyl HIC medium.
(137) Table 4 shows ADCs with antibodies to CD33, Her2 and 1.1 used to generate data in the Examples Section. The site specific CD33, Her2 and 1.1 ADCs shown in Table 4 are examples of site specific ADCs of the invention.
(138) To make a site specific ADC of the invention any antibody disclosed herein can be conjugated using site specific techniques to any drug disclosed herein via any linker disclosed herein. In certain embodiments, the linker is cleavable (e.g., vc). In certain embodiments, the drug is a CPI or CBI dimer.
(139) Polypeptides, antibodies and ADCs of the invention may be site-specific conjugated through an engineered cysteine at position 334 (according to the numbering of the Eu index of Kabat). The IgG1 antibody heavy chain CH2 region is shown in SEQ ID NO:25 (Table 18; K334, using the numbering of the Eu index of Kabat, is bold and underlined). The IgG1 antibody heavy chain CH2 and CH3 regions are shown in SEQ ID NO:26 (Table 18; K334 and K392, using the numbering of the Eu index of Kabat, are bold and underlined).
(140) TABLE-US-00004 TABLE 4 Exemplified ADCs CD33- K334C- CPI (SEQ ID Nos: 23 and 32)
(141) In the above table, the bracketed portion of the structural representations of the compounds represent the amino acid within the peptide sequence of the antibodies to which the respective linker payloads are conjugated.
2. Formulations and Uses
(142) Polypeptides, antibodies, and ADCs described herein can be formulated as pharmaceutical formulations. The pharmaceutical formulation may further comprise pharmaceutically acceptable carriers, excipients, or stabilizers. Further, the compositions can include more than one of the ADCs disclosed herein.
(143) The compositions used in the present invention can further include pharmaceutically acceptable carriers, excipients, or stabilizers (Remington: The Science and practice of Pharmacy 21st Ed., 2005, Lippincott Williams and Wilkins, Ed. K. E. Hoover), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations, and may include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e. g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG). “Pharmaceutically acceptable salt” as used herein refers to pharmaceutically acceptable organic or inorganic salts of a molecule or macromolecule. Pharmaceutically acceptable excipients are further described herein.
(144) Various formulations of one or more ADCs of the invention may be used for administration including, but not limited to formulations comprising one or more pharmaceutically acceptable excipients. Pharmaceutically acceptable excipients are known in the art, and are relatively inert substances that facilitate administration of a pharmacologically effective substance. For example, an excipient can give form or consistency, or act as a diluent. Suitable excipients include but are not limited to stabilizing agents, wetting and emulsifying agents, salts for varying osmolarity, encapsulating agents, buffers, and skin penetration enhancers. Excipients as well as formulations for parenteral and nonparenteral drug delivery are set forth in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing, 2000.
(145) In some aspects of the invention, these agents are formulated for administration by injection (e.g., intraperitoneally, intravenously, subcutaneously, intramuscularly, etc.). Accordingly, these agents can be combined with pharmaceutically acceptable vehicles such as saline, Ringer's solution, dextrose solution, and the like. The particular dosage regimen, i.e., dose, timing and repetition, will depend on the particular individual and that individual's medical history.
(146) Therapeutic formulations of the ADCs of the invention are prepared for storage by mixing an ADC having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington, The Science and Practice of Pharmacy 21st Ed. Mack Publishing, 2005), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and may include buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e. g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG).
(147) Liposomes containing the ADCs of the invention can be prepared by methods known in the art, such as described in Eppstein, et al., 1985, PNAS 82:3688-92; Hwang, et al., 1908, PNAS 77:4030-4; and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556. Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition including phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
(148) The active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nanoparticles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington, The Science and Practice of Pharmacy 21st Ed. Mack Publishing, 2005.
(149) Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e. g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(−)-3-hydroxybutyric acid.
(150) The formulations to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. Therapeutic ADC compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
(151) Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g., TWEEN™ 20, 40, 60, 80 or 85) and other sorbitans (e. g. Span™ 20, 40, 60, 80 or 85). Compositions with a surface-active agent will conveniently include between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
(152) Suitable emulsions may be prepared using commercially available fat emulsions, such as INTRALIPID™, LIPOSYN™, INFONUTROL™, LIPOFUNDIN™ and LIPIPHYSAN™. The active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e. g. egg phospholipids, soybean phospholipids or soybean lecithin) and water. It will be appreciated that other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emulsion. Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%. The fat emulsion can include fat droplets between 0.1 and 1.0 μm, particularly 0.1 and 0.5 μm, and have a pH in the range of 5.5 to 8.0. The emulsion compositions can be those prepared by mixing an ADC with INTRALIPID™ or the components thereof (soybean oil, egg phospholipids, glycerol and water).
(153) The invention also provides kits for use in the instant methods. Kits of the invention include one or more containers including one or more ADCs of the invention and instructions for use in accordance with any of the methods of the invention described herein. Generally, these instructions include a description of administration of the ADC for therapeutic treatments.
(154) The instructions relating to the use of the ADCs of the invention generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
(155) The kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an infusion device such as a minipump. A kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an ADC of the invention. The container may further include a second pharmaceutically active agent.
(156) Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit includes a container and a label or package insert(s) on or associated with the container.
(157) The ADCs of the invention can be used for therapeutic, diagnostic, or non-therapeutic purposes. For example, the antibody or antigen-binding fragment thereof may be used as an affinity purification agents (e.g., for in vitro purification), as a diagnostic agent (e.g., for detecting expression of an antigen of interest in specific cells, tissues, or serum)
(158) For therapeutic applications, the ADCs of the invention can be administered to a mammal, especially a human by conventional techniques, such as intravenously (as a bolus or by continuous infusion over a period of time), intramuscularly, intraperitoneally, intra-cerebrospinally, subcutaneously, intra-articularly, intrasynovially, intrathecally, orally, topically, or by inhalation. The antibodies or antigen-binding fragments also are suitably administered by intra-tumoral, peri-tumoral, intra-lesional, or peri-lesional routes. The ADCs of the invention can be used in prophylactic treatment or therapeutic treatment. For example, the ADCs of the invention may be used for the prophylactic or therapeutic treatment of cancers, autoimmune diseases, inflammatory diseases or infectious diseases.
3. Definitions
(159) Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Generally, nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art.
(160) The term “L-D” refers to a linker-drug moiety resulting from a drug (D) linked to a linker (L). The term “Drug (D)” refers to any therapeutic agent useful in treating a disease. The drug has biological or detectable activity, for example, a cytotoxic agent, a chemotherapeutic agent, a cytostatic agent, or an immunomodulatory agent. In the context of cancer treatment, a therapeutic agent has a cytotoxic effect on tumors including the depletion, elimination and/or the killing of tumor cells. The terms drug, payload, and drug payload are used interchangeably. In certain embodiments, therapeutic agents have a cytotoxic effect on tumors including the depletion, elimination and/or the killing of tumor cells. In certain embodiments, the drug is DNA alkylating agent. In certain embodiments, the drug is a CPI or CBI dimer. In certain embodiments, the drug is (8S)-8-(chloromethyl)-6-[(3-{[(1S)-1-(chloromethyl)-5-hydroxy-8-methyl-1,6-dihydropyrrolo[3,2-e]indol-3(2H)-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-1-methyl-3,6,7,8-tetrahydropyrrolo[3,2-e]indol-4-yl dihydrogen phosphate. In certain embodiments, the drug is preferably membrane permeable.
(161) The term “Linker (L)” describes the direct or indirect linkage of the antibody to the drug payload. Attachment of a linker to an antibody can be accomplished in a variety of ways, such as through surface lysines, reductive-coupling to oxidized carbohydrates, cysteine residues liberated by reducing interchain disulfide linkages, reactive cysteine residues engineered at specific sites, and acyl donor glutamine-containing tag or an endogenous glutamine made reactive by polypeptide engineering in the presence of transglutaminase and an amine. The present invention uses site specific methods to link the antibody to the drug payload. In one embodiment, conjugation occurs through cysteine residues that have been engineered into the antibody constant region. Linkers can be cleavable (i.e., susceptible to cleavage under intracellular conditions) or non-cleavable. In some embodiments, the linker is a cleavable linker.
(162) An “antigen-binding fragment” of an antibody refers to a fragment of a full-length antibody that retains the ability to specifically bind to an antigen (preferably with substantially the same binding affinity). Examples of an antigen-binding fragment includes: an Fab fragment; an F(ab′)2 fragment; an Fd fragment; an Fv fragment; a dAb fragment (Ward et al., (1989) Nature 341:544-546); an isolated complementarity determining region (CDR); a disulfide-linked Fv (dsFv); an anti-idiotypic (anti-Id) antibodies; an intrabody; a single chain Fv (scFv, see e. g., Bird et al. Science 242:423-426 (1988) and Huston et al. Proc. Natl. Acad. Sci. USA 85:5879-5883 (1988)); and a diabod y (see e. g., Holliger et al. Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993); Poljak et al., 1994, Structure 2:1121-1123). The antigen-binding fragment of the invention comprises the engineered antibody constant domain described herein, but does not need to comprise the full length Fc-region of a native antibody. For example, the antigen-binding fragment of the invention can be a “minibody” (VL-VH-CH3 or (scFv-CH3).sub.2; see, Hu et al., Cancer Res. 1996; 56(13):3055-61, and Olafsen et al., Protein Eng Des Sel. 2004; 17(4):315-23).
(163) Residues in a variable domain of an antibody are numbered according Kabat, which is a numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies. See, Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain. For example, a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e. g. residues 82a, 82b, and 82c, according to Kabat) after heavy chain FR residue 82. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. Various algorithms for assigning Kabat numbering are available. The algorithm implemented in the 2012 release of Abysis (www.abysis.org) is used herein to assign Kabat numbering to variable regions unless otherwise noted.
(164) Unless otherwise specified, amino acid residues in the IgG heavy constant domain of an antibody are numbered according the Eu index of Edelman et al., 1969, Proc. Natl. Acad. Sci. USA 63(1):78-85 as described in Kabat et al., 1991, referred to herein as the “EU index of Kabat”. Typically, the Fc domain comprises from about amino acid residue 236 to about 447 of the human IgG1 constant domain. Correspondence between C numberings can be found, e.g., at IGMT database. Amino acid residues of the light chain constant domain are numbered according to Kabat et al., 1991. Numbering of antibody constant domain amino acid residues is also shown in International Patent Publication No. WO 2013/093809.
(165) Unless otherwise specified, amino acid residues in the light chain constant domain of an antibody are numbered according to Kabat et al., 1991.
(166) An amino acid residue of a query sequence “corresponds to” a designated position of a reference sequence (e. g., position 104 of SEQ ID NO:25 or position 162 of SEQ ID NO:26) when, by aligning the query amino acid sequence with the reference sequence, the position of the residue matches the designated position. Such alignments can be done by hand or by using well-known sequence alignment programs such as ClustalW2, or “BLAST 2 Sequences” using default parameters.
(167) The term “about”, as used here, refers to +/−10% of a value.
(168) As used herein, the terms “engineered” (as in engineered cysteine) and “substituted” (as in substituted cysteine) are used interchangeably, and refer to mutating an amino acid to cysteine, in order to create a conjugation site for attaching another moiety to a polypeptide or antibody.
EXAMPLES
(169) The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.
Example 1: Production of Stably Transfected Cells K334C Derived Antibody Variants
(170) 1A. Production of CD33-K334C
(171) CHO cells were transfected with DNA encoding CD33-K334C antibody variant and stable high production pools were isolated using standard procedures well-known in the art. The variant was purified to >95% homogeneity by capturing it from the conditioned medium on a MabSelect SuRe protein A column followed by additional purification using ion exchange column as follows. 20 liters of stable CHO clarified conditioned media was spiked with 5% (v/v) 0.55 M HEPES, 110 mM EDTA, pH 6.75 and was loaded onto a 0.94 L MabSelect SuRe (GE Healthcare Life Sciences Cat#17-5438-03 Lot#10204103) Protein A affinity column (GE BPG, 10 cm ID×12 cm H) equilibrated with TBS (50 mM Tris, 150 mM NaCl, pH 7.5). The column was washed with 2 column volumes (CV) of TBS pH 7.5 followed by 5 CVs of 50 mM Tris, 0.5 M CaCl2 pH 7.5 and 3 CVs of 10 mM Tris, 10 mM NaCl pH 7.5. The bound antibody was then step eluted with 100% 150 mM Glycine, pH 3.5. MabSelect SuRe peak pool was adjusted to pH 3.5 using 2 M Glycine, pH 2.7. The low pH pool was then immediately neutralized to pH 7.0 with 2 M Tris base and stored at 4° C. The neutralized protein A pool was titrated to pH 8.1 and was loaded onto an IEX column (HiScale: 2.6 cm I.D×19 cm H) packed with 100 ml of Fractogel EMD TMAE HiCap M resin (cat#1.10316.5003 lot#K93326916-316). The TMAE column was equilibrated with 50 mM Tris at pH 8.1. MabSelect SuRe peak pool was injected then washed with 3CV of 50 mM Tris pH8.1. The flow-through and wash containing the pure protein of interest was collected. The TMAE Pool was then concentrated and dialyzed against 20 mM NaSuccinate 8.5% Sucrose pH 5.8 buffer by a TFF unit (Millipore Pellicon 3, fully regenerated cellulose membrane, cat#P3C010C01, 30 kDa; 2×0.11m2; 1 cycle). Final pool was analyzed by OD280 (SoloVPE), SDS-PAGE, isoelectric focusing (IEF) (pH3-10) and analytical SEC (YMC-Pack Diol-200). Endotoxin was tested using Endosafe PTS RMPTS964 and Endosafe strip PTS-20 from Charles River Laboratories.
(172) All the other CD33-cys variants as outlined in Table 7 were generated using similar procedures.
(173) 1B. Production of her 2-K334C Variant
(174) CHO cells were transfected with DNA encoding Her2-K334C antibody variant and stable high production pools were isolated using standard procedures well-known in the art. The variant was purified to >95% homogeneity by capturing it from the conditioned medium on a MabSelect SuRe protein A column followed by additional purification using pre-packed G25 size exclusion column as follows. 3*50 mL of stable SSI CHO pool (from production study of the clone) clarified conditioned media (no spike of 5% (v/v) 0.55 M HEPES, 110 mM EDTA, pH 6.75) was loaded directly onto a 2 mL Mabselect SurRe (GE Healthcare Life Sciences Cat#17-5438-03 Lot#10204103) affinity column equilibrated with TBS (50 mM Tris, 150 mM NaCl, pH 7.5). The column was washed with 2 column volumes (CV) of TBS pH 7.5 followed by 5 CVs of 50 mM Tris, 0.5 M CaCl2 pH 7.5 and 3 CVs of 10 mM Tris, 10 mM NaCl pH 7.5. The bound antibody was then step eluted with 100% 150 mM Glycine, pH 3.5. Mabseclect Sure peak pool was adjusted to pH 3.5 using 2 M Glycine, pH 2.7 and then titrated to pH 8.1 with 2 M Tris base (27 μL used). The titrated pool was filtered and then loaded (200 mg/ml challenge) onto an IEX column (.D*H 0.5 cm*10 cm) packed with 0.7 ml of Fractogel EMD TMAE HiCap M resin (cat#1.10316.5003 lot#K93326916-316). The TMAE column was equilibrated with 50 mM Tris pH 8.1. Mabselect peak pool was injected then washed with 6CV of 50 mM Tris pH 8.1. The flow-through fractions containing the pure protein of interest were collected, and pooled. The TMAE Pool was then buffer exchanged to PBS via a pre-packed G25 (30 mL/CV). The final pool was 0.2 um filtered and analyzed by OD280 (NanoDrop), SDS-PAGE, IEF (pH3-10), and analytical SEC (YMC-Pack Diol-200).
(175) 1C. Production of 1.1-K334C Variant
(176) CHO cells were transfected with DNA encoding 1.1-K334C antibody variant and stable high production pools were isolated using standard procedures well-known in the art. A two-column process, i.e., Protein-A capture followed by size-exclusion chromatography, was used to isolate this variant from the concentrated CHO pool starting material. Using these purification process, 1.1-K334C variant has >97% peak-of-interest (POI) as determined by analytical size-exclusion chromatography.
Example 2: Integrity of CD33 Derived Antibodies
(177) Molecular assessment of the K334C cysteine variants (CD33-K334C and CD33-K334C/K392C) was performed to evaluate key biophysical properties to ensure that the variant would be amenable to a standard antibody manufacturing platform process.
(178) To determine integrity of the purified engineered cysteine antibody variant preparations produced via stable CHO expression (and formulated in 20 mM sodium phosphate, 400 mM sodium chloride, pH 7.2), the percent purity of peaks was calculated using non-reduced capillary gel electrophoresis (Caliper LabChip GXII: Perkin Elmer Waltham, Mass.). Results as tabulated in Table 5 show that the engineered cysteine antibody variants contain low levels of fragments or half molecules. The double mutant K334C/K392C contained slightly more fragments relative to the single mutant (3.4% versus 1.2%). The main peak represents >95% intact antibody for both variants.
(179) TABLE-US-00005 TABLE 5 Percent Purity of Peaks Calculated from Non-Reduced Electropherogram Antibody Main Peak (%) Fragments (%) CD33-K334C 98.8 1.2 CD33-(K334C/K392C) 96.6 3.4
Example 3: Generation of CD33-K334C-CPI ADC
(180) 3A. Preparation of Antibody for Conjugation
(181) To 2060 μL CD33-K334C antibody (9.72 mg/mL solution in Dulbecco's Phosphate Buffered Saline (DPBS), 20 mg) was added 323.3 μL DPBS (Lonza, pH 7.4), 90 μL Ethylenediaminetetraacetic acid (EDTA, 0.5M solution in water) and 26.7 μL tris(2-carboxyethyl)phosphine hydrochloride (TCEP, 0.5M solution in water, 100 eq.). Reagents were mixed thoroughly and the mixture aged at ambient temperature overnight. The reaction mixture was then buffer exchanged via GE Sephadex gel desalting column and DPBS/5 mM EDTA eluent. The resulting reduced antibody solution (in 3.5 mL total volume) was treated with 131 μL dehydroascorbic acid (DHA, 50 mM solution in 50% ethanol in DPBS (v/v), 49 eq.). Reagents were thoroughly mixed and the mixture aged overnight at 4° C. The reaction mixture was then buffer exchanged via GE Sephadex gel desalting column and DPBS/5 mM EDTA eluent. The resulting antibody solution was concentrated to 1.7 mL total volume via Millipore Amicon Ultra 50 KD ultrafiltration device, and antibody concentration measured via NanoDrop 2000 spectrophotometer to be 11.18 mg/mL in DPBS/5 mM EDTA (19 mg, 95%).
(182) 3B. Conjugation of Linker-Payload to Prepared Antibody
(183) The CPI drug compound was made according to methods disclosed in PCT Publication WO 2015/110935.
(184) To 1340 μL prepared CD33-K334C antibody (11.18 mg/mL DPBS/5 mM EDTA, 15 mg) was added 77 μL DPBS/5 mM EDTA, 150 μL N,N-dimethylacetamide (DMA) and 100 μL of a solution of linker-payload, N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(8S)-8-(chloromethyl)-6-[(3-{[(1S)-1-(chloromethyl)-8-methyl-5-(phosphonooxy)-1,6-dihydropyrrolo[3,2-e]indol-3(2H)-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-1-methyl-3,6,7,8-tetrahydropyrrolo[3,2-e]indol-4-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide (MalPeg6-vc-PABC-DMAE-CPI; LP7; Table 4) (10 mM solution in DMA, 10 eq.). Reagents were thoroughly mixed and the mixture aged at ambient temperature for 2 hours. Next, the crude reaction was buffer exchanged via GE Sephadex gel desalting column to DPBS pH 7.4 and purified by size exclusion chromatography via GE Akta Explorer system using GE SEC HiLoad 26/60 Superdex 200 PG column with DPBS pH 7.4 as eluent to afford monomeric ADC. The resulting ADC, CD33-K334C-CPI, was characterized using the analytical methods described below.
(185) Identical methods were employed in the preparation of other CD33-Cys variant ADCs (Tables 6 and 7), Her2-K334C variant ADC and 1.1-K334C ADC, respectively.
Example 4: Analytical Characterization of K334C ADCs
(186) 4A. Protein LC/MS Analysis.
(187) Samples were prepped for LCMS analysis by combining approximately 1-5 μl of sample (approximately 1-5 mg/ml ADC in pH 7.4 PBS buffer) to 10 μl total volume with additional pH 7.4 PBS buffer. Approximately 5 μl of 0.5M solution of tris(2-carboxyethyl)phosphine (TCEP) in water was added, and the mixture was incubated at 37° C. for 5-10 minutes prior to analysis. The samples were injected into an Agilent 110 HPLC system fitted with an Agilent Poroshell 300SB-C8 (2. 1×75 mm) column. The system temperature was set to 60° C. A 5 minute gradient from 20% to 45% acetonitrile in water (with 0.1% formic acid modifier) was utilized. The eluent was monitored by UV (220 nM) and by a Waters Micromass ZQ mass spectrometer (ESI ionization; cone voltage: 20V; Source temp: 120° C.; Desolvation temp: 350° C.). The crude spectrum containing the multiple-charged species was deconvoluted using MaxEnt1 within MassLynx 4. 1 software package according to the manufacturer's instructions.
(188) 4B. MS Determination of Loading Per Antibody
(189) The total loading of the payload to the antibody to make an ADC is referred to as the Drug Antibody Ratio or DAR. The DAR was calculated for each of the ADCs made and reported in Tables 6 and 7.
(190) The spectra for the entire elution window (usually 5 minutes) were combined into a single summed spectrum (i.e., a mass spectrum that represents the MS of the entire sample). MS results for ADC samples were compared directly to the corresponding MS of the identical non-loaded control antibody. This allowed for the identification of loaded/nonloaded heavy chain (HC) peaks and loaded/non-loaded light chain (LC) peaks. The ratio of the various peaks can be used to establish loading based on the equation below (Equation 1). Calculations are based on the assumption that loaded and non-loaded chains ionize equally which has been determined to be a generally valid assumption. The following calculation was performed in order to establish the DAR:
Loading=2*[LC1/(LC1+LC0)]+2*[HC1/(HC0+HC1+HC2)]+4*[HC2/(HC0+HC1+HC2)] Equation 1:
Where the indicated variables are the relative abundance of: LC0=unloaded light chain, LC1=single loaded light chain, HC0=unloaded heavy chain, HC1=single loaded heavy chain, and HC2=double loaded heavy chain. One of ordinary skill in the art would appreciate that the invention encompasses expansion of this calculation to encompass higher loaded species such as LC2, LC3, HC3, HC4, HC5, and the like.
(191) 4C. Analytical Size Exclusion Chromatography
(192) Column: GE Superdex 200 (5/150 GL); Mobile phase: Phosphate buffered saline (PBS, 1×, pH 7.4) with 2% acetonitrile; Isocratic; Flow rate: 0.25 mL/minute. Temperature: room temperature; Injection Volume: 10 μL of 1 mg/mL stock; Instrument: Agilent 1100 HPLC. The resulting conjugates were >95% pure by SEC.
(193) 4D. Hydrophobic Interaction Chromatography (HIC)
(194) Compounds were prepared for HIC analysis by diluting samples to approximately 1 mg/ml with PBS. The samples were analyzed by auto-injection of 15 μl onto an Agilent 1200 HPLC with a TSK-GEL Butyl NPR column (4.6×3.5 mm, 2.5 μm pore size; Tosoh Biosciences part #14947). The system includes an auto-sampler with a thermostat, a column heater and a UV detector.
(195) The gradient method was used as follows: Mobile phase A: 1.5M ammonium sulfate, 50 mM potassium phosphate dibasic (pH 7); Mobile phase B: 20% isopropyl alcohol, 50 mM potassium phosphate dibasic (pH 7); T=0 min. 100% A; T=12 min., 0% A.
(196) Relative retention times (RRT) are calculated by comparing the retention times of ADC to its naked antibody counterpart. Relative retention times are shown in Table 7. As shown, these vary widely between different conjugates indicating that the position where payload is conjugated can dictate the hydrophobicity of the resulting conjugate.
(197) TABLE-US-00006 TABLE 6 Analytical Data for Exemplified ADCs Mass Spectra: Theoretical Δ SEC-HPLC Loading or mass or linker- retention time and Drug per Linker- payload HPLC Δ mass for Antibody Payload molecular the Heavy Chain Ratio ADC ID ID weight (HC) portion (DAR) CD33- LP7 1608 SEC (Protocol B): 1.9 K334C- 6.514 minutes; CPI HPLC (Protocol A): HC Δ mass = 1608 CD33- LP7 1608 SEC (Protocol B): 2.0 K392C- 6.499 minutes; CPI HPLC (Protocol A): HC Δ mass = 1607 CD33- LP7 3216 SEC (Protocol B): 4.0 K334C/ (1608 × 2) 6.427 minutes; K392C- HPLC (Protocol A): CPI HC Δ mass = 3216 Her2- LP7 1608 SEC (Protocol B): 2.0 K334C- 6.601 minutes; CPI HPLC (Protocol A): HC Δ mass = 1610 1.1- LP7 1608 SEC (Protocol B): 2.0 K334C- 6.569 minutes; CPI HPLC (Protocol A): HC Δ mass = 1608
Example 5. Generation of CD33-(K334C/K392C)-MalPeg6-Vc-PABC-DMAE-CPI ADC
(198) 5A. Preparation of Antibody for Conjugation
(199) To 4500 μL CD33-(K334C/K392C) antibody (10.94 mg/mL solution in Dulbecco's Phosphate Buffered Saline (DPBS), 49 mg) was added 253 μL DPBS (Lonza, pH 7.4), 180 μL Ethylenediaminetetraacetic acid (EDTA, 0.5M solution in water) and 66.7 μL tris(2-carboxyethyl)phosphine hydrochloride (TCEP, 0.5M solution in water, 100 eq.). Reagents were mixed thoroughly and the mixture aged at ambient temperature overnight. The reaction mixture was then buffer exchanged via GE Sephadex gel desalting columns and DPBS/5 mM EDTA eluent. The resulting reduced antibody solution (in 7.0 mL total volume) was treated with 166 μL DPBS/5 mM EDTA solution and 334 μL dehydroascorbic acid (DHA, 50 mM solution in 50% ethanol in DPBS (v/v), 50 eq.). Reagents were thoroughly mixed and the mixture aged overnight at 4° C. The reaction mixture was then buffer exchanged via GE Sephadex gel desalting columns and DPBS/5 mM EDTA eluent. The resulting antibody solution was concentrated to 4.6 mL total volume via Millipore Amicon Ultra 50 KD ultrafiltration device, and antibody concentration measured via NanoDrop 2000 spectrophotometer to be 8.29 mg/mL in DPBS/5 mM EDTA (38 mg, 78%).
(200) 5B. Conjugation of Linker-Payload to Prepared Antibody:
(201) The CPI drug compound was made according to methods disclosed in PCT Publication WO 2015/110935.
(202) To 1810 μL prepared CD33-(K334C/K392C)-human IgG1 antibody (8.29 mg/mL DPBS/5 mM EDTA, 15 mg) was added 220 μL N,N-dimethylacetamide (DMA) and 100 μL of a solution of linker-payload, N-[1-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)-21-oxo-3,6,9,12,15,18-hexaoxahenicosan-21-yl]-L-valyl-N.sup.5-carbamoyl-N-[4-({[(2-{[({(8S)-8-(chloromethyl)-6-[(3-{[(1S)-1-(chloromethyl)-8-methyl-5-(phosphonooxy)-1,6-dihydropyrrolo[3,2-e]indol-3(2H)-yl]carbonyl}bicyclo[1.1.1]pent-1-yl)carbonyl]-1-methyl-3,6,7,8-tetrahydropyrrolo[3,2-e]indol-4-yl}oxy)carbonyl](methyl)amino}ethyl)(methyl)carbamoyl]oxy}methyl)phenyl]-L-ornithinamide (MalPeg6-vc-PABC-DMAE-CPI) (10 mM solution in DMA, 10 eq.). Reagents were thoroughly mixed and the mixture aged at ambient temperature for 2 hours. Next, the crude reaction was buffer exchanged via GE Sephadex gel desalting column to DPBS pH 7.4 and purified by size exclusion chromatography via GE Akta Explorer system using GE SEC HiLoad 26/60 Superdex 200 PG column with DPBS pH 7.4 as eluent to afford monomeric ADC. The resulting ADC was characterized using the analytical methods described in Example 4 and DAR values can be found in Tables 6 and 7.
Example 6. Plasma Stability of CD33 ADCs
(203) From stock ADC solutions, 50 μg/mL of each ADC was prepared in fresh pooled male CD-1 mouse plasma with sodium heparin. In a frozen 96-well plate, 0-min time-point was sampled immediately after the ADC plasma preparation. The plate was then placed in a −80° C. freezer. The remaining ADC plasma samples in capped tubes were incubated at 37° C. in a CO.sub.2 controlled incubator. Aliquots were removed after 8, 24 and 72-hours and frozen at −80° C. until analysis. At the time of analysis, the plasma samples were thawed and deglycosylated for 2 hr at 37° C. using 2 μl of IgZero (Genovis, Switzerland). The incubation time is reported as the total time period for which ADCs were in contact with plasma. The deglycosylated samples were analyzed utilizing an immunocapture high resolution LC/MS method. Briefly, 50 μl of plasma sample was added to a 96 well lo-bind plate (Eppendorf, Hamburg, Germany) and deglycosylated for 1.5 hr at 37° C. using 2 μl of IgZero (Genovis, Switzerland) prepared in water. Capture of ADC was performed using biotinylated goat anti-human FC gamma (Jackson ImmunoResearch, West Grove, Pa.) at a ratio of 3:1 capture:ADC for 1 hr at room temperature, under gentle shaking. Streptavidin T1 beads (Life Technologies, Grand Island, N.Y.) were washed and added to the samples, mixing for 0.5 hr, then a magnet was used to wash, and finally elute with 50 μl of 2% formic acid. The samples were analyzed in a reduced format and were treated with the addition of 200 mM tris(2-carboxyethyl)phosphine (TCEP) for a final TCEP concentration of 20 mM. The samples (2 μl) were injected onto a BEH C4 column (150 μm×50 mm, 1.7 μm, 300A, Waters) set at 85° C., with an autosampler set at 4° C. LC separation was achieved using a nano-acquity LC system (Waters Technology). Spectra were collected from 2-8 min using a Waters Synapt-G2S QToF equipped with an ionKey nanospray source (Waters Technology). Positive TOF-MS scan was collected over m/z range of 800-2100 amu using MassLynx (Waters Technology) software, and was deconvoluted using the MaxEnt1 algorithm in BioPharmaLynx software (Waters Technology).
(204) As shown in
(205) TABLE-US-00007 TABLE 7 Plasma Stability of CD33 ADCs Plasma Variant RRT stability DAR Light Chain K183C 1.25 poor 1.9 Heavy Chain K290C 1.52 Moderate 1.9 K334C 1.11 good 1.9 Q347C 1.70 Moderate 1.9 Y373C 1.36 poor 1.7 E388C 1.73 poor 1.9 K392C 1.21 good 2 K334C/K392C 1.07 N/A 4
Example 7. Thermal Stability of ADCs
(206) Differential Scanning Calorimetry (DCS) was used to determine the thermal stability of the engineered cysteine antibody CPI conjugates shown in Table 8. For this analysis, samples formulated in PBS-CMF pH 7.2 were dispensed into the sample tray of a MicroCal VP-Capillary DSC with Autosampler (GE Healthcare Bio-Sciences, Piscataway, N.J.), equilibrated for 5 minutes at 10° C. and then scanned up to 110° C. at a rate of 100° C. per hour. A filtering period of 16 seconds was selected. Raw data was baseline corrected and the protein concentration was normalized. Origin Software 7.0 (OriginLab Corporation, Northampton, Mass.) was used to fit the data to an MN2-State Model with an appropriate number of transitions.
(207) As shown in Table 8, both single K334C and double mutant K334C/K392C ADCs exhibited excellent thermal stability as determined by the first melting transition (Tm1) >65° C. These results demonstrated that both antibody variants are not perturbed during conjugation.
(208) TABLE-US-00008 TABLE 8 Thermal Stability of CD33 ADCs CD33 ADC T.sub.m1 T.sub.m2 T.sub.m3 K334C 68.19 ± 0.06 74.11 ± 0.21 83.94 ± 0.14 K334C/K392C 68.28 ± 0.06 74.14 ± 0.20 83.75 ± 0.14
Example 8: ADC Binding to Human FcRn
(209) It is believed in the art that FcRn interacts with IgG regardless of subtype in a pH dependent manner and protects the antibody from degradation by preventing it from entering the lysosomal compartment where it is degraded. Therefore, a consideration for selecting positions for introduction of reactive cysteines into the wild type IgG1-Fc region was to avoid altering the FcRn binding properties and half-life of the antibody comprising the engineered cysteine.
(210) BIAcore® analysis was performed to determine the steady-state affinity (KD) for the anti-CD33 derived monoclonal antibodies and their respective ADCs for binding to human FcRn. BIAcore® technology utilizes changes in the refractive index at the surface layer of a sensor upon binding of the anti-CD33 derived monoclonal antibodies or their respective ADCs to human FcRn protein immobilized on the layer. Binding was detected by surface plasmon resonance (SPR) of laser light refracting from the surface. Human FcRn was specifically biotinylated through an engineered Avi-tag using the BirA reagent (Catalog #: BIRA500, Avidity, LLC, Aurora, Colo.) and immobilized onto a streptavidin (SA) sensor chip to enable uniform orientation of the FcRn protein on the sensor. Next, various concentrations of the anti-CD33 derived monoclonal antibodies or their respective ADCs or in 20 mM MES (2-(N-morpholino)ethanesulfonic acid pH 6.0, with 150 mM NaCl, 3 mM EDTA (ethylenediaminetetraacetic acid), 0.5% Surfactant P20 (MES-EP) were injected over the chip surface. The surface was regenerated using HBS-EP+0.05% Surfactant P20 (GE Healthcare, Piscataway, N.J.), pH 7.4, between injection cycles. The steady-state binding affinities were determined for the anti-CD33 derived monoclonal antibodies or their respective ADCs, and these were compared with the wild type anti-CD33 antibody (comprising no cysteine mutations in the IgG1 Fc region).
(211) These data demonstrated that incorporation of engineered cysteine residues into the IgG-Fc region at positions 334 and/or 392 did not alter affinity to FcRn (Table 9).
(212) TABLE-US-00009 TABLE 9 Steady-State Affinities of Site-Specific Conjugates Binding Human FcRn mAb/ADC K.sub.D (nM) Wild-type 1274.0 CD33-K334C 1067.0 CD33-K334C-CPI 922.3 CD33-K392C 1177.0 CD33-K392C-CPI 993.6 CD33-(K334C/K392C) 964.1 CD33-(K334C/K392C)-CPI 1220.0
Example 9: ADC Binding to Fcγ Receptors
(213) Binding of the ADCs using site-specific conjugation to human Fc-γ receptors was evaluated in order to understand if conjugation to a payload alters binding which can impact antibody related functionality such as antibody-dependent cell-mediated cytotoxicity (ADCC). FcγIIIa (CD16) is expressed on NK cells and macrophages, and co-engagement of this receptor with the target expressing cells via antibody binding induces ADCC. BIAcore® analysis was used to examine binding of the anti-CD33 derived monoclonal antibodies and their respective ADCs to Fc-γ receptors IIa (CD32a), IIb(CD32b), IIIa (CD16) and FcγRI (CD64).
(214) For this surface plasmon resonance (SPR) assay, CD33 extra-cellular domain protein was immobilized on a CM5 chip (GE Healthcare, Piscataway, N.J.) and ˜300-400 response units (RU) of either a CD33 monoclonal antibody or its respective ADC was captured. Various concentrations of the Fcγ receptors FcγIIa (CD32a), FcγIIb(CD32b), FcγIIIa (CD16a) and FcγRI (CD64) were injected over the surface and binding was determined.
(215) FcγRs IIa, IIb and IIIa exhibited rapid on/off rates and therefore the sensorgrams were fit to steady state model to obtain K.sub.D values. FcγRI exhibited slower on/off rates so data was fit to a kinetic model to obtain K.sub.D values.
(216) Conjugation of payload at the engineered cysteine position 334 showed a moderate loss in FcγR affinity compared to their unconjugated counterparts while conjugation at position 392 did not modulate the FcγR affinity (Table 10). This loss in binding is also reflected in the double K334C/K392C conjugate and presence of the four payloads in the double mutant exacerbated this loss. It is important to note that these mutations alone do not result in the loss of binding to FcγR prior to conjugation. Taken together, these results suggested that location of the conjugated payload can impact binding of the ADC to FcγR and may impact the effector functionality of the conjugate.
(217) TABLE-US-00010 TABLE 10 Binding Affinity (μM) of Site-Specific Conjugates for Fcγ Receptors binding to CD16a, CD32a, CD32b and CD64 CD16a CD32a CD32b CD64 Wild-type 0.40 1.11 3.90 0.00015 CD33-K334C 0.19 0.84 3.30 0.00002 CD33-K334C-CPI 1.75 3.90 6.30 0.00007 CD33-K392C 0.39 1.03 3.60 0.00010 CD33-K392C-CPI 0.19 2.08 4.37 0.00015 CD33-(K334C/K392C) 0.21 0.90 3.46 0.00002 CD33-(K334C/K392C)-CPI 5.65 12.90 20.10 0.00017
Example 10. Cytotoxicity of ADCs
(218) 10A. Cytotoxicity of CD33 K334C ADC
(219) For in vitro cytotoxicity assay with AML cell lines, cells were incubated with different concentrations of ADCs/payload for 96 hours after which cell viability was measured with CelltiterGlo (Promega, Madison, Wis.). Luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, Mass.). IC.sub.50 values were calculated using a four-parameter logistic model with XLfit (IDBS, Bridgewater, N.J.) and reported ng/ml antibody concentration in Table 11. The IC.sub.50 are shown +/−the standard deviation.
(220) Table 11 shows IC50 (ng/mL) values of the anti-CD33 ADC treatments in several cell lines. These data demonstrate that CD33-K334C-CPI with drug-antibody ratio (DAR) of 2 induces cell death in CD33 expressing cell lines (HL60, NB4, Hel92.1.7, TF-1). The data further demonstrates that the double cysteine mutant CD33-K334C/K392C-CPI with a DAR of 4 is more potent than the DAR2 K334C version. All ADCs were minimally active in the CD33 negative cell line, Raji indicating that the activity seen in CD33 expressing cell lines is selective. Corroborating this observation, the non-targeted control 1.1-K334C-CPI ADC with DAR of 2 was substantially less active at the highest doses tested. In addition, it is worth noting that potent activity is also observed in CD33 expressing cell lines like HEL92.1.7 that express multi-drug resistant pumps (e.g., MDR) indicating that CPI evades multi-drug resistance pumps.
(221) TABLE-US-00011 TABLE 11 In Vitro Cytotoxicity Data (ng/mL) for CD33 Conjugates and Negative Control IC50 Values (ng/ml) ADC DAR HL60 NB4 HEL92.1.7 TF-1 Raji CD33-K334C-CPI 1.9 10.3 ± 11.4 1.9 ± 3.1 10.1 ± 16.6 52.2 ± 53.6 1440.9 ± 604.5 CD33-K334C/K392C-CPI 4 2.5 ± 2.1 0.4 ± 0.1 0.9 ± 0.3 158.6 ± 163.9 1045.4 ± 497.1 1.1-K334C- CPI 2 232.3 ± 118.4 143.3 ± 33 414.7 ± 308.5 3198.6 ± 2218.4 1616 ± 1061.2
(222) 10B. Cytotoxicity of Her2 K334C ADC
(223) Her2-Target expressing N87 (gastric cancer), MDA-MB-453 (breast cancer)) or Her2-non-expressing (HT29) cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96® AQ.sub.ueous One Solution Cell Proliferation MTS Assay (Promega, Madison Wis.) 96 hours after treatment. Relative cell viability was determined as percentage of untreated control. IC50 values were calculated using a four parameter logistic model #203 with XLfit v4.2 (IDBS, Guildford, Surry, UK). As shown in Table 12, Her2-K334C-CPI conjugate showed selective killing of Her2-expressing cells.
(224) TABLE-US-00012 TABLE 12 In vitro Cytotoxicity Data (EC50; ng/mL) for Herceptin Conjugate and Negative Control Identifier N87 MDA-MB-453 HT29 Her2-K334C- CPI 21.34 45.45 13532 1.1-K334C-CPI 3397 ND 11216 ND Not determined
Example 11. Assessment of Anti-CD33 ADC Activity in Human AML In Vivo Models
(225) The anti-CD33 CPI ADCs were tested in Acute Myeloid Leukemia (AML) xenograft models. For each model described below the first dose was given on Day 0 and the tumors were measured at least once a week and their volume was calculated using the formula, tumor volume (mm.sup.3)=0.5×(tumor width.sup.2)(tumor length). The mean tumor volumes (±S.E.M.) for each treatment group were calculated having a maximum of 10 animals and a minimum of 6 animals to be included. All animal experiments were conducted in a facility accredited by the Association for Assessment of Laboratory Animal Care under Institutional Animal Care and Use Committee guidelines and appropriate animal research approval.
(226) 11A. HL60 AML Xenografts
(227) To evaluate DAR 2 anti-CD33 CPI ADCs, the HL60 AML sc xenograft model was dosed intravenously four times every four days (q4dx4) with PBS vehicle, anti-CD33 ADC (CD33-K334C-CPI, CD33-K392C-CPI, CD33-K290C-CPI, CD33-K347C-CPI) at the doses provided in Table 13.
(228) The data demonstrates that the anti-CD33 ADC CD33-K334C-CPI and CD33-K392C-CPI inhibited growth of HL60 AML subcutaneous xenograft tumors. The q4dx4 dose of 1mpk was the most efficacious dose of ADC tested in this study, and by day 48, ten out of ten animals in their dose group remained tumor-free. Further, the data also demonstrates that anti-CD33-K334C-CPI ADC inhibited tumor growth more potently than anti-CD33 ADCs conjugated at K392C, K290C and K347C. Thus, ADCs conjugated at position 334 or at position 392 surprisingly showed superior plasma stability and in vivo efficacy as compared to ADCs conjugated at other positions.
(229) As both CD33-K334C-CPI and CD33-K392C-CPI showed best stability in plasma, the effects of the DAR 4 CD33-K334C/K392C ADC was also examined in immune deficient mice on the in vivo growth of human tumors. For subcutaneous (sc) AML models, 10×10.sup.6 HL60 cells were implanted subcutaneously in the flank of female NOD-SCID mice. When the tumors reached an average volume of 200 mm.sup.3, animals were staged to ensure uniformity of the tumor size among various treatment groups. The HL60 AML sc xenograft model was dosed intravenously four times every four days (Q4dx4) with PBS vehicle, anti-CD33 ADC and comparator control gemtuzumab ozagamicin (calicheamicin conjugate of an anti-CD33; DAR 4) at the doses provided in Table 14.
(230) TABLE-US-00013 TABLE 13 HL60 AML Xenografts - CD33 ADCs q4d x4 HL60 AML xenografts, mean tumor volume (mm3 +/− SEM) DOSE PBS CD33-K290C-CPI CD33-K347C-CPI CD33-K334C-CPI CD33-K392C-CPI (MPK) 0 0.3 1 0.3 1 0.3 1 0.3 1 Day 0 179 ± 12 180 ± 8 Day 1 186 ± 7 196 ± 15 192 ± 14 194 ± 8 180 ± 9 186 ± 12 191 ± 9 Day 3 292 ± 18 276 ± 19 291 ± 19 261 ± 39 253 ± 14 269 ± 13 218 ± 11 Day 4 468 ± 43 339 ± 26 Day 6 630 ± 52 582 ± 78 427 ± 52 527 ± 87 449 ± 38 423 ± 21 97 ± 23 Day 8 786 ± 103 610 ± 105 293 ± 42 668 ± 123 331 ± 49 450 ± 20 0 ± 0 418 ± 52 95 ± 24 Day 10 918 ± 153 896 ± 169 351 ± 71 878 ± 209 399 ± 98 518 ± 36 0 ± 0 Day 11 588 ± 127 32 ± 12 Day 13 1531 ± 226 1373 ± 271 393 ± 82 1052 ± 211 500 ± 112 702 ± 55 0 ± 0 Day 14 704 ± 151 0 ± 0 Day 15 1819 ± 270 1855 ± 343 572 ± 187 1503 ± 315 698 ± 167 1002 ± 114 0 ± 0 Day 17 1913 ± 104 1408 ± 413 591 ± 185 1539 ± 347 781 ± 219 1363 ± 154 0 ± 0 Day 18 989 ± 177 0 ± 0 Day 20 2199 ± 231 1600 ± 552 1172 ± 301 1323 ± 175 832 ± 145 1927 ± 216 0 ± 0 Day 21 1387 ± 242 0 ± 0 Day 22 — — — — 855 ± 107 1957 ± 302 0 ± 0 Day 23 1178 ± 168 0 ± 0 Day 24 — — — — 1189 ± 190 — 0 ± 0 Day 25 1187 ± 168 0 ± 0 Day 27 — — — — 1432 ± 174 — 0 ± 0 Day 28 1757 ± 301 0 ± 0 Day 29 — — — — 2260 ± 284 — 0 ± 0 Day 30 1916 ± 248 0 ± 0 Day 31 — — — — — — 0 ± 0 Day 32 0 ± 0 Day 34 — — — — — — 0 ± 0 Day 35 0 ± 0 Day 36 — — — — — — 0 ± 0 Day 37 0 ± 0 Day 38 — — — — — — 0 ± 0 Day 39 0 ± 0 Day 41 — — — — — — 0 ± 0 Day 42 0 ± 0 Day 43 — — — — — — 0 ± 0 Day 44 33 ± 33 Day 45 — — — — — — 0 ± 0 Day 46 68 ± 68 Day 48 — — — — — — 0 ± 0 Day 49 123 ± 123 Day 51 283 ± 283 Day 53 443 ± 443
(231) TABLE-US-00014 TABLE 14 HL60 AML Xenografts - CD33 double mutant (K334C/K392C) ADCs HL60 AML xenografts, mean tumor volume (mm.sup.3 +/− SEM) q4dx4 Gemtuzumab PBS CD33-K334C/K392C-CPI Ozogamycin DOSE (mpk) 0 0.3 0.6 1 1 Day 0 214 ± 11 215 ± 17 218 ± 14 219 ± 16 220 ± 19 Day 4 406 ± 38 283 ± 38 301 ± 23 248 ± 12 337 ± 41 Day 7 986 ± 77 278 ± 146 29 ± 14 31 ± 13 158 ± 31 Day 10 1466 ± 108 268 ± 224 0 ± 0 0 ± 0 35 ± 16 Day 14 2411 ± 206 19 ± 13 0 ± 0 0 ± 0 0 ± 0 Day 16 — 13 ± 13 0 ± 0 0 ± 0 0 ± 0 Day 18 — 8 ± 8 0 ± 0 0 ± 0 0 ± 0 Day 21 — 15 ± 15 0 ± 0 0 ± 0 0 ± 0 Day 23 — 37 ± 25 0 ± 0 0 ± 0 0 ± 0 Day 25 — 82 ± 59 0 ± 0 0 ± 0 0 ± 0 Day 28 — 138 ± 92 0 ± 0 0 ± 0 0 ± 0 Day 31 — 231 ± 162 0 ± 0 0 ± 0 0 ± 0 Day 35 — 496 ± 345 0 ± 0 0 ± 0 32 ± 32 Day 37 — 335 ± 335 0 ± 0 0 ± 0 33 ± 33 Day 39 — 0 ± 0 0 ± 0 0 ± 0 24 ± 24 Day 42 — 0 ± 0 0 ± 0 0 ± 0 105 ± 57 Day 44 — 0 ± 0 0 ± 0 0 ± 0 143 ± 79 Day 46 — 30 ± 30 0 ± 0 0 ± 0 262 ± 95 Day 49 — 46 ± 46 0 ± 0 0 ± 0 438 ± 171 Day 51 — 50 ± 50 0 ± 0 0 ± 0 550 ± 212 Day 53 — 93 ± 93 0 ± 0 0 ± 0 732 ± 269 Day 56 — 147 ± 147 0 ± 0 0 ± 0 953 ± 410 Day 58 — 198 ± 198 0 ± 0 0 ± 0 445 ± 323 Day 60 — 239 ± 239 0 ± 0 0 ± 0 604 ± 457 Day 63 — 589 ± 589 0 ± 0 0 ± 0 435 ± 435 Day 67 — 43 ± 32 0 ± 0 0 ± 0 0 ± 0 Day 70 — 119 ± 80 0 ± 0 0 ± 0 115 ± 115 Day 72 — 207 ± 149 0 ± 0 0 ± 0 175 ± 175 Day 74 — 250 ± 168 0 ± 0 0 ± 0 176 ± 176 Day 78 — 683 ± 477 0 ± 0 0 ± 0 709 ± 709 Day 81 — — 0 ± 0 0 ± 0 —
(232) 11B. TF-1 AML Xenografts
(233) The effects of the CD33-K334C-CPI ADC and CD33-K334C/K392C-CPI ADC on the in vivo growth of human tumors were examined in immunodeficient mice. For subcutaneous (sc) AML models, 10×10.sup.6 TF-1 cells were implanted subcutaneously in the flank of female Athymic nu/nu mice. When the tumors reached an average volume of 300 mm.sup.3, animals were staged to ensure uniformity of the tumor size among various treatment groups. The TF-1 AML sc xenograft model was dosed intravenously four times every four days (Q4dx4) with PBS vehicle, anti-CD33 ADC, and gemtuzumab ozogamicin (control calicheamicin conjugate as comparator) at the doses provided in Table 12.
(234) The data demonstrates that both CD33-K334C-CPI ADC and CD33-K334C/K392C-CPI inhibited growth of TF-1 AML xenograft tumors. The 1 mg/kg dose of the CD33-K334C-CPI ADC and 0.3 mpk dose of the CD33-K334C/K392C-CPI were the most potent tested in this study. As expected, DAR 4 CD33-K334C/K392C-CPI ADC is more potent than DAR 2 CD33-K334C-CPI ADC. Furthermore, the data shows that the CD33-K334C-CPI ADC inhibited tumor growth more potently than gemtuzumab ozogamicin (calicheamicin conjugate; positive control) indicating a greater efficacy than a calicheamicin conjugated anti-CD33 ADC.
(235) TABLE-US-00015 TABLE 15 TF-1 AML Xenografts - CD33 ADCs Gemtuzumab DOSE PBS CD33-K334C-CPI CD33--K334C/K392C-CPI Ozogamicin (mg/kg) 0 0.3 0.6 1 0.3 0.6 1 1 Day −1 284 ± 11 286 ± 15 282 ± 20 284 ± 18 285 ± 26 281 ± 18 281 ± 28 289 ± 15 Day 4 767 ± 113 407 ± 52 283 ± 58 291 ± 45 337 ± 61 339 ± 36 286 ± 60 684 ± 73 Day 7 1031 ± 183 238 ± 51 229 ± 45 189 ± 37 204 ± 60 209 ± 35 119 ± 42 917 ± 107 Day 11 1690 ± 310 38 ± 25 71 ± 30 0 ± 0 47 ± 37 35 ± 24 14 ± 14 1621 ± 300 Day 14 1468 ± 260 26 ± 26 62 ± 26 0 ± 0 45 ± 32 23 ± 23 17 ± 17 1652 ± 390 Day 19 — 16 ± 16 0 ± 0 0 ± 0 21 ± 21 0 ± 0 0 ± 0 — Day 22 — 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 — Day 25 — 59 ± 59 0 ± 0 0 ± 0 35 ± 35 0 ± 0 0 ± 0 — Day 28 — 79 ± 79 0 ± 0 0 ± 0 79 ± 79 0 ± 0 0 ± 0 — Day 32 — 102 ± 102 0 ± 0 0 ± 0 184 ± 163 27 ± 27 0 ± 0 — Day 35 — 113 ± 113 0 ± 0 0 ± 0 210 ± 186 33 ± 33 0 ± 0 — Day 39 — 162 ± 162 0 ± 0 0 ± 0 345 ± 316 42 ± 42 0 ± 0 — Day 43 — 219 ± 219 0 ± 0 0 ± 0 45 ± 45 47 ± 47 0 ± 0 — Day 46 — 0 ± 0 0 ± 0 0 ± 0 63 ± 63 50 ± 50 0 ± 0 — Day 49 — 0 ± 0 0 ± 0 0 ± 0 43 ± 43 60 ± 60 0 ± 0 — Day 54 — 0 ± 0 0 ± 0 0 ± 0 67 ± 67 76 ± 76 0 ± 0 — Day 60 — 0 ± 0 0 ± 0 0 ± 0 78 ± 78 100 ± 100 0 ± 0 — Day 67 — 0 ± 0 0 ± 0 0 ± 0 93 ± 93 151 ± 151 0 ± 0 — Day 74 — 0 ± 0 0 ± 0 0 ± 0 95 ± 95 241 ± 241 0 ± 0 — Day 83 — 0 ± 0 0 ± 0 0 ± 0 123 ± 123 0 ± 0 0 ± 0 —
Example 12. Assessment of ADC Activity in a Her2 Positive Tumor Xenograft Model
(236) An in vivo efficacy study of the Her2-K334C-CPI ADC was performed with a Her2-expressing xenograft model using the N87 cell line. For this study, 7.5 million tumor cells in 50% matrigel were implanted subcutaneously into 6-8 weeks old nude mice until the tumor sizes reach between 250 and 350 mm3. Dosing was done through bolus tail vein injection. The N87 xenograft model was dosed intravenously four times every four days (Q4dx4) with PBS vehicle or with Her2-K334C-CPI ADC at 0.3, 1.0, or 2.0 mg/kg, as shown below in Table 13 and
(237) These data demonstrated that Her2-K334C-CPI ADC inhibited growth of N87 xenograft in a dose-dependent manner. Doses of 1 and 2 mpk provided long lasting regressions of the tumor.
(238) TABLE-US-00016 TABLE 16 N87 Xenografts - Her2 ADC N87 xenografts, mean tumor volume (mm3 +/− SEM) Q4dx4 PBS Her2-K334C-CPI Dose (mg/kg) 0.00 0.30 1.00 2.00 Day 0 316 +/− 15 309 +/− 13 309 +/− 13 309 +/− 19 Day 3 364 +/− 14 354 +/− 12 332 +/− 20 302 +/− 12 Day 7 569 +/− 22 310 +/− 15 235 +/− 20 176 +/− 9 Day 11 707 +/− 46 341 +/− 24 185 +/− 23 109 +/− 6 Day 14 733 +/− 38 251 +/− 17 131 +/− 18 63 +/− 4 Day 18 969 +/− 66 194 +/− 15 82 +/− 13 37 +/− 3 Day 21 1002 +/− 59 180 +/− 9 71 +/− 14 42 +/− 5 Day 24 1099 +/− 83 168 +/− 11 66 +/− 11 39 +/− 4 Day 28 1282 +/− 83 138 +/− 9 73 +/− 12 39 +/− 6 Day 32 1472 +/− 114 128 +/− 7 63 +/− 8 39 +/− 7 Day 35 1443 +/− 106 114 +/− 9 55 +/− 6 43 +/− 5 Day 38 1705 +/− 123 111 +/− 8 49 +/− 4 35 +/− 5 Day 43 1435 +/− 116 113 +/− 12 57 +/− 6 37 +/− 4 Day 46 1470 +/− 132 108 +/− 12 52 +/− 7 31 +/− 4 Day 50 1556 +/− 192 116 +/− 14 53 +/− 4 30 +/− 5 Day 57 1734 +/− 207 103 +/− 13 38 +/− 4 23 +/− 4 Day 64 1493 +/− 89 105 +/− 19 33 +/− 4 31 +/− 5 Day 72 1686 +/− 5 126 +/− 23 36 +/− 5 37 +/− 6 Day 81 1869 +/− 140 168 +/− 35 31 +/− 5 18 +/− 5 Day 88 — 167 +/− 38 35 +/− 6 15 +/− 7 Day 95 — 212 +/− 53 37 +/− 6 19 +/− 5 Day 100 — 196 +/− 50 37 +/− 10 14 +/− 4
Example 13. Pharmacokinetics of CD33-K334C-CPI and CD33-K392C-CPI ADCs
(239) nu/nu mice were dosed with CD33-K392C-CPI or CD33-K334C-CPI at 3 mg/kg using intravenous administration. Quantitation of the total antibody concentrations in mouse plasma was achieved using Gyrolab™ and Bioaffy 1000 CDs with fluorescence detection. Briefly, the capture protein was BIOT sheep anti-hlgG (The Binding Site, cat# AU003.MCUS01) at 100 μg/mL and the detection antibody was Alexa Fluor 647 goat anti-hlgG (Bethyl, cat#A80-319A) at 2 μg/mL. The quantitation range was 0.0390 to 80 μg/mL, and the lower limit of quantitation was 0.100 μg/mL in plasma. DAR is determined using mass spectrometry and the normalized average DAR was multiplied by the mAb concentration and the resulting exposure was termed the ConjPL (conjugated payload).
(240) The total Ab concentrations were similar through the 14 day collection period while the conjugated payload concentrations paralleled those of the Ab for the first few days before decreasing after 7 or 14 days. These profiles (
(241) TABLE-US-00017 TABLE 17 Residue numbering chart Heavy Chain Heavy Chain (CH2 domain, except A114) (CH3 domain) EU Kabat Position at EU Kabat Position at Residue index numbering SEQ ID NO: 25 Residue index numbering SEQ ID NO: 25 A114 118 114 N/A E345 345 366 115 K246 246 259 16 Q347 347 368 117 D249 249 262 19 S354 354 375 124 D265 265 278 35 R355 355 376 125 S267 267 280 37 L358 358 381 128 D270 270 283 40 K360 360 383 130 N276 276 289 46 Q362 362 385 132 Y278 278 291 48 K370 370 393 140 E283 283 300 53 Y373 373 396 143 K290 290 307 60 S375 375 398 145 R292 292 309 62 D376 376 399 146 E293 293 310 63 A378 378 401 148 E294 294 311 64 E380 380 405 150 Y300 300 319 70 E382 382 407 152 V302 302 321 72 Q386 386 414 156 V303 303 322 73 E388 388 416 158 L314 314 333 84 N390 390 418 160 N315 315 334 85 K392 392 420 162 E318 318 337 88 T393 393 421 163 K320 320 339 90 D401 401 430 171 I332 332 351 102 F404 404 435 174 E333 333 352 103 T411 411 442 181 K334 334 353 104 D413 413 444 183 I336 336 355 106 K414 414 445 184 R416 416 447 186 Q418 418 449 188 Q419 419 450 189 N421 421 452 191 M428 428 459 198 A431 431 462 201 L432 432 463 202 T437 437 468 207 Q438 438 469 208 K439 439 470 209 L443 443 474 213 S444 444 475 214 Kappa Light Chain Lambda Light Chain EU Kabat Position at EU Kabat Position at Residue index numbering SEQ ID No. 30 Residue index numbering SEQ ID No. 31 A111 111 111 4 K110 N/A 110 4 K149 149 149 42 A111 N/A 111 5 K183 183 183 76 L125 N/A 125 19 K188 188 188 81 K149 N/A 149 43 K207 207 207 100 V155 N/A 155 49 N210 210 210 103 G158 N/A 158 52 T161 N/A 161 55 P183 N/A 183 76 Q185 N/A 185 78 S188 N/A 188 81 H189 N/A 189 82 S191 N/A 191 84 T197 N/A 197 90 V205 N/A 205 96 E206 N/A 206 97 K207 N/A 207 98 T208 N/A 208 99 A210 N/A 210 101
(242) TABLE-US-00018 TABLE 18 Sequences 1 CD33 h11A1 EVQLVESGGGLVQPGGSLRLSCAASGYIFTDYVTHW VH Protein VRQAPGKGLEWIAYINPYNAGTKYNERFKGRFTISS DNAKNSLYLQMNSLRAEDTAVYYCARDYRYEIYGMD YWGQGTLVTVSS 2 CD33 GAGGTGCAGCTGGTGGAGTCTGGCGGCGGACTGGTG h11A1 VH DNA CAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCC TCCGGATACATATTCACTGACTATGTTACACACTGG GTGAGGCAGGCCCCTGGCAAGGGCCTGGAGTGGATC GCCTATATTAATCCTTACAATGATGGTACTAAATAC AATGAGAGGTTCAAAGGCCGGTTCACCATCTCCAGC GACAACGCCAAGAACTCCCTGTACCTCCAGATGAAC TCCCTGAGGGCCGAGGATACCGCCGTGTACTACTGT GCCAGAGATTATAGGTACGAAATCTATGGTATGGAC TACTGGGGCCAGGGCACCCTGGTGACCGTGTCCTCT 3 CD33 DIQLTQSPSSLSASVGDRVTITCRASSSVGYMHWYQ h11A1 VL Protein QKPGKAPKLLIYDISQLASGVPSRFSGSGSGTDFIL TISSLQPEDFATYYCQLWSSNPLTFGGGTKVEIK 4 CD33 GACATCCAGCTGACCCAGTCTCCATCCTCCCTGTCT h11A1 VL DNA GCATCTGTAGGAGACAGAGTCACCATCACTTGCAGA GCCAGTTCAAGTGTAGGTTACATGCACTGGTATCAG CAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTAT GACACATCCCAACTGGCTTCTGGGGTCCCATCAAGG TTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTC ACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACT TACTACTGTCAGCTGTGGAGCAGTAACCCGCTCACG TTCGGCGGAGGGACCAAGGTGGAGATCAAA 5 CD33 DYVTH h11A1 VH CDR1 Kabat 6 CD33 GYIFTDY h11A1 VH CDR1 Chothia 7 CD33 GACTATGTTACACAC h11A1 VH CDR1 DNA Kabat 8 CD33 GGATACATATTCACTGACTAT h11A1 VH CDR1 DNA Chothia 9 CD33 YINPYNAGTKYNERFKG h11A1 VH CDR2 Kabat 10 CD33 NPYNAG h11A1 VH CDR2 Chothia 11 CD33 TATATTAATCCTTACAATGCTGGTACTAAATACAAT h11A1 VH CDR2 GAGAGGTTCAAAGGC DNA Kabat 12 CD33 AATCCTTACAATGCTGGT h11A1 VH CDR2 DNA Chothia 13 CD33 DYRYEIYGMDY h11A1 VH CDR3 Kabat and Chothia 14 CD33 GATTATAGGTACGAAATCTATGGTATGGACTAC h11A1 VH CDR3 DNA Kabat and Chothia 15 CD33 EVQLVESGGGLVQPGGSLRLSCAASGYIFTDYVTHW h11A1 HC Protein VRQAPGKGLEWIAYINPYNAGTKYNERFKGRFTISS DNAKNSLYLQMNSLRAEDTAVYYCARDYRYEIYGMD YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPRELLQGSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLICLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPG 16 CD33 GAGGTGCAGCTGGTGGAGTCTGGCGGCGGACTGGTG h11A1 HC DNA CAGCCTGGCGGCTCTCTGAGACTGTCTTGTGCCGCC TCCGGATACATATTCACTGACTATGTTACACACTGG GTGAGGCAGGCCCCTGGCAAGGGCCTGGAGTGGATC GCCTATATTAATCCTTACAATGCTGGTACTAAATAC AATGAGAGGTTCAAAGGCCGGTTCACCATCTCCAGC GACAACGCCAAGAACTCCCTGTACCTCCAGATGAAC TCCCTGAGGGCCGAGGATACCGCCGTGTACTACTGT GCCAGAGATTATAGGTACGAAATCTATGGTATGGAC TACTGGGGCCAGGGCACCCTGGTGACCGTGTCCTCT GCGTCGACCAAGGGCCCATCGGTCTTCCCCCTGGCA CCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCC CTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCG GTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGC GGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCA GGACTCTACTCCCTCAGCAGCGTAGTGACCGTGCCC TCCAGCAGCTTGGGCACCCAGACCTACATCTGCAAC GTGAATCACAAGCCCAGCAACACCAAGGTGGACAAG AAAGTTGAGCCCAAATCTTGTGACCGCACTCACACA TGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGA CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGAC ACCCTCATGATCTCCCGGACCCCTGAGGTCACATGC GTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTC AAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCAT AATGCCAAGACAAAGCCGCGGGAGCTGCTGCAGGGG AGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTG CACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGC AAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAG AAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAA CCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAG ATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTC AAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGG GAGAGCAATGGGCAGCCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTC CTCTATAGCAAGCTCACCGTGGACAAGAGCAGGTGG CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCAT GAGGCTCTGCACAACCACTACACGCAGAAGAGCCTC TCCCTGTCCCCCGGATAGTAG 17 CD33 RASSSVGYMH h11A1 VL CDR1 Protein Kabat and Chothia 18 CD33 AGAGCCAGTTCAAGTGTAGGTTACATGCAC h11A1 VL CDR1 DNA Kabat and Chothia 19 CD33 DTSQLAS h11A1 VL CDR2 Protein Kabat and Chothia 20 CD33 GACACATCCCAACTGGCTTCT h11A1 VL CDR2 DNA Kabat and Chothia 21 CD33 QLWSSNPLT h11A1 VL CDR3 Protein Kabat and Chothia 22 CD33 CAGCTGTGGAGCAGTAACCCGCTCACG h11A1 VL CDR3 DNA Kabat and Chothia 23 CD33 DIQLTQSPSSLSASVGDRVTITCRASSSVGYMHWYQ h11A1 LC Protein QKPGKAPKLLIYDTSQLASGVPSRFSGSGSGTDFTL TISSLQPEDFATYYCQLWSSNPLTFGGGTKVEIKRT VAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 24 CD33 GACATCCAGCTGACCCAGTCTCCATCCTCCCTGTCT h11A1 LC DNA GCATCTGTAGGAGACAGAGTCACCATCACTTGCAGA GCCAGTTCAAGTGTAGGTTACATGCACTGGTATCAG CAGAAACCAGGGAAAGCCCCTAAGCTCCTGATCTAT GACACATCCCAACTGGCTTCTGGGGTCCCATCAAGG TTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTC ACCATCAGCAGTCTGCAACCTGAAGATTTTGCAACT TACTACTGTCAGCTGTGGAGCAGTAACCCGCTCACG TTCGGCGGAGGGACCAAGGTGGAGATCAAACGTACT GTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCT GATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTG TGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAA GTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGT AACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG GACAGCACCTACAGCCTCAGCAGCACCCTGACGCTG AGCAAAGCAGACTACGAGAAACACAAAGTCTACGCC TGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTC ACAAAGAGCTTCAACAGGGGAGAGTGT 25 IgG1 HC; CH2 APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV domain SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AK 26 IgG1 HC; CH2 and APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV CH3 domains SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTIPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K 27 IgG1 K334C ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE CTISKAKGQPREPLVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYLTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 28 IgG1-K392C ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPLVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYCTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 29 IgG1-K334C/K392C ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE CTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYCTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 30 Cκ constant RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE domain AKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC 31 Cλ constant GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPG domain AVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYL SLTPEQWK SHRSYSCQVTHEGSTVEKTVAPTECS 32 CD33-K334C EVQLVESGGGLVQPGGSLRLSCAASGYIFTDYVTHW h11A1 HC Protein VRQAPGKGLEWIAYINPYNAGTKYNERFKGRFTISS DNAKNSLYLQMNSLRAEDTAVYYCARDYRYEIYGMD YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPRELLQGSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIECTISKAKGQPREPQVYTLPPSREE MTKNQVSLICLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPG 33 CD33-K392C EVQLVESGGGLVQPGGSLRLSCAASGYIFTDYVTHW h11A1 HC Protein VRQAPGKGLEWIAYINPYNAGTKYNERFKGRFTISS DNAKNSLYLQMNSLRAEDTAVYYCARDYRYEIYGMD YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPRELLQGSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYCT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPG 34 CD33-K334C/K392C EVQLVESGGGLVQPGGSLRLSCAASGYIFTDYVTHW h11A1 HC Protein VRQAPGKGLEWIAYINPYNAGTKYNERFKGRFTISS DNAKNSLYLQMNSLRAEDTAVYYCARDYRYEIYGMD YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDRTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPRELLQGSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIECTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYCT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPG
(243) The various features and embodiments of the present invention, referred to in individual sections above apply, as appropriate, to other sections, mutatis mutandis. Consequently features specified in one section may be combined with features specified in other sections, as appropriate. All references cited herein, including patents, patent applications, papers, text books, and cited sequence Accession numbers, and the references cited therein are hereby incorporated by reference in their entirety. In the event that one or more of the incorporated literature and similar materials differs from or contradicts this application, including but not limited to defined terms, term usage, described techniques, or the like, this application controls.