PEPTIDE-DERIVED THERAPEUTICS TARGETING KDM5C FOR THE TREATMENT OF CANCER
20220184221 · 2022-06-16
Inventors
Cpc classification
C12N9/0071
CHEMISTRY; METALLURGY
A61K47/645
HUMAN NECESSITIES
C07K2319/10
CHEMISTRY; METALLURGY
C12Y114/11
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K47/64
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention relates to treatment of cancer. In particular, the present invention relates to peptides that bind KDM5C for the treatment of cancer.
Claims
1. A peptide that binds to KDM5C.
2. A peptide that binds to KDM5C, wherein said peptide comprises the sequence: X.sub.1X.sub.2X.sub.3X.sub.4nX.sub.5X.sub.6X.sub.7X.sub.8; where X.sub.1=T or S X.sub.2=D, E or I X.sub.3=T, D or Q X.sub.4=Q, S, N or T X.sub.5=K or Nle X.sub.6=T X.sub.7=H X.sub.3=H X.sub.9=H; or a binding fragment thereof.
3. A peptide that binds to KDM5C and comprises the sequence selected from the group consisting of T D T T K T H H H; T D T Q K T H H H; T D T N K T H H H; T E D S K T H H H; T E D Q K T H H H; T T Q S K T H H H; T D T S K T H H H; T E D T K T H H H; T E E Q K T H H H; S D Q Q K T H H H; T T Q Q K T H H H; S D Q T K T H H H; T D D Q K T H H H; T E E N K T H H H; T E E S K T H H H; T T Q T K T H H H; T D S T K T H H H; S E T Q K T H H H; S E T S K T H H H; T D D N K T H H H; T D T T n T H H H; T D T Q n T H H H; T D T N n T H H H; T E D S n T H H H; T E D Q n T H H H; T T Q S n T H H H; T D T S n T H H H; T E D T n T H H H; T E E Q n T H H H; S D Q Q n T H H H; T T Q Q n T H H H; S D Q T n T H H H; T D D Q n T H H H; T E E N n T H H H; T E E S n T H H H; T T Q T n T H H H; T D S T n T H H H; S E T Q n T H H H; S E T S n T H H H; T D D N n T H H H; R T K Q T A R K S T G G; R T n Q T A R K S T G G; G A K R H R K V L R D N I and G A K R H R n V L R D N I; wherein n=norLeucine (Nle) or a binding fragment thereof.
4. A peptide that binds to KDM5C, wherein said peptide comprises the sequence: X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9; where X.sub.1=T X.sub.2=K, G, L, Q, V, E, H or I X.sub.3=I, L, V or D X.sub.4=L, M, V, F or S X.sub.5=V or K X.sub.6=V, G, R, L, K, F, H, T, A, P, I or N X.sub.7=H X.sub.8=H X.sub.9=H; or a binding fragment thereof.
5. The peptide of any one of claims 1 to 4, further comprising a cell penetrating peptide.
6. The peptide of claim 5, wherein said cell penetrating peptide is a TAT cell penetrating peptide.
7. The peptide of claim 5 or 6, wherein said cell penetrating peptide is attached via a 6-aminohexanoic acid linker.
8. A peptide comprising the sequence selected from the group consisting of: TABLE-US-00009 TDTNnTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TDTQKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TDTNKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TDTSnTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TEDSKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TDTSKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TDTTnTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TEDQnTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TTQSKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TEDQKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; GAKRHRnVLRDNI{6-aminohexanoic acid}GRKKRRQRRRPPQ; SETQnTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; SDQQKTHHH{6-aminohexanoic acid}GRKKRRQRRRPPQ; TDTNnTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TDTQKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TDTNKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TDTSnTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TEDSKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TDTSKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TDTTnTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TEDQnTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TTQSKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TEDQKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; GAKRHRnVLRDNI{6-aminohexanoic acid} FFLIPKGRRRRRRRRR; SETQnTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; SDQQKTHHH{6-aminohexanoic acid}FFLIPKGRRRRRRRRR; TDTNnTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TDTQKTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TDTNKTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TDTSnTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TEDSKTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TDTSKTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TDTTnTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TEDQnTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TTQSKTHHH{6-aminohexanoic acid}RRWRRWRRWRR; TEDQKTHHH{6-aminohexanoic acid}RRWRRWRRWRR; GAKRHRnVLRDNI{6-aminohexanoic acid}RRWRRWRRWRR; SETQnTHHH{6-aminohexanoic acid}RRWRRWRRWRR; and SDQQKTHHH{6-aminohexanoic acid}RRWRRWRRWRR.
9. The peptide of any one of claims 1 to 8, wherein said peptide inhibits KDM5C activity.
10. A polynucleotide encoding one or more peptides of any one of claims 1, 2, 3 and 8.
11. A vector comprising the polynucleotide of claim 10.
12. A pharmaceutical composition comprising one or more peptides of any one of claims 1 to 9, one or more polynucleotides of claim 10 or one or more vectors of claim 11 and a pharmaceutically acceptable carrier.
13. A method of inhibiting the activity of KDM5C in a subject in need thereof, comprising administering one or more of the peptides of any one of claims 1 to 9, one or more polynucleotides of claim 10, one or more vectors of claim 11 or the pharmaceutical composition of claim 12.
14. A method of treating a disease associate with increased KDM5C in a subject in need thereof, comprising administering one or more of the peptides of any one of claims 1 to 9, one or more polynucleotides of claim 10, one or more vectors of claim 11 or the pharmaceutical composition of claim 12.
15. The method of claim 14, wherein the disease is cancer.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
DETAILED DESCRIPTION
[0043] The present invention relates to peptide-derived therapeutics targeting enzymes in the lysine methylation pathway and the use of such therapeutics to treat diseases or disorders associated with dysfunction in lysine methylation. In particular, the present invention relates to peptide-derived therapeutics which target KDM5C and the uses thereof.
[0044] Peptides:
[0045] The present invention provides peptides that bind, optionally specifically bind, to KDM5C. In specific embodiments, the peptides of the present invention bind KDM5C with high affinity. In specific embodiments, the peptides bind to KDM5C and inhibit activity thereof. In certain embodiments, the peptides bind the catalytic core of KDM5C.
[0046] Exemplary peptides are set forth in the table below:
TABLE-US-00002 Experimental SEQ Peptide ID NO: Sequence EP1 1 TDTTKTHHH EP2 2 TDTQKTHHH EP3 3 TDTNKTHHH EP4 4 TEDSKTHHH EP5 5 TEDQKTHHH EP6 6 TTQSKTHHH EP7 7 TDTSKTHHH EP8 8 TEDTKTHHH EP9 9 TEEQKTHHH EP10 10 SDQQKTHHH EP11 11 TTQQKTHHH EP12 12 SDQTKTHHH EP13 13 TDDQKTHHH EP14 14 TEENKTHHH EP15 15 TEESKTHHH EP16 16 TTQTKTHHH EP17 17 TDSTKTHHH EP18 18 SETQKTHHH EP19 19 SETSKTHHH EP20 20 TDDNKTHHH EP21 21 TDTTnTHHH EP22 22 TDTQnTHHH EP23 23 TDTNnTHHH EP24 24 TEDSnTHHH EP25 25 TEDQnTHHH EP26 26 TTQSnTHHH EP27 27 TDTSnTHHH EP28 28 TEDTnTHHH EP29 29 TEEQnTHHH EP30 30 SDQQnTHHH EP31 31 TTQQnTHHH EP32 32 SDQTnTHHH EP33 33 TDDQnTHHH EP34 34 TEENnTHHH EP35 35 TEESnTHHH EP36 36 TTQTnTHHH EP37 37 TDSTnTHHH EP38 38 SETQnTHHH EP39 39 SETSnTHHH EP40 40 TDDNnTHHH EP41 41 RTKQTARKSTGG EP42 42 RTnQTARKSTGG EP43 43 GAKRHRKVLRDNI EP44 44 GAKRHRnVLRDNI n = norLeucine (Nle)
[0047] In certain embodiments of the present invention, the peptides comprise the consensus sequence set forth below:
[0048] X.sub.2X.sub.3X.sub.4X.sub.5THHH; where
[0049] X.sub.1=T or S
[0050] X.sub.2=D, E or I
[0051] X.sub.3=T, D or Q
[0052] X.sub.4=Q, S, N or T
[0053] X.sub.5=K or Nle
[0054] . (SEQ ID NO:65)
[0055] In certain embodiments of the present invention, there is provided a peptide comprising the sequence as set forth in any one of SEQ ID NOs: EP1-40.
[0056] In certain embodiments, the peptide inhibitors are modified from the natural substrate peptides of KDM5C. The natural substrate peptides of KDM5C include histones H3-K4 and H4-K20. In specific embodiments, the peptide inhibitors are histones H3-K4 and H4-K20 with Lys to nor-Leu mutations. In specific embodiments, the peptides comprise the sequence as set forth in any one of SEQ ID NO: EP41-44.
[0057] In certain embodiments of the present invention, there is provided peptides comprising variant sequences other than those specifically disclosed herein, which comprise significant sequence identity (e.g. 75%, 80%, 85%, 90%, 95%, 98%, or 99% sequence identity) to the amino acid sequence provided that such peptides retain the ability to inhibit KDM5C activity. Such peptides can comprise one or more amino acid substitutions, additions, deletions, or insertions as compared to the parent amino acid sequence. Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties. For instance, the conservative amino acid substitution can be an acidic amino acid substituted for another acidic amino acid (e.g. Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g. Ala, Gly, Val, Ile, Leu, Met, Phe, Pro, Trp, Val, etc.), a basic amino acid substituted for another basic amino acid (Lys, Arg, etc.), an amino acid with a polar side chain substituted for another amino acid with a polar side chain (Asn, Cys, Gln, Ser, Thr, Tyr, etc.), etc. In certain embodiments, naturally occurring amino acids in the peptides are replaced with amino acid analogs and derivatives thereof.
[0058] A worker skilled in the art could readily determine amino acid substitutions or truncations which impact binding activity of the peptides of the present invention. In certain embodiments, there is provided the EP4 peptide (i.e. the peptide comprising T E D S K T H H H) comprising one or more substitutions.
[0059]
[0060] X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9; where
[0061] X.sub.1=T
[0062] X.sub.2=K, G, L, Q, V, E, H or I
[0063] X.sub.3=I, L, V or D
[0064] X.sub.4=L, M, V, For S
[0065] X.sub.5=V or K
[0066] X.sub.6=V, G, R, L, K, F, H, T, A, P, I or N
[0067] X.sub.7=H
[0068] X.sub.3=H
[0069] X.sub.9=H.
[0070] In certain embodiments of the present invention, there is provided peptides comprising a fragment of the sequences specifically disclosed herein comprising at least 5 contiguous amino acids, provided that such peptides retain the ability to inhibit KDM5C activity.
[0071] In certain embodiments of the present invention, the peptides or fragments thereof comprise additional amino acids at the N and/or C terminus. In certain embodiments, the peptides of the present invention comprise A or AA at the N terminus. In certain embodiments, the peptides of the present invention comprise A or AA at the C terminus. In certain embodiments, the peptides of the present invention comprise A or AA at the N and C terminals. In certain embodiments of the present invention, there is provided a conjugate or fusion protein comprising the peptide of the present invention and heterologous amino acid sequence.
[0072] In certain embodiments, the peptides of the present invention includes a linker sequence. Linkers are known in the art and are generally classified into 3 categories according to their structures: (1) flexible linkers, (2) rigid linkers, and (3) in vivo cleavable linkers. Besides the basic role in linking the functional peptides together (as in flexible and rigid linkers) or releasing free functional peptide inhibitor in vivo (as in in vivo cleavable linkers), linkers may offer many other advantages for the production of inhibitor peptides, such as improving biological activity, increasing expression yield, and achieving desirable pharmacokinetic profiles.
TABLE-US-00003 Linker Model Advantages Example(s) Flexible Allows for interaction between functional peptide and delivery mechanism (i.e., functional units) (GGGGS)n, (G)n, 6-amino- hexanoic acid (i.e., ahx)
Increases separation between functional units Rigid
Maintain distance between functional units (EAAAK)n, (XP)n Cleavable
Allows for in vivo separation of functional units Disulphide, protease sensitive peptide sequences
[0073] In certain embodiments, the peptides of the present invention further comprise a 6-aminohexanoic acid linker. The chemical structure of the linker is set forth below:
##STR00001##
[0074] In specific embodiments, a cell penetrating peptide is conjugated to the peptide of the invention via a linker sequence.
[0075] In certain embodiments of the present invention, the peptides comprise other modifications including, without limitation, glycosylations, acetylations, phosphorylations, PEG, D-amino acids, nanoparticles, solid lipid nanoparticles, esterification, N-acetylation or may be formulated with liposomes, nano-emulsions, mucoadhesive polymers, nanoparticles, solid lipid nanoparticles.
[0076] It is known in the art that peptide modifications may improve therapeutic peptide delivery by increasing stability, inhibiting enzyme activity, enhancing absorption and/or cell targeting.
Mechanisms of Therapeutic Peptide Delivery
[0077]
TABLE-US-00004 Goal Peptide modification/formulations Stomach Increased stability PEG, D-amino acids, nanoparticles, solid lipid nanoparticles Small intestine Increased stability cyclization, PEG, lipidation, D-amino acids, polymer matrices, nanoparticles, esterification, N-acetylation Enzyme inhibitors soybean trypsin inhibitor, aprotinin, puromycin, bacitracin Absorption chitosans, fatty acids, lectins, Zonula occludens enhancers toxin, cell penetrating peptides, liposomes, nano- emulsions, mucoadhesive polymers, nanoparticles, solid lipid nanoparticles Circulation Increased stability PEG, hyper-glycosylation, liposomes, nanoparticles Cell targeting Antibody, cell penetrating peptides
[0078] The peptides of the present invention may be coupled, either directly or via a linker, to a cell penetrating motif or other moiety so as to more efficiently facilitate the delivery of the peptide to the interior of a cell. Thus, the peptide can be provided as part of a composition or conjugate comprising the peptide and cell penetrating motif or other moiety. Any of various cell penetrating motifs and or other moieties useful for these purposes can be used. By way of illustration, suitable cell penetrating motifs and other relevant moieties (e.g. cell-membrane anchoring moieties) include lipids and fatty acids, cell penetrating peptides, and other types of carrier molecules (e.g. Pep-1).
[0079] In certain embodiments, the peptides of the present invention are coupled either directly or via a linker to a cell penetrating peptide. A repository of cell penetrating peptide can be found at crdd.osdd.net/Raghava/cppsite/index.html. Exemplary cell penetrating peptide are set forth in the table below:
TABLE-US-00005 CPP name Sequence Origin Class TAT48-60 GRKKRRQRRRPPQ (SEQ ID NO: 45) HIV-1 TAT protein Cationic TAT49-57 RKKRRQRRR (SEQ ID NO: 46) HIV-1 TAT protein Cationic Penetratin, RQIKIWFQNRRMKWKK (SEQ ID NO: 47) Antennapedia Drosophila Cationic pAntp(43-58) melanogaster Polyarginines Rn Chemically synthesized Cationic DPV1047 VKRGLKLRHVRPRVTRMDV (SEQ ID Chemically synthesized Cationic NO: 48) PR9 FFLIPKGRRRRRRRRR (SEQ ID NO: 49) Chemically synthesized Cationic Mut6DPT (CPP) RRWRRWRRWRR (SEQ ID NO: 50) Chemically synthesized Cationic MPG GALFLGFLGAAGSTMGAWSQPKKKRKV HIV glycoprotein 41/sV40 T Amphipathic (SEQ ID NO: 51) antigen NLS Pep-1 KETWWETWWTEWSQPKKKRKV (SEQ ID Tryptophan-rich Amphipathic NO: 52) cluster/SV40 T antigen NLS pVEC LLIILRRRIRKQAHAHSK (SEQ ID NO: 53) Vascular endothelial Amphipathic cadherin ARF(1-22) MVRRFLVTLRIRRACGPPRVRV (SEQ ID p14ARF protein Amphipathic NO: 54) BPrPr(1-28) MVKSKIGSWILVLFVAMWSDVGLCKKRP N terminus of unprocessed Amphipathic (SEQ ID NO: 55) bovine prion protein MAP KLALKLALKALKAALKLA (SEQ ID NO: 56) Chemically synthesized Amphipathic Transportan GVVTLNSAGYLLGKINLKALAALAKKIL Chimeric galanin- Amphipathic (SEQ ID NO: 57) mastoparan p28 LSTAADMQGVVTDGMASGLDKDYLKPDD Azurin Amphipathic (SEQ ID NO: 58) VT5 DPKGDPKGVTVTVTVTVTGKGDPKPD Chemically synthesized Amphipathic (SEQ ID NO: 59) Bac 7 RRIRPRPPRLPRPRPRPLPFPRPG (SEQ Bactenecin family of Amphipathic (Bac 1-24) ID NO: 60) antimicrobial peptides C105Y CSIPPEVKFNKPFVYLI (SEQ ID NO: 61) α1-Antitrypsin Hydrophobic PFVYLI PFVYLI (SEQ ID NO: 62) Derived from synthetic Hydrophobic C105Y Pep-7 SDLWEMMMVSLACQY (SEQ ID NO: 63) CHL8 peptide phage clone Hydrophobic Repository can be found at crdd.osdd.net/Raghava/cppsite/index.html
[0080] In certain embodiments of the present invention, a TAT cell penetrating peptide is linked either directly or via a linker to the peptides of the present invention. In certain embodiments of the present invention, a TAT cell penetrating peptide comprising the sequence GRKKRRQRRRPPQ is linked to the peptides of the present invention directly or via a linker. In certain embodiments of the present invention, a TAT cell penetrating peptide comprising the sequence GRKKRRQRRRPPQ is linked to the peptides of the present invention via a 6-aminohexanoic acid linker. In certain embodiments, the cell penetrating peptide is linked to the N-terminus of the peptide either directly or indirectly via a linker. In certain embodiments, the cell penetrating peptide is linked to the C-terminus of the peptide either directly or indirectly via a linker.
[0081] In specific embodiments of the present invention, there is provided a peptide-derived inhibitor comprising the sequence set forth in the table below:
TABLE-US-00006 KDM5C peptide inhibitor sequence complete with delivery peptide. Inhibitor Sequence EP4-TAT TEDSKTHHH{6-aminohexanoic acid} GRKKRRQRRRPPQ EP4-PR9 TEDSKTHHH{6-aminohexanoic acid} FFLIPKGRRRRRRRRR EP4-CPP TEDSKTHHH{6-aminohexanoic acid} RRWRRWRRWRR
[0082] The peptides of the present invention can be biochemically synthesized such as by using standard solid phase techniques. These methods include exclusive solid phase synthesis, partial solid phase synthesis methods, fragment condensation, classical solution synthesis. Solid phase polypeptide synthesis procedures are well known in the art.
[0083] Recombinant techniques may also be used to generate the peptides of the present invention. Such recombinant techniques are known in the art. Accordingly, the present invention also provides a nucleic acid encoding the amino acid sequence of the peptide, and conjugates comprising the peptide. The nucleic acid can comprise DNA or RNA, and can be single or double stranded. Furthermore, the nucleic acid can comprise nucleotide analogues or derivatives (e.g. inosine or phophorothioate nucleotides and the like). The nucleic acid can encode the amino acid sequence of the peptide as part of a fusion protein comprising such sequence and a cell penetrating motif. The nucleic acid encoding the amino acid sequence of the peptide can be provided as part of a construct comprising the nucleic acid and elements that enable delivery of the nucleic acid to a cell, and/or expression of the nucleic acid in a cell. Such elements include, for example, expression vectors and transcription and/or translation sequences. Suitable vectors, transcription/translation sequences, and other elements, as well as methods of preparing such nucleic acids and constructs, are known in the art.
[0084] Accordingly, in certain embodiments polynucleotide encoding and expressing one or more peptide(s) of the invention. In another preferred embodiment, the polynucleotide is inserted in a vector. Preferably, said recombinant vector is an expression vector capable of expressing said polynucleotide when transfected or transformed into a host cell such as a prokaryotic or eukaryotic cell. The polynucleotide is inserted into an expression vector in proper orientation and correct reading frame for expression. In certain embodiments, the polynucleotide is operably linked to at least one transcriptional regulatory sequence and, optionally to at least one translational regulatory sequence. Recombinant vectors are known in the art and include but are not limited to plasmids and viral vectors. Viral vectors include but are not limited to oncolytic viral vectors, lentivirus and adenovirus vectors.
[0085] Pharmaceutical Compositions:
[0086] The peptides and peptide derived inhibitors of the present invention be formulated as a pharmaceutical composition. In certain embodiments, the pharmaceutical composition comprises one or more peptides and peptide derived inhibitors of the invention alone or in combination with one or more other active agents and a pharmaceutically acceptable carrier.
[0087] Polynucleotides and vectors encoding the peptides of the invention may also be formulated as pharmaceutical compositions. In certain embodiments, the pharmaceutical composition comprises one or more polynucleotides or one or more vectors of the present invention alone or in combination with one or more other active agents and a pharmaceutically acceptable carrier.
[0088] The pharmaceutical composition may comprise one or more other pharmaceutically active agents or drugs. Examples of such other pharmaceutically active agents or drugs that may be suitable for use in the pharmaceutical composition include anticancer agents. Suitable anticancer agents include, without limitation, alkylating agents; nitrogen mustards; folate antagonists; purine antagonists; pyrimidine antagoinists; spindle poisons; topoisomerase inhibitors; apoptosis inducing agents; angiogenesis inhibitors; podophyllotoxins; nitrosoureas; cisplatin; carboplatin; interferon; asparginase; tamoxifen; leuprolide; flutamide; megestrol; mitomycin; bleomycin; doxorubicin; irinotecan; and taxol, geldanamycin and various anti-cancer peptides and antibodies.
[0089] The carrier may be any of those conventionally used and is limited only by physio-chemical considerations, such as solubility and lack of reactivity with the active compound(s), and by the route of administration. The pharmaceutically acceptable carriers described herein, for example, vehicles, adjuvants, excipients, and diluents, are well-known to those skilled in the art and are readily available to the public. The pharmaceutically acceptable carrier may be one which is chemically inert to the active agent(s) and one which has no detrimental side effects or toxicity under the conditions of use.
[0090] The choice of carrier will be determined in part by the active agents, as well as the method of administration. Accordingly, there are a variety of suitable formulations of the pharmaceutical composition of the present inventive methods. The following formulations for oral, aerosol, topical, parenteral, subcutaneous, intravenous, intramuscular, interperitoneal, rectal, and vaginal administration are exemplary and are in no way limiting. One skilled in the art will appreciate that these routes of administering the compound of the invention are known, and, formulations appropriate for each of these routes of administration are known in the art.
[0091] In certain embodiments, one or more peptides of the present invention are conjugated, directly or indirectly, to a carrier. Appropriate carriers are known in the art and include but are not limited to proteins including but not limited to keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA) and ovalbumin (OVA); virus-like particles and viruses.
[0092] Methods of Treatment
[0093] The present invention also provides methods of inhibiting KDM5C activity. This method comprises bringing KDM5C into contact with a peptide, peptide derived inhibitor or a pharmaceutical composition of the present invention. This contact may occur in vivo or in vitro. Accordingly, in certain embodiments, the present invention provides methods of inhibiting the activity of KDM5C in a subject in need thereof, by administering one or more peptide(s), one or more peptide(s) derived inhibitor(s), one or more polynucleotide(s) or vector(s) encoding one or more peptide(s) or one or more pharmaceutical composition(s) of the present invention alone or in combination with one or more other active agents. The subject may be a mammal. In certain embodiments, the subject is a human.
[0094] The present invention also provides methods of treatment of disease associated with increased KDM5C activity. Accordingly, in certain embodiments, the present invention provides methods of treatment of disease associated with increased KDM5C activity in a subject in need thereof, by administering to the with one or more peptide(s), one or more peptide(s) derived inhibitor(s), one or more polynucleotide(s) or vector(s) encoding one or more peptide(s) or one or more pharmaceutical composition(s) of the present invention alone or in combination with one or more other active agents.
[0095] In certain embodiments, the disease associated with increased KDM5C activity is a proliferative disease. In certain embodiments, the proliferative disease is cancer. Accordingly, in certain embodiments, the present invention provides methods of treatment of a cancer associated with increased KDM5C activity in a subject in need thereof, by administering one or more peptide(s), one or more peptide(s) derived inhibitor(s), one or more polynucleotide(s) or vector(s) encoding one or more peptide(s) or one or more pharmaceutical composition(s) of the present invention alone or in combination with one or more other active agents.
[0096] The types of cancer include but are not limited to a cancer selected from the group consisting of acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g. lymphangiosarcoma, lymphangioendothelio sarcoma, hemangio sarcoma); appendix cancer; benign monoclonal gammopathy; biliary cancer (e.g. cholangiocarcinoma); bladder cancer; breast cancer (e.g. adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast, triple negative breast cancer (TNBC), ER positive breast cancer, ER negative breast cancer, PR positive breast cancer, PR negative breast cancer, ER/PR positive breast cancer, ER/PR negative breast cancer, HER2 positive breast cancer, HER2 negative breast cancer); brain cancer (e.g. meningioma, glioblastomas, glioma (e.g. astrocytoma, oligodendroglioma), medulloblastoma); bronchus cancer; carcinoid tumor; cervical cancer (e.g. cervical adenocarcinoma, squamous cell carcinoma of the cervix); choriocarcinoma; chordoma; craniopharyngioma; colorectal cancer (e.g. colon cancer, rectal cancer, colorectal adenocarcinoma); connective tissue cancer; epithelial carcinoma; ependymoma; endotheliosarcoma (e.g. Kaposi's sarcoma, multiple idiopathic hemorrhagic sarcoma); endometrial cancer (e.g. uterine cancer, uterine sarcoma); esophageal cancer (e.g. adenocarcinoma of the esophagus, Barrett's adenocarcinoma); Ewing's sarcoma; ocular cancer (e.g. intraocular melanoma, retinoblastoma); familiar hypereosinophilia; gall bladder cancer; gastric cancer (e.g. stomach adenocarcinoma); gastrointestinal stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g. head and neck squamous cell carcinoma, oral cancer (e.g. oral squamous cell carcinoma), throat cancer (e.g. laryngeal cancer, pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer)); heavy chain disease (e.g. alpha chain disease, gamma chain disease, mu chain disease; hemangioblastoma; hypopharynx cancer; inflammatory myofibroblastic tumors; immunocytic amyloidosis; kidney cancer (e.g. nephroblastoma a.k.a. Wilms' tumor, renal cell carcinoma); liver cancer (e.g. hepatocellular cancer (HCC), malignant hepatoma); lung cancer (e.g. bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung); leiomyosarcoma (LMS); mastocytosis (e.g. systemic mastocytosis); muscle cancer; myelodysplasia syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD) (e.g. polycythemia vera (PV), essential thrombocytosis (ET), agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF), chronic idiopathic myelofibrosis, chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)); neuroblastoma; neurofibroma (e.g. neurofibromatosis (NF) type 1 or type 2, schwannomatosis); neuroendocrine cancer (e.g. gastroenteropancreatic neuroendocrine tumor (GEP-NET), carcinoid tumor); osteosarcoma (e.g. bone cancer); ovarian cancer (e.g. cystadenocarcinoma, ovarian embryonal carcinoma, ovarian adenocarcinoma); papillary adenocarcinoma; pancreatic cancer (e.g. pancreatic andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors); penile cancer (e.g. Paget's disease of the penis and scrotum); pinealoma; primitive neuroectodermal tumor (PNT); plasma cell neoplasia; paraneoplastic syndromes; intraepithelial neoplasms; prostate cancer (e.g. prostate adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland cancer; skin cancer (e.g. squamous cell carcinoma (SCC), keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small bowel cancer (e.g. appendix cancer); soft tissue sarcoma (e.g. malignant fibrous histiocytoma (MFH), liposarcoma, malignant peripheral nerve sheath tumor (MPNST), chondrosarcoma, fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small intestine cancer; sweat gland carcinoma; synovioma; testicular cancer (e.g. seminoma, testicular embryonal carcinoma); thyroid cancer (e.g. papillary carcinoma of the thyroid, papillary thyroid carcinoma (PTC), medullary thyroid cancer); urethral cancer; vaginal cancer; and vulvar cancer (e.g. Paget's disease of the vulva).
[0097] In specific embodiments of the present invention, there is provided a method of treatment of a cancer in a subject in need thereof, by administering to the with a peptide, peptide derived inhibitor or a pharmaceutical composition of the present invention, wherein the cancer is selected from the group consisting of bladder, non-small lung carcinoma, small cell lung carcinoma, leukemia, liver, breast, colon, and pancreatic cancer.
[0098] In certain embodiments, the cancer is a metastatic cancer.
[0099] In certain embodiments, one or more peptide(s), one or more peptide(s) derived inhibitor(s), one or more polynucleotide(s) or vector(s) encoding one or more peptide(s) or one or more pharmaceutical composition(s) of the present invention are used in combination with additional pharmaceutical agents in the methods of the present invention.
[0100] The additional pharmaceutical agents may include but are not limited to anti-cancer agents. Anti-cancer agents encompass biotherapeutic anti-cancer agents as well as chemotherapeutic agents.
[0101] Exemplary biotherapeutic anti-cancer agents include, but are not limited to, interferons, cytokines (e.g. tumor necrosis factor, interferon a, interferon γ), vaccines, hematopoietic growth factors, monoclonal serotherapy, immuno stimulants and/or immunodulatory agents (e.g. IL-1, 2, 4, 6, or 12), immune cell growth factors (e.g. GM-CSF) and antibodies (e.g. HERCEPTIN (trastuzumab), T-DM1, AVASTIN (bevacizumab), ERBITUX (cetuximab), VECTIBIX (panitumumab), RITUXAN (rituximab), BEXXAR (tositumomab)).
[0102] Exemplary chemotherapeutic agents include, but are not limited to, anti-estrogens (e.g. tamoxifen, raloxifene, and megestrol), LHRH agonists (e.g. goscrclin and leuprolide), anti-androgens (e.g. flutamide and bicalutamide), photodynamic therapies (e.g. vertoporfin (BPD-MA), phthalocyanine, photo sensitizer Pc4, and demethoxy-hypocrellin A (2BA-2-DMHA)), nitrogen mustards (e.g. cyclophosphamide, ifosfamide, trofosfamide, chlorambucil, estramustine, and melphalan), nitrosoureas (e.g. carmustine (BCNU) and lomustine (CCNU)), alkylsulphonates (e.g. busulfan and treosulfan), triazenes (e.g. dacarbazine, temozolomide), platinum containing compounds (e.g. cisplatin, carboplatin, oxaliplatin), vinca alkaloids (e.g. vincristine, vinblastine, vindesine, and vinorelbine), taxoids (e.g. paclitaxel or a paclitaxel equivalent such as nanoparticle albumin-bound paclitaxel (Abraxane), docosahexaenoic acid bound-paclitaxel (DHA-paclitaxel, Taxoprexin), polyglutamate bound-paclitaxel (PG-paclitaxel, paclitaxel poliglumex, CT-2103, XYOTAX), the tumor-activated pro-drug (TAP) ANG1005 (Angiopep-2 bound to three molecules of paclitaxel), paclitaxel-EC-1 (paclitaxel bound to the erbB2-recognizing peptide EC-1), and glucose-conjugated paclitaxel, e.g. 2′-paclitaxel methyl 2-glucopyranosyl succinate; docetaxel, taxol), epipodophyllins (e.g. etoposide, etoposide phosphate, teniposide, topotecan, 9-am inocamptothecin, camptoirinotecan, irinotecan, crisnatol, mytomycin C), antimetabolites, DHFR inhibitors (e.g. methotrexate, dichloromethotrexate, trimetrexate, edatrexate), IMP dehydrogenase inhibitors (e.g. mycophenolic acid, tiazofurin, ribavirin, and EICAR), ribonuclotide reductase inhibitors (e.g. hydroxyurea and deferoxamine), uracil analogs (e.g. 5-fluorouracil (5-FU), floxuridine, doxifluridine, ratitrexed, tegafur-uracil, capecitabine), cytosine analogs (e.g. cytarabine (ara C), cytosine arabinoside, and fludarabine), purine analogs (e.g. mercaptopurine and Thioguanine), Vitamin D3 analogs (e.g. EB 1089, CB 1093, and KH 1060), isoprenylation inhibitors (e.g. lovastatin), dopaminergic neurotoxins (e.g. I-methyl-4-phenylpyridinium ion), cell cycle inhibitors (e.g. staurosporine), actinomycin (e.g. actinomycin D, dactinomycin), bleomycin (e.g. bleomycin A2, bleomycin B2, peplomycin), anthracycline (e.g. daunorubicin, doxorubicin, pegylated liposomal doxorubicin, idarubicin, epirubicin, pirarubicin, zorubicin, mitoxantrone), MDR inhibitors (e.g. verapamil), Ca<2+> ATPase inhibitors (e.g. thapsigargin), imatinib, thalidomide, lenalidomide, tyrosine kinase inhibitors (e.g. axitinib (AG013736), bosutinib (SKI-606), cediranib (RECENTIN™, AZD2171), dasatinib (SPRYCEL®, BMS-354825), erlotinib (TARCEVA®), gefitinib (IRESSA®), imatinib (Gleevec®, CGP57148B, STI-571), lapatinib (TYKERB®, TYVERB®), lestaurtinib (CEP-701), neratinib (HKI-272), nilotinib (TASIGNA®), semaxanib (semaxinib, SU5416), sunitinib (SUTENT®, SU11248), toceranib (PALLADIA®), vandetanib (ZACTEVIA®, ZD6474), vatalanib (PTK787, PTK/ZK), trastuzumab (HERCEPTIN®), bevacizumab (AVASTIN®), rituximab (RITUXAN®), cetuximab (ERBITUX®), panitumumab (VECTIBIX®), ranibizumab (Lucentis®), nilotinib (TASIGNA®), sorafenib (NEXAVAR®), everolimus (AFINITOR®), alemtuzumab (CAMPATH®), gemtuzumab ozogamicin (MYLOTARG®), temsirolimus (TORISEL®), ENMD-2076, PCI-32765, AC220, dovitinib lactate (TKI258, CHIR-258), BIBW 2992 (TOVOK™), SGX523, PF-04217903, PF-02341066, PF-299804, BMS-777607, ABT-869, MP470, BIBF 1120 (V ARGATEF®), AP24534, JNJ-26483327, MGCD265, DCC-2036, BMS-690154, CEP-11981, tivozanib (AV-951), OSI-930, MM-121, XL-184, XL-647, and/or XL228), proteasome inhibitors (e.g. bortezomib (VELCADE)), mTOR inhibitors (e.g. rapamycin, temsirolimus (CCI-779), everolimus (RAD-001), ridaforolimus, AP23573 (Ariad), AZD8055 (AstraZeneca), BEZ235 (Novartis), BGT226 (Norvartis), XL765 (Sanofi Aventis), PF-4691502 (Pfizer), GDC0980 (Genetech), SF1126 (Semafoe) and OSI-027 (OSI)), oblimersen, gemcitabine, caraiinomycin, leucovorin, pemetrexed, cyclophosphamide, dacarbazine, procarbizine, prednisolone, dexamethasone, campathecin, plicamycin, asparaginase, aminopterin, methopterin, porfiromycin, melphalan, leurosidine, leurosine, chlorambucil, trabectedin, procarbazine, discodermolide, carminomycin, aminopterin, and hexamethyl melamine.
EXAMPLE
[0103] The example below details the development of peptide inhibitors that target KDM5C. The focus on the KDM5 family (histone H3K4me2/3 demethylases) results from growing evidence for a causal role of these KDMs in a number of different human cancers, contributing to cancer cell proliferation and drug resistance. KDM5C in ovarian, breast, prostate, and colon cancer, in addition to other tumors, is highly expressed and involved in the regulation of tumor-related gene expression through the abnormal demethylation of histone H3K4me2/3. Colon cancer is the second most common among malignant solid tumors. Chemotherapy is a standard treatment for this disease; however, the number of effective chemotherapy drugs available to treat colon cancer is limited. Recent studies have shown that KDM5C may have a specific role in drug resistance in colon cancer, and that KDM5C is overexpressed in some lung, gastric and cervical cancers (Lin et al., 2018). The importance of KDM5 H3K4me2/3-specific demethylase activity towards its role in cell proliferation and drug resistance in cancer has not been resolved so far, and it's unclear how much of KDM5's role in cancer is attributable to histone-specific demethylation. KDM5C regulation is extensive and has been reported to downregulate the genes that regulate cell proliferation, including the tumor protein p53, PCNA, MKI67, and the cyclin-dependent inhibitor, p21, thereby promoting cell proliferation (Xu et al., 2017; Stein et al., 2014). In agreement with these findings, unpublished preliminary research from the Biggar lab also suggests that KDM5C may also function through the demethylation of the tumor protein, p53 at trimethylated lysine K370me3, effectively decreasing p53 activity and decreasing the expression of p21 and PCNA. Furthermore, KDM5C downregulates BMP7 in liver cancer and BRMS1 in breast cancer to promote invasion, inhibits the von-Hippel Lindau (VHL) tumor suppressor gene, and has been shown to downregulate ABCC1 expression thereby promoting drug resistance in colon cancer (Lin et al., 2018; Stein et al, 2014; Ji et al., 2015; Wang et al., 2015). Interestingly, this presents a mechanism whereby KDM5C inhibition may decrease drug cancer cell resistance in colon cancer, but may also be a conserved mechanism for the treatment of other KDM5C-dependent cancers. As a result of its established role in cancer development and progression, there has been significant interest in the development of KDM5-specific inhibitors. To date, one highly regarded inhibitor of the KDM5 family of demethylases is available under the name CPI-455 and has been shown to increase global H3K4me3 methylation levels, however, this inhibitor unfortunately has weak activity towards KDM5 inhibition in vivo with an IC50 of ˜25 uM (Vinogradova et al., 2016).
[0104] Materials and Methods
[0105] KDM5C Construct Information
[0106] The plasmid used to product recombinant KDM5C was:
[0107] Vector Name: pFB-CT10HF-LIC
[0108] Construct ID: JARID1CA-c022
[0109] The sequence of recombinant KDM5C is set forth below (SEQ ID NO:64):
TABLE-US-00007 MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPP ADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGS SLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGK NIGSLLRSHYERIVYPYEMYQSGANLVQCNTRPFDNEEKDKEYKPHSIP LRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGAGPKM MGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLES KEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCD GCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRPPEAFGFEQATREY TLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLVNSIEEDVTVEYG ADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHI NADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPS LAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQ CAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLR RYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKALLE KGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVCLSHIN DLCKCSSSRQYLRYRYTLDELPAMLHKLKV
[0110] Purification of Recombinant Target Proteins
[0111] Expression and Purification of KDM5C
[0112] SF9 cells (500 mL at 10.sup.6 cells/mL) were infected with KDM5C-His.sub.6 baculovirus at a 1:100 ratio. After 60 hr post-infection, cells were harvested by centrifugation and the pellet was frozen on liquid nitrogen. Cells were lysed in P5 buffer (50 mM NaHPO4 pH 7, 500 mM NaCl, 10% glycerol, 0.05% TritonX-100, 0.5 mM DTT, 5 mM Imidazole and protease inhibitors) and homogenized by 20 passes through a dounce homogenizer (pestle A) followed by sonication (three times each for 30 sec at 40% intensity). The dounce homogenized cell lysate was incubated with 1 mM MgCl.sub.2 and 2.5 U/ml benzonase nuclease at 4° C. for 1 hr followed by centrifugation at 18,000 g for 45 min. The soluble cell lysate was incubated with prewashed 200 μL HisPur™ Ni-NTA Resin with P5 buffer for 1 hr at 4° C. The beads were pelleted by centrifugation at 800×g for 2 min, the supernatant was removed and the beads were washed 4 times each of 5 min with P40 buffer under rotation at 4° C. Finally, the protein was eluted with P500 buffer. The purified protein was dialyzed in storage buffer (20 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT), snap frozen on liquid nitrogen and stored in small aliquots at −80° C.
[0113] Synthesis of Oriented Peptide Array Library (OPAL)
[0114] The peptide libraries were synthesized on cellulose membrane using the ResPep SL automatic peptide and SPOT array synthesizer (Intavis). An extra fine needle tip was used to achieve a density of 600 peptides per SPOT membrane (8×12 cm). The following oriented peptide library arrays were synthesized for binding dependent interactions: AXXXX[Lys]XXXXA and AXXXX[nor-Leu]XXXXA; where X is a mixture of 19 amino acids (except Cys), and the brackets ([/]) encase the amino acids that were preferred by the protein of interest. To generate oriented peptide library pools, each degenerated position was scanned with any of the 19 amino acids (excluding Cys).
[0115] Target Protein Binding Assays
[0116] The OPAL was designed sequentially starting from the most degenerate to highly specific peptide against our target protein as described above. The potential inhibitor peptides were initially screened based on the binding affinity between the peptides and target proteins. All the steps were carried out at room temperature unless otherwise stated. The OPAL cellulose macro arrays are presoaked in 100% ethanol followed by 50% ethanol for 15 min with constant rocking. The membrane is then washed with distilled water three times each of 15 min. The processed membrane is first blocked with 5% nonfat dry milk in Tris buffered saline containing 0.05% Tween 20 (TBST) for 1 hr at room temperature. Finally, the array was equilibrated with peptide binding buffer (50 mM Tris-CI, 350 mM NaCl, 10% glycerol, 0.5 mM DTT and 0.05% Tween20). The array was then incubated with 1 μM of target protein overnight at 4° C. under rotation. The excess protein was washed away by three consecutive 10 min washes with TBST. Each array was then incubated with HRP conjugated anti-His antibody (1:5000) in TBST for 1 hr. The array was then washed thrice each of 10 min. The signals were detected using chemiluminescence. The signal intensities observed were subjected to densitometry analysis using ImageJ software protein array analyzer.
[0117] In Vitro Lysine Demethylase Activity Inhibition Assay
[0118] Inhibition of in vitro demethylase activity by the peptides was analysed using Succinate-Glo™ JmjC demethylase assay kit (Promega). The experiment was performed in low-volume 384-well plates at room temperature as per the manufacturer's instruction.
[0119] Fluorescent Polarization
[0120] Recombinant KDM5C protein was serially diluted in a 384-well plate, followed by the addition of fluorescein-labeled inhibitor peptide in PBS buffer. The mixtures were incubated in the dark for 30 min prior to fluorescent polarization measurements at room temperature on an EnVision Multilabel Plate Reader (PerkinElmer) with the excitation set at 480 nm and emission at 535 nm. Binding curves were generated by fitting the binding data to a hyperbolic nonlinear regression model using Prism 3.0 (GraphPad software, Inc., San Diego, Calif.), which also produced the corresponding dissociation constants (K.sub.d).
[0121] Delivery of Inhibitor Peptide to the Cell Line
[0122] Synthesis of three different cell penetrating peptide peptide with sequence Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Gln (i.e., TAT), Phe-Phe-Leu-Ile-Pro-Lys-Gly-(Arg).sub.9 (i.e., PR9) and (Arg-Arg-Trp).sub.3-Arg-Arg (i.e., MutD6 or CPP) were carried out by solid phase synthesis on a ResPep SL peptide synthesizer (INTAVIS)) following the Fmoc chemistry protocol. A 6-carboxyfluorescein (FITC derivative, referred to as only FITC in this document) was added to the C-terminal end of the peptides for ligation to a fluorochrome FITC and was separated by the addition of a 6-aminohexanoic acid group to provide both (1) fluor flexibility and (2) reduce steric constraints of the molecule.
[0123] To evaluate the internalization of FITC-labelled peptides, exponentially growing HCT 116 cells were seeded on 6 well plate at a density of 2×10.sup.5 cells per well and incubated overnight. After overnight incubation, the media (DMEM with penstrep and 10% FBS) was replaced with fresh media supplemented with 10 μM FITC-labelled inhibitor peptides. Following the incubation (24 hr), cells were washed three times with ice cold PBS to remove the excess extracellular complexes. Cells were then stained with Hoechst dye (1:2000 dilution from 10 mg/mL stock in PBS) directly adding sufficient staining solution to the well. Cells were incubated for 10 min with the dye, protected from light. The staining solution is discarded and the cells were washed 3 times with PBS and imaged directly under fluorescent microscope.
[0124] Cell Viability Assay and IC.sub.50 Determination
[0125] Cell viability was measured using the Resazurin reduction assay which indirectly quantifies living cells through the metabolically active reduction of resazurin to fluorescent resorufin. This assay allows to maintain cells viability and, therefore, to monitor cell growth with time. Exponentially growing cells were seeded into 96-well plates at the density of 2.0×10.sup.4 cells/mL and incubated overnight. The media was replaced with fresh media prior to inhibitor treatment. Cells were treated with 0.2 μM of inhibitor peptide for 24 hr. The inhibitor peptide was diluted in the cell culture media (DMEM −/−) in the absence of serum from a 5 mM stock. All the treated cells were compared to the control (TAT alone peptide with equivalent quantity of DMSO) which were considered as 100% viable. One set of wells also prepared with medium only for background subtracting and instrument gain adjustment. The experiments were carried out in triplicate and expressed as mean±SD. A 10% resazurin solution (0.15 mg/ml stock dissolved in PBS, filter sterilized and stored protected from light at 4° C.) was then added to each well and incubated for 2 hr. The fluorescence was recorded using a multiwell plate reader (Perkin Elmer) at Ex. 560 nm and Em. 610 nm.
[0126] Inhibition of Target Enzyme Activity in HCT 116 Cell Line
[0127] The EP4-TAT inhibitor from all the above experiments were tested for histone methylation status in HCT 116 cells. 3×10.sup.6 cells were plated in 10 cm dish and incubated overnight. Cells were then treated with the inhibitors at various concentrations (0.001 to 15 μM). Cells (5×10.sup.6 cells/mL), 24 hr of post dosing, were collected in 15 mL falcon tube and centrifuged at 300×g for 10 min. The supernatant was discarded and the cells are washed with iced cold PBS. The cell pellet is flash-frozen in liquid nitrogen and stored at −80° C. Histone isolation is done using standard protocol. To summarize, cells were re-suspended in 1 mL hypotonic lysis buffer (10 mM Tris-HCl pH 8, 1 mM KCl, 1.5 mM MgCl.sub.2 and 1 mM DTT) containing protease inhibitor. The cells were transferred to 1.5 mL tube and incubated for 30 min on rotor at 4° C. to promote hypotonic swelling and lysis. The intact nuclei are collected by centrifugation at 10,000×g for 10 min in a cooled tabletop centrifuge. The supernatant is entirely discarded and pellets were re-suspended completely in 600 μL 0.4N H.sub.2SO.sub.4 and incubated overnight on rotor at 4° C. The nuclear debris were removed by centrifugation at 16,000×g for 10 min. The supernatant containing the histones were transferred to a fresh 1.5 mL tube and precipitated by adding 195 μL TCA (33%) drop by drop. The reaction is incubated at 4° C. overnight under rotation. The histones were pelleted by centrifugation at 16,000×g for 10 min. After complete removal of the supernatant carefully, the histone pellets were washed with ice-cold acetone to remove the left-over acids without disturbing the pellet. Finally, the pellets were air dried for 30 min at room temperature. The histone pellets were dissolved in 100 μL milliQ water and stored frozen at −20° C. Samples of 1, 3 and 5 μL of histones were separated on 15% SDS-PAGE gel and stained with Coomassie Brilliant Blue and characterized on the quality and concentration of the histone. The locations of the linker histone H1 and the core histones H3, H2B, H2A and H4 were noted.
[0128] For western blot, of total of 1 μL of histones were separated on 15% SDS-PAGE and transferred overnight at 15V on PVDF membrane. Following blocking with 5% nonfat dry milk in 1×TBST for 1 hr, the membrane containing histones lanes treated with inhibitor, were probed with H3K4Me3 (Abcam) primary antibody (1:2500) in 1×PBST. Both the membranes were incubated overnight at 4° C. under rotation. Following this incubation, membranes were washed in 1×TBST and 1×PBST respectively for 30 min, followed by incubation with secondary antibody for an additional 1 hr. The membranes were further washed for 30 min as before. Histone proteins were detected by Supersignal™ West Pico PLUS Chemiluminescent substrate (ThermoFisher Scientific) using the Chemidoc XRS+imaging system (BioRad).
[0129] Flow Cytometry
[0130] A total of 0.3×10.sup.6 HCT 116 cells were plated in 6 well-plate and incubated overnight. Cells were treated with the inhibitor, DMSO and TAT alone controls. For each condition, approximately 1×10.sup.6 HCT 116 cells were collected along with the floating cells in the media by centrifugation at 300×g for 10 min. The cells were then washed with 5 mL of ice-cold PBS and re-suspended in 0.5 mL of ice-cold PBS. The cells were slowly dropped into 4.5 mL of vortexing ice-cold 70% ethanol for rapid dispersion. The sample was incubated on ice for 45 min and then fixed at −20° C. overnight. The fixed cells were centrifuged at 4° C. at 300×g for 10 min. The resultant cell pellet was re-suspended to 200 μL of the stain master mix (133.7 μL of 1 mg/mL propidium iodide (PI), 1 μL of 10 mg/mL RNase A and PBS 865.3 μL). The PI-treated cells were incubated at 37° C. for 30 min and then analyzed by a flow cytometry (BD Accuri™ C6 Plus). The BD Accuri C6 Plus software version FCS 3.1 was used for apoptosis and cell cycle analysis.
[0131] NCI60 Cancer Cell Screen
[0132] Following the receipt at the NCI, cell-active EP4-TAT was be tested for its effects on cell viability in a dose-responsive manner in the complete panel. The effect of EP4-TAT on cell viability was carried out using Sulforhodamine B (SRB) staining in all 60 cell lines (n=4). Using several measurements [time zero (T.sub.z), control growth (C), and growth at the five inhibitor concentrations (T.sub.i)], the percentage growth will be calculated at each inhibition concentration. Three dose-response parameters are calculated: (1) GI.sub.50 (drug concentration resulting in a 50% reduction in the net protein increase, [(T.sub.i−T.sub.z)/(C−T.sub.z)]×100=50), (2) TGI (drug concentration resulting in total growth inhibition, T.sub.i=T.sub.z), and (3) LC.sub.50 ([(T.sub.i−T.sub.z)/T.sub.z]×100=−50).
[0133] Experimental Results
[0134] Identification of Potent High Affinity Target Binding Peptides
[0135] A high affinity peptide screen was carried out against target protein KDM5C. The method involves the sequential synthesis and printing of OPALs.
[0136] Further the best hits from the arrays were then used to design sequence-selective peptides followed next by the sequence-specific high affinity peptides. At the end of the experiment, 44 KDM5C specific potential high affinity peptides were selected.
[0137] In Vitro Validation: KDMase Inhibition
[0138] All the potential KDM5C inhibitors selected from the OPAL screen were tested for inhibition of KDM5C demethylation activity in vitro. KDM5C demethylation activity was carried out using a H3K4me3 substrate peptide. A total of 20 (EP1-EP20) inhibitor peptides, representing all lysine-derived versions of top inhibitor candidates from the OPAL screen, were tested for inhibitory activity in a dose-responsive manner (
[0139] In order to quantify the dissociation kinetics of EP4 with KDM5C, fluorescent polarization was performed, and it was determined that EP4 bound to KDM5C with an experimental Kd of 0.11+/−0.03 nM (
[0140] Characterization of Critical Binding Residues of EP4
[0141] The position and contribution of critical residues within the EP4 inhibitor were assessed by peptide array and in vitro recombinant KDM5C binding assay. Progressive C-terminal and N-terminal tandem truncations of EP4 sequence were used to assess the individual residue contribution of EP4 to KDM5C binding. Relative binding was qualitatively determined by chemiluminescence (
[0142] EP4 Peptide Interacts with the KDM5C Catalytic Domain
[0143] KDM5C quaternary structure, comprising the JmjN, JmjC and ZF domains, was modelled for predicting different binding sites using refined protein structure to identify spatial properties, backbone positioning, and protein-side-chain conformation that concurrently strengthens global topologies and protein modeling structural properties. Our structural model with the lowest score had a 0.110 RMSD(A). Each side-chain residue was created using the most plausible rotamer from the Dunbrack backbone-dependent rotamer library from UCSF Chimera. Auto-optimization for EP4 peptide is conducted with Avogadro to monitor poor contacts and improper bonds. For initial modelling of KDM5CA-EP4 complex, the inhibitor positing should substitute other co-factors in the investigational framework. This was achieved by superimposing template structure on the KDM5C catalytic core structure to replace template cofactors with other enzymatic cofactors.
[0144] By this method, 200 clustered KDM5CA-EP4 protein peptide complex structures are synthesized and the top structure with the lowest z-score of −1.6 is predicted to yield the best possible binding interaction for EP4 peptide with KDM5C (
[0145] Inhibitors were Delivered and Reduced Colorectal Carcinoma Cell Viability
[0146] Our EP4 KDM5C inhibitor peptide were tested for a decrease in cell viability. Individual peptide was tagged initially with 3 different cell penetrating peptide in order to decide the best cell delivery peptide (
[0147] The cell penetrating peptide tagged EP4 inhibitors are then tested for loss of cell viability on colorectal carcinoma HCT 116 cell line at a 10 μM dose (
[0148] Flow Cytometry
[0149] To determine whether loss in cell viability was associated with increased apoptosis, HCT 116 cells were treated with 2 μM of EP4-TAT and analyzed by PI staining. Representative data from flow cytometry analysis are shown in
[0150] Histone Lysine Methylation Status is Inhibitor-Responsive in Colorectal Carcinoma
[0151] HCT 116 colorectal carcinoma cell line was treated with the KDM5C inhibitor EP4-TAT to test dynamic changes in H3K4 tri-methylation levels in comparison to the commercial KDM5 inhibitor, CPI-455. The demethylation of histone H3K4 tri-methylation was found to be inhibited when treated with 25 nM of the KDM5C inhibitor (
[0152] EP4-TAT Performance on the NCI60 Cancer Panel Screen
[0153] To determine the therapeutic breadth of our EP4-TAT peptide, we utilized the National Cancer Institute Developmental Therapeutics Program (NCI DTP) to screen EP4-TAT (vs. TAT alone) on a panel of 60 cancer cell lines (NCI60; representing leukemia, melanoma, and lung, colon, brain, ovary, breast, prostate, and kidney cancers). EP4-TAT was found to have a growth inhibitory (GI.sub.50) effect in 7 lines, spanning CNS (SNB-75) and renal (A498, RXF393, UO-31), and non-small cell lung cancer (NSCLC; HOP-92, NCI-226, EKVX) (
[0154] EP4-TAT Increases Chemo-Sensitivity in NSCLC Cells
[0155] As KDM5C has also been reported to facilitate drug resistance, we explored the potential of EP4-TAT to increase sensitivity to chemotherapies. We have focused this study towards cisplatin treatment as KDM5C inhibition is reported to reduce resistance to platinum-based drugs ( ) and EP4-TAT responsive NCI60 cancers (
[0156] Top KDM5C Inhibitors Screened from OPAL Array.
TABLE-US-00008 Experimental SEQ ID NO: Peptide Sequence 1 EP 1 TDTTKTHHH 2 EP 2 TDTQKTHHH 3 EP 3 TDTNKTHHH 4 EP 4 TEDSKTHHH 5 EP 5 TEDQKTHHH 6 EP 6 TTQSKTHHH 7 EP 7 TDTSKTHHH 8 EP 8 TEDTKTHHH 9 EP 9 TEEQKTHHH 10 EP 10 SDQQKTHHH 11 EP 11 TTQQKTHHH 12 EP 12 SDQTKTHHH 13 EP 13 TDDQKTHHH 14 EP 14 TEENKTHHH 15 EP 15 TEESKTHHH 16 EP 16 TTQTKTHHH 17 EP 17 TDSTKTHHH 18 EP 18 SETQKTHHH 19 EP 19 SETSKTHHH 20 EP 20 TDDNKTHHH 21 EP 21 TDTTnTHHH 22 EP 22 TDTQnTHHH 23 EP 23 TDTNnTHHH 24 EP 24 TEDSnTHHH 25 EP 25 TEDQnTHHH 26 EP 26 TTQSnTHHH 27 EP 27 TDTSnTHHH 28 EP 28 TEDTnTHHH 29 EP 29 TEEQnTHHH 30 EP 30 SDQQnTHHH 31 EP 31 TTQQnTHHH 32 EP 32 SDQTnTHHH 33 EP 33 TDDQnTHHH 34 EP 34 TEENnTHHH 35 EP 35 TEESnTHHH 36 EP 36 TTQTnTHHH 37 EP 37 TDSTnTHHH 38 EP 38 SETQnTHHH 39 EP 39 SETSnTHHH 40 EP 40 TDDNnTHHH 41 EP 41 RTKQTARKSTGG 42 EP 42 RTnQTARKSTGG 43 EP 43 GAKRHRKVLRDNI 44 EP 44 GAKRHRnVLRDNI
REFERENCES
[0157] Arrowsmith C H, Bountra C, Fish P V, Lee K, Schapira M. Epigenetic protein families: a new frontier for drug discovery. Nat. Rev. Drug Discov. 2012; 11, 384-400. [0158] Beck-Sickinger A G, Mörl K. Posttranslational Modification of Proteins. Expanding Nature's [0159] Inventory. By Christopher T. Walsh. Angew. Chem. Int. Ed. 2006; 45, 1020-1020. [0160] Biggar K K, Li S S C. Non-histone protein methylation as a regulator of cellular signaling and function. Nat. Rev. Mol. Cell Biol. 2015; 16, 5-17. [0161] Blum G, Ibanez G, Rao X, Shum D, Radu C, Djaballah H, et al. Small-molecule inhibitors of Set8 with cellular activity. ACS Chem. Biol. 2014; 9:2471-2478. [0162] Dhami G K, Liu H, Galka M, Voss C, Wei R, Muranko K, et al. Dynamic methylation of numb by Set8 regulates its binding to p53 and apoptosis. Mol Cell. 2013; 50(4):565-76. [0163] Ding C, Li R, Peng J, Li S, Guo Z. A polymorphism at the miR-502 binding site in the 3′ untranslated region of the Set8 gene is associated with the outcome of small-cell lung cancer. Experimental and therapeutic medicine. 2012; 3(4):689-92. [0164] Guo Z, Wu C, Wang X, Wang C, Zhang R, Shan B. A polymorphism at the miR-502 binding site in the 3′-untranslated region of the histone methyltransferase Set8 is associated with hepatocellular carcinoma outcome. Int J Cancer. 2012; 131(6):1318-22. [0165] Hamamoto R, Saloura V, Nakamura Y. Critical roles of non-histone protein lysine methylation in human tumorigenesis. Nat. Rev. Cancer 2015; 15, 110-124. [0166] Hashemi M, Sheybani-Nasab M, Naderi M, Roodbari F, Taheri M. Association of functional polymorphism at the miR-502-binding site in the 3′ untranslated region of the Set8 gene with risk of childhood acute lymphoblastic leukemia, a preliminary report. Tumor Biol. 2014; 35(10): 10375-9. [0167] Ji X, Jin S, Qu X, Li K, Wang H, He F, et al. Lysine-specific demethylase 5C promotes hepatocellular carcinoma cell invasion through inhibition BMP7 expression, BMC Cancer 2015; 26: 801. [0168] Jin H, Zangar R C. Protein modifications as potential biomarkers in breast cancer. Biomark. [0169] Insights 2009; 4, 191-200. [0170] Rau R C, Dou Y. Hijacked in cancer: the KMT2(MLL) family of methyltransferases. Nat. Rev. Cancer 2015; 15, 334-346. [0171] Seo J, Lee K J. Post-translational modifications and their biological functions: proteomic analysis and systematic approaches. J. Biochem. Mol. Biol. 2014; 37, 35-44. [0172] Shi X, Kachirskaia I, Yamaguchi H, West L E, Wen H, Wang E W, et al. Modulation of p53 function by Set8-mediated methylation at lysine 382. Mol Cell. 2007; 27(4):636-46. [0173] Song F, Zheng H, Liu B, Wei S, Dai H, Zhang L, et al. An miR-502-binding site single-nucleotide polymorphism in the 3′-untranslated region of the Set8 gene is associated with early age of breast cancer onset. Clin Cancer Res. 2009; 15(19):6292-300. [0174] Stein J, Majores M, Rohde M, Lim S, Schneider S, Krappe E, et al. KDM5C is overexpressed in prostate cancer and is a prognostic marker for prostate-specific antigen-relapse following radical prostatectomy. Am. J. Pathol. 2014; 184: 2430-2437. [0175] Takawa M, Cho H-S, Hayami S, Toyokawa G, Kogure M, Yamane Y, et al. Histone lysine methyltransferase Set8 promotes carcinogenesis by deregulating PCNA expression. Cancer Res. 2012; 72(13):3217-27. [0176] Valente S, Lepore I, Dell'Aversana C, Tardugno M, Castellano S, Sbardella G, et al. Identification of PR-SET7 and EZH2 selective inhibitors inducing cell death in human leukemia U937 cells. Biochimie. 2012; 94(11):2308-13. [0177] Veschi V, Liu Z, Voss T C, Ozbun L, Gryder B, Yan C, et al. Epigenetic siRNA and chemical screens identify Set8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell 2017; 31:50-63. [0178] Vinogradova M, Gehling V S, Gustafson A, Arora S, Tindell C A, et al. (2016). An inhibitor of KDM5 demethylases reduces survival of drug-tolerant cancer cells. Nat. Chem. Biol. 12(7): 531-538. [0179] Wang C, Guo Z, Wu C, Li Y, Kang S. A polymorphism at the miR-502 binding site in the 3′ untranslated region of the Set8 gene is associated with the risk of epithelial ovarian cancer. Cancer Genetics. 2012; 205(7-8): 373-6. [0180] Wang Q, Wei J, Su P, Gao P. Histone demethylase JARID1C promotes breast cancer metastasis cells via down regulating BRMS1 expression, Biochem. Biophys. Res. Commun. 2015; 464: 659-666. [0181] Xu J, Yin Z, Gao W, Liu L, Yin Y, Liu P, et al. Genetic variation in a microRNA-502 minding site in Set8 gene confers clinical outcome of non-small cell lung cancer in a Chinese population. PLoS One. 2013; 8(10):e77024. [0182] Xu L, Wu W, Cheng G, Qian M, Hu K, Yin G, et al. Enhancement of proliferation and invasion of gastric cancer cell by KDM5C via decrease in p53 expression. Technol. Cancer Res. Treat. 2017; 16:141-149. [0183] Yang F, Sun L, Li Q, Han X, Lei L, Zhang H, et al. Set8 promotes epithelial mesenchymal transition and confers TWIST dual transcriptional activities. EMBO J. 2012; 31(1):110-23. [0184] Yao L, Li Y, Du F, Han X, Li X, Niu Y, et al. Histone H4 Lys 20 methyltransferase Set8 promotes androgen receptor-mediated transcription activation in prostate cancer. Biochem Biophys Res Commun. 2014; 450(1):692-6. [0185] Zhang X, Wen H, Shi X. Lysine methylation: beyond histones. Acta Biochim. Biophys. Sin. 2012; 44, 14-27.