PEACH POLYGALACTURONASE-INHIBITING PROTEIN PpPGIP1 GENE, AND CLONING METHOD AND USE THEREOF

Abstract

The present invention discloses a peach polygalacturonase-inhibiting protein PpPGIP1 gene, and a cloning method and use thereof. The peach polygalacturonase-inhibiting protein PpPGIP1 gene has a nucleotide sequence shown in SEQ ID NO: 1, and a protein encoded by the peach polygalacturonase-inhibiting protein PpPGIP1 gene has an amino acid sequence shown in SEQ ID NO: 2. The cloning method includes the following steps: (1) extracting total RNA from a peach, and subjecting the total RNA to reverse transcription to obtain cDNA, which serves as a template; (2) designing primers based on the PpPGIP1 gene sequence; and (3) Polymerase Chain Reaction (PCR) amplification: conducting PCR amplification to obtain a PpPGIP1 gene amplification product. As there is a protein-protein interaction relationship between PpPGIP1 and PpVIN2, the effective inhibition of the PpPGIP1 expression in peach can significantly reduce the activity of the acid invertase PpVIN2 and thus reduce the decomposition of sucrose.

Claims

1. Use of a peach polygalacturonase-inhibiting protein PpPGIP1 gene in the preparation of a peach antifreeze, characterized in that, a nucleotide sequence of the peach polygalacturonase-inhibiting protein PpPGIP1 gene is shown in SEQ ID NO: 1.

2. Use of a peach polygalacturonase-inhibiting protein PpPGIP1 gene in the preparation of a peach acid invertase PpVIN2 inhibitor, characterized in that, a nucleotide sequence of the peach polygalacturonase-inhibiting protein PpPGIP1 gene is shown in SEQ ID NO: 1.

3. The use of the peach polygalacturonase-inhibiting protein PpPGIP1 gene in the preparation of the peach acid invertase PpVIN2 inhibitor according to claim 2, characterized in that, a virus-induced peach polygalacturonase-inhibiting protein PpPGIP1 gene silencing system is constructed in a peach through an Agrobacterium transient transformation to obtain a peach having effective inhibition of an acid invertase VIN activity.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0020] FIG. 1 shows the confirmation of an Y2H system that there is a protein-protein interaction relationship between PpPGIP1 and PpVIN2, where positive control group: BD-53+AD-T; negative control group: BD-Lam+AD-T; and experimental group: BD-PpVIN2+AD-PpPGIP1.

[0021] FIG. 2 shows the inhibition of the VIN activity by silencing PpPGIP1 (A, B, and C) in peach through Agrobacterium transient transformation, where (A) shows peach phenotypes after Agrobacterium infection; (B) shows the PpPGIP1 expression analysis after Agrobacterium transient transformation; and (C) shows the effect of successful Agrobacterium transient transformation on the VIN activity.

DETAILED DESCRIPTION OF THE EMBODIMENTS

[0022] The present invention will be described in further detail below with reference to the accompanying drawings and examples.

Specific Example 1

[0023] Cloning and sequence analysis of peach polygalacturonase-inhibiting protein PpPGIP1 gene

[0024] 1. Total RNA was extracted from “Yulu” peach and reverse-transcribed into cDNA, which would serve as a PCR template. Specifically: RNA prep Pure Plant Kit of TIANGEN (Tiangen, Beijing, China) was used to extract total RNA from peach, and then the HiScript® II Q Select RT Super Mix for qPCR (Vazyme, Nanjing, China) kit was used to reverse-transcribe the total RNA into cDNA, which would serve as a template for PCR.

[0025] 2. The online website NCBI-PRIMER (https://www.ncbi.nlm.nih. gov/tools/primer-blast/) was used to design specific amplification primers for a CDS region of the peach PpPGIP1 gene (Gene ID: LOC18769194): upstream primer sequence: 5′-CCCGCAATCACATTTCTTATCC-3′ (SEQ ID NO: 3), and downstream primer sequence: 5′-CACTCCCAAGCTGCAAATAA-3′ (SEQ ID NO: 4).

[0026] 3. PCR amplification: PCR amplification was conducted to obtain a PpPGIP1 gene amplification product. A PCR amplification system included: 2 μL of cDNA, 12.5 μL of 2× Phanta Max Master Mix (PCR amplification high-fidelity enzyme: 2× Phanta Max Master Mix was purchased from Nanjing Vazyme Biotech Co., Ltd.), 1 μL of each of the upstream and downstream primers, and 8.5 μL of ddH.sub.2O. A PCR amplification procedure was as follows: pre-denaturation at 95° C. for 3 min; denaturation at 95° C. for 15 s, annealing at 60° C. for 15 s, and extension at 72° C. for 1 min, 35 cycles; and complete extension at 72° C. for 5 min.

[0027] 4. Colony PCR and sequence alignment: The PCR amplification product was extracted and purified, and then ligated to a PMD18-T vector, the vector was transformed into Escherichia coli (E. coli) DH5α, and then the E. coli was coated on an LB-Amp plate that was evenly coated with X-Gal and IPTG, and then invertedly cultivated overnight at 37° C. After further verification by PCR, sequencing was conducted to obtain the PpPGIP1 sequence, which matched the peach genome data and was shown in SEQ ID NO: 1:

TABLE-US-00001 ATGGACGTCAAGTTCCCCACCCTCCTCTGCTTGACCCTACTCTTCTCCAC CATCCTAAACCAAGCGCTCTCCGAGCTCTGCAACCCGGAAGACAAGAAAG TTCTCCTACAAATCAAGAAAGCCTTCAACGACCCCTACGTCTTGACCTCA TGGAAGCCAGAGACAGACTGCTGTGACTGGTACTGTGTCACCTGTGACTC CACCACAAACCGCATCAACTCCCTCACCATCTTCTCTGGCCAAGTCTCCG GTCAAATTCCGACCCAAGTCGGTGACTTGCCGTATCTTGAAACACTTGAG TTTCACAAGCAACCCAATCTTACCGGACCAATACAACCCTCCATTGCCAA GCTTAAGCGCCTCAAGGAGCTGCGCCTCAGCTGGACTAACATCTCAGGCT CTGTACCTGACTTCCTCAGCCAACTCAAGAACCTCACCTTTCTTGACCTC TCATTCAGTAACCTCACAGGCTCCATCCCCAGCTCGCTTTCTCAGCTTCC CAACCTCAACGCTCTTCATCTAGACCGTAACAAGCTCACAGGTCATATTC CGAAGTCATTTGGAGAATTCCATGGCAGTGTTCCAGAGCTCTATCTCTCC CACAACCAGCTCTCAGGCAACATACCAACCTCATTAGCCAAACTGGACTT CAACCGCATAGACTTCTCCCGGAACAAGCTCGAAGGCGATGCATCCATGA TCTTTGGATTGAACAAGACAACCCAGATTGTGGATCTGTCTAGGAACTTG CTGGAATTTAATCTGTCAAAGGTGGAGTTTTCCAAGAGCTTGATATCGTT GGATCTTAACCATAACAAGATCACAGGCGGAATTCCGGTGGGGCTGACCC AAGTGGATTTGCAGTTCCTGAACGTGAGCTACAACAGGTTGTGTGGTCAG ATTCCAGTGGGCGGGAAGTTACAGAGCTTCGACTCCTCAACTTATTTCCA TAACCGCTGCTTGTGTGGTGCTCCACTCCCAAGCTGCAAATAA.

[0028] A protein encoded by the peach acid invertase inhibitor gene PpPGIP1 had an amino acid sequence shown in SEQ ID NO: 2:

TABLE-US-00002 MDVKFPTLLCLTLLFSTILNQALSELCNPEDKKVLLQIKKAFNDPYVLTS WKPETDCCDWYCVTCDSTTNRINSLTIFSGQVSGQIPTQVGDLPYLETLE FHKQPNLTGPIQPSIAKLKRLKELRLSWTNISGSVPDFLSQLKNLTFLDL SFSNLTGSIPSSLSQLPNLNALHLDRNKLTGHIPKSFGEFHGSVPELYLS HNQLSGNIPTSLAKLDFNRIDFSRNKLEGDASMIFGLNKTTQIVDLSRNL LEFNLSKVEFSKSLISLDLNHNKITGGIPVGLTQVDLQFLNVSYNRLCGQ IPVGGKLQSFDSSTYFHNRCLCGAPLPSCK.

[0029] Bioinformatics analysis showed that the PpPGIP1 protein included 330 amino acid residues (AA), and had a molecular weight of 36.5 kDa and a theoretical isoelectric point (pI) of 8.03. According to the secondary structure prediction, in the PpPGIP1 protein, α-helix accounted for 32.73%, β-pleated sheet accounted for 11.52%, and random coil between α-helix and β-pleated sheet accounted for 55.76%. Most of the AA residues of the PpPGIP1 polypeptide chain were below 0, and the entire peptide chain was hydrophilic. Therefore, it was inferred that the PpPGIP1 protein was a hydrophilic protein. There was no transmembrane domain in the PpPGIP1 protein, and 1-330AA was completely on the cell membrane surface. Therefore, it was inferred that the protein was an outer membrane protein (OMP). The protein signal peptide prediction showed that, in the PpPGIP1 protein, there were 24 AA signal peptide sequences at the N-terminus, and cleavage sites were located between the 24th serine (Ser) and the 25th glutamic acid (Glu). The PpPGIP1 protein included 7 N-glycosylation sites, which were located at AA 106, 130, 144, 154, 238, 254, and 291, respectively. The PpPGIP1 protein included 12 phosphorylation sites, including 9 Ser sites and 3 Thr sites. The tertiary structure prediction showed that, in the PpPGIP1 protein, there were 4 strictly conserved cysteine residues at each of the N-terminus and the C-terminus, and the central region was occupied by an LRR domain rich in leucine repeats.

Specific Example 2

[0030] A yeast two-hybrid system (Y2H) was used to confirm the protein-protein interaction between PpPGIP1 and PpVIN2.

[0031] 1. Construction and identification of a bait recombinant vector pGBKT7-PpVIN2 and a prey recombinant vector pGADT7-PpPGIP1

[0032] The online website NCBI-PRIMER (https://www.ncbi.nlm.nih. gov/tools/primer-blast/) was used to design specific amplification primers for the peach PpPGIP1 gene and PpVIN2 gene (with Gene ID: LOC18769194 and Gene ID: LOC18776102, respectively), and the primers each are flanked with an appropriate restriction site and a homologous sequence of an expression vector (Table 1). The primers were designed in accordance with the requirements of the homologous recombinase Clon Express®II One Step Cloning Kit (Vazyme, Nanjing, China) and the high-fidelity enzyme 2× Phanta Max Master Mix (Vazyme, Nanjing, China). Homologous sequences at two termini of a linearized vector were respectively introduced at the 5′-termini of the forward and reverse specific primers of the target fragment, such that the 5′-terminus and 3′-terminus of an amplified target fragment carried homologous sequences (15 to 20 bp) corresponding to the two termini of the linearized expression vector, respectively, thereby ensuring a direction of insertion of the target fragment into the expression vector.

TABLE-US-00003 TABLE 1 Primer sequences for constructing the recombinant vectors pGADT7-PpPGIP1 and pGBKT7-PpVIN2 Primer Sequence pGBKT7-PpVIN2-F AGGCCGAATTCCCGGGGATCCATGGCAG (SEQ ID NO: 5) ACCCAAGACCTTTTCTTC pGBKT7-PpVIN2-R CTAGTTATGCGGCCGCTGCAGCATGAAC (SEQ ID NO: 6) GAAATCGAAATCG pGADT7-PpPGIP1-F GTGGGCATCGATACGGGATCCCCCGCAA (SEQ ID NO: 7) TCACATTTCTTATCC pGADT7-PpPGIP1-R ACGATTCATCTGCAGCTCGAGTTATTTG (SEQ ID NO: 8)

[0033] Note: The sequence in italic represents a homologous sequence of the vector; and the bolded sequence represents a restriction site, including BamHI, PstI, BamHI, and XhoI in sequence.

[0034] A PCR amplification system was of 25 μL, including: 2 μL of cDNA, 12.5 μL of 2× Phanta Max Master Mix, 1 μL of each of upstream and downstream primers, and 8.5 μL of ddH.sub.2O. A PCR amplification procedure for the target fragment PpPGIP1 was as follows: pre-denaturation at 95° C. for 3 min; denaturation at 95° C. for 15 s, annealing at 55° C. for 15 s, and extension at 72° C. for 1 min (35 cycles); and complete extension at 72° C. for 5 min. A PCR amplification procedure for the target fragment PpVIN2 was as follows: pre-denaturation at 95° C. for 3 min; denaturation at 95° C. for 15 s, annealing at 55° C. for 15 s, and extension at 72° C. for 2 min and 30 s (35 cycles); and complete extension at 72° C. for 5 min.

[0035] According to the Clon Express® II recombination reaction system, an amount of each component in the recombination reaction was calculated based on concentrations of recovered products of a vector and an inserted fragment to complete the recombination reaction. PpVIN2 was ligated to a bait vector pGBKT7 to obtain a recombinant plasmid BD-PpVIN2, and PpPGIP1 was ligated to a prey vector pGADT7 to obtain a recombinant plasmid AD-PpPGIP1.

[0036] According to the requirements of DH5a Competent Cell (CWBIO, Beijing, China), the recombinant plasmids AD-PpPGIP1 and BD-PpVIN2 were each transformed into E. coli DH5α through thermal shock; then the E. coli was coated on an LB-Amp/kana plate that was evenly coated with X-Gal and IPTG, and then invertedly cultivated overnight at 37° C.; single clones were picked for colony PCR identification; and positive clones with the target fragment were screened out and sent to Sangon Biotech (Shanghai) Co., Ltd. for sequencing. Confirmed positive clones were subjected to expanded cultivation, and plasmid extraction was conducted to obtain the prey recombinant plasmid AD-PpPGIP1 and the bait recombinant plasmid BD-PpVIN2.

[0037] 2. Detection of Toxicity and Self-Activation of the Bait Plasmid

[0038] Bait plasmid toxicity detection: The bait plasmid pGBKT7-PpVIN2 and an empty vector pGBKT7 were each transformed into Y2H Gold yeast competent cells, the transformed competent cells were each coated on an SD/-Trp-deficient medium and invertedly cultivated in an incubator at 30° C. for 3 d to 5 d, and then the colony growth on the plate was observed.

[0039] Bait plasmid self-activation detection: The bait plasmid pGBKT7-PpVIN2 and an empty vector pGADT7 were co-transformed into Y2H Gold yeast competent cells, the transformed competent cells were coated on SD/-Trp/-Leu, SD/-Trp/-Leu/-His, and SD/-Trp/-Leu/-His/-Ade-deficient media and invertedly cultivated in an incubator at 30° C. for 3 d to 5 d, and then the colony growth on the plate was observed.

[0040] 3. Co-Transformation of Recombinant Plasmids and Identification of Interacting Protein Fusions

[0041] According to the lithium acetate (LiAc) transformation method, the bait and prey vectors were co-transformed with the heat-denatured salmon sperm DNA (carrier DNA) into a yeast strain Y2H Gold (Yeastmaker™, Clontech), and BD-53+AD-T and BD-Lam+AD-T (both of which were provided by Yeastmaker™, Clontech) were used as a positive control group and a negative control group, respectively. Then the transformed yeast cells were cultivated on a DDO medium (SD-Leu/-Trp medium) at 30° C. for 2 d to 3 d. Finally, positive colonies were transferred to a QDO medium (SD-Leu/-Trp/-Ade/-His medium) and a QDO/A/X medium (QDO medium with 200 ng/mL Aureobasidin A and 40 μg/mL Xa-Gal) and cultivated at 30° C. for 2 d to 3 d. According to the growth state and chromogenic reaction, the possible interaction between PpVIN2 and PpPGIP1 was verified.

[0042] Results were shown in FIG. 1, and it can be seen that the yeast cells co-transformed with bait vector BD-PpVIN2+prey vector AD-PpPGIP1, BD-53+AD-T, and BD-Lam+AD-T all could normally grow in the auxotrophic plate DDO, indicating that fusion proteins were successfully transformed into the yeast cell Y2H Gold. In addition, the yeast strains co-transformed with the experimental group BD-PpVIN2+AD-PpPGIP1 and the positive control group BD-53+AD-T could grow normally on the QDO plate, and the co-transformants were all blue on the QDO-X-A plate. The yeast strain co-transformed with the negative control group BD-Lam+AD-T could not grow normally in the QDO medium and appeared like rusty red dead bacteria, and failed to present blue in the QDO-X-A medium. The results showed that the PpPGIP1 and PpVIN2 activated ADE2, HIS3, and MEL1 reporter genes in the yeast genome through protein-protein interaction. This result confirmed that there was protein-protein interaction between the prey protein PpPGIP1 and the bait protein PpVIN2.

Specific Example 3

[0043] The PpPGIP1 silencing in peach through Agrobacterium transient transformation and VIGS significantly inhibited the VIN activity.

[0044] The test variety “Yulu” honey peach (“Prunus persica L. Batsch”) was picked from the Fenghua Honey Peach Research Institute of Ningbo City, Zhejiang Province. Mature-green-stage peaches that were uniform in size and had no disease, insect, and mechanical damage were selected for Agrobacterium infection.

[0045] 1. In order to improve the efficiency of silencing and reduce the possibility of non-target genes being silenced, the online software SGN VIGS (https://vigs.solgenomics.net/) was used for PpPGIP1 (Gene ID: LOC18769194), to subclone a predicted specific silencing sequence (300 bp) for the target gene PpPGIP1 into a pTRV2 vector to obtain a recombinant vector pTRV2-PpPGIP1, and pTRV1+pTRV2 was adopted as the control group.

[0046] Construction and identification of the recombinant vector pTRV2-PpPGIP1: The online website NCBI-PRIMER (https://www.ncbi.nlm.nih. gov/tools/primer-blast/) was used to design specific amplification primers for the peach PpPGIP1 (Gene ID: LOC18769194), and the primers each are flanked with an appropriate restriction site and a homologous sequence of an expression vector (Table 2).

TABLE-US-00004 TABLE 2 Primer sequences for constructing the recombinant vector pTRV2-PpPGIP1 Primer Sequence pTRV2-PpPGIP1-F AAGGTTACCGAATTCTCTAGAGACCCCT (SEQ ID NO: 9) ACGTCTTGGCCTC pTRV2-PpPGIP1-R TGTCTTCGGGACATGCCCGGGCTTGAGT (SEQ ID NO: 10) TGGCTGAGGAAGTCAG

[0047] Note: The sequence in italic represents a homologous sequence of the vector; and the bolded sequence represents a restriction site, including XbaI and SmaI in sequence.

[0048] A PCR amplification system was of 25 μL, including: 1 μL of cDNA, 12.5 μL of 2× Taq Master Mix, 1 μL of each of upstream and downstream primers, and 9.5 μL of ddH.sub.2O. A PCR amplification procedure for the target fragment PGIP was as follows: pre-denaturation at 95° C. for 3 min; denaturation at 95° C. for 15 s, annealing at 59° C. for 15 s, and extension at 72° C. for 1 min (35 cycles); and complete extension at 72° C. for 5 min.

[0049] According to the Clon Express®II recombination reaction system, an amount of each component in the recombination reaction was calculated based on concentrations of recovered products of a vector and a target fragment to complete the recombination reaction. PpPGIP1 was ligated to an expression vector pTRV2 to obtain a recombinant vector pTRV2-PpPGIP1.

[0050] According to the requirements of DH5a Competent Cell (CWBIO, Beijing, China), the recombinant vector pTRV2-PGIP was transformed into E. coli DH5a through thermal shock; then the E. coli was coated on an LB/kana plate that was evenly coated with X-Gal and IPTG, and then invertedly cultivated overnight at 37° C.; single clones were picked for colony PCR identification; and positive clones with the target fragment were screened out and sent to Sangon Biotech (Shanghai) Co., Ltd. for sequencing to obtain a PpPGIP1-specific silencing sequence (300 bp), which matched the peach genome data and was shown as follows (SEQ ID NO: 11):

TABLE-US-00005 GACCCCTACGTCTTGGCCTCATGGGACCCAGAGACAGACTGCTGTGACTG GTACTCTGTCACCTGTGACTCCACCACAAACCGCGTCAACTCCCTCACCC TCTTCTCCGGGGGACTCTCCGGTCAAATTCCGACCCAAGTCGGTGACTTG CCGTATCTTGAAACACTTGAGTTTCACAAGCAACCCAATCTTACCGGACC AATCCAACCCTCCATTGCCAAGCTTAAGCGCCTCAAGGAGCTGCGCCTCA GCTGGACCAACATCTCCGGCTCTGTCCCTGACTTCCTCAGCCAACTCAAG.

[0051] 2. Agrobacterium transformed with the recombinant plasmid was used to infect peach.

[0052] The recombinant plasmid carrying the target gene fragment and the empty vector were each transformed into Agrobacterium tumefaciens GV3101 through freezing and thawing. The Agrobacterium tumefaciens was cultivated in an LB solid medium (kan, 50 μg/mL; Gen, 50 μg/mL; and rif, 50 μg/mL) at 28° C. for 2 d to 3 d, and then single clones were picked and activated in a fresh LB liquid medium (kan, 50 μg/mL; Gen, 50 μg/mL; and rif, 50 μg/mL) at 28° C. for 12 h to 16 h, and then cultivated in a fresh LB liquid medium (kan, 50 μg/mL; rif, 50 μg/mL; MES, 10 mM; and AS, 40 mM) at 28° C. and 200 rpm under shaking for 16 h to 24 h until OD600 was 0.8 to 1.0. A resulting bacterial suspension was centrifuged at room temperature and 5,000 g for 10 min to obtain bacteria, and a resulting supernatant was discarded. The bacteria were resuspended in an osmotic buffer (10 mM MgCl.sub.2; 10 mM MES, pH 5.6; and 200 μM AS), OD600 was adjusted to 1.0, and then a resulting suspension stood in the dark for 3 h.

[0053] The suspension was injected with a sterile syringe into the sunny side and the night side of the “Yulu” peach, where a needle tip was at about 1 cm below the peel and did not touch the peach pit; and infected peaches were stored at a temperature of 20° C. and a humidity of 85% to 90%. One group of peaches were injected with a suspension of GV3101-pTRV1 and GV3101-pTRV2-PpPGIP1 in a volume ratio of 1:1, and the other group of peaches were injected with a suspension of GV3101-pTRV1 and GV3101-pTRV2 in a volume ratio of 1:1. 7 d and 10 d after the peaches were infected, samples were collected for all peaches and stored at −80° C.

[0054] 3. Analysis of the Phenotypes and the Basic PpPGIP1 Expression of Peaches Undergoing Agrobacterium Transient Transformation

[0055] Results were shown in FIG. 2. On day 10 after the Agrobacterium infection, the infected area on the surface of the peach was darkened, presenting a blue-green color; and after the peel was removed, it was found that the uninfected area was normal white, but the infected area was light green. qPCR analysis showed that the expression level of PpPGIP1 in the GV3101-pTRV1+pTRV2-PpPGIP1 group was significantly lower than that in the control group GV3101-pTRV1+pTRV2 after infected peaches were stored at 20° C. for 7 d and 10 d. The expression level of the PpPGIP1 gene was reduced by 10% and 34% compared with the control group, indicating that the PpPGIP1 gene in peach was effectively silenced, and the system for silencing PpPGIP1 in peach through Agrobacterium transient transformation was successfully constructed.

[0056] 4. Analysis of VIN Activity in Peaches in which PpPGIP1 was Silenced Through Agrobacterium Transient Transformation

[0057] As shown in FIG. 2, compared with the control group, the VIN activity in the experimental group with silenced PpPGIP1 was reduced by 10% and 34% on days 7 and 10, respectively, indicating that the effective inhibition of PpPGIP1 in peach could significantly reduce the VIN activity.

[0058] The above description does not limit the present invention, and the present invention is not limited to the above examples. Variations, modifications, additions, or replacements made by those of ordinary skill in the art within the essential scope of the present invention should also fall within the protection scope of the present invention.