THREONINE166 AND SERINE189 OF RUBICON RUN DOMAIN AS LRRK2 KINASE INHIBITION TARGET SITES
20220169720 · 2022-06-02
Assignee
Inventors
Cpc classification
G01N2800/2835
PHYSICS
C07K16/28
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
C07K16/44
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Method of detecting phosphorylation at Threonine 166 of a Rubicon protein to identify a subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) such as Parkinson's disease and compounds and methods for treating the same.
Claims
1. An in vitro method of detecting phosphorylation of a Rubicon protein comprising: isolating proteins from a sample; contacting the isolated proteins with an antibody that hybridises to a phosphorylated Threonine at 166 of a Rubicon protein to form a complex; detecting the complex wherein detection of the complex that varies from a predetermined value indicates that the sample comes from a subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2).
2. The in vitro method according to claim 1, wherein the disease associated with Leucine-rich repeat kinase 2 (LRRK2) is Parkinson's disease.
3. The in vitro method according to claim 1, wherein the antibody is a chimeric humanised antibody.
4. The in vitro method according to claim 1, wherein the antibody is a monoclonal antibody.
5. The in vitro method according to claim 1, wherein the complex is detected with an enzyme linked immunosorbent assay.
6. The in vitro method according to claim 1, wherein the subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) is treated with a compound able to block interaction of LRRK2 with Threonine 166 and/or Serine 189 of the Rubicon protein.
7. The in vitro method according to claim 1, wherein the compound comprises a treatment antibody.
8. The in vitro method according to claim 7, wherein the treatment antibody is a chimeric humanised antibody.
9. The in vitro method according to claim 7, wherein the treatment antibody is a monoclonal antibody.
10. (canceled)
11. (canceled)
12. An antibody which is capable of binding to Rubicon phosphorylated at Threonine 166 and/or phosphorylated at Serine 189.
13. The antibody according to claim 12, comprising at least one variable region incorporating a CDR selected from amino acid sequences i) to vi): i) LC-CDR1: RSSQSLVHSNGNTYLH (SEQ ID NO. 4); ii) LC-CDR2: KLSNRFS (SEQ ID NO. 5); iii) LC-CDR3: SQSTHVPLT (SEQ ID NO. 6); iv) HC-CDR1: NYGVS (SEQ ID NO. 7); v) HC-CDR2: TINSNGGSKYYPDSVKG (SEQ ID NO. 8); vi) HC-CDR3: DVWLRRQWYFDV (SEQ ID NO. 9); and a functional variant with 99% amino acid sequence identity to any one of amino acid sequences i) to vi).
14. The antibody according to claim 12, comprising amino acid sequences: i) LC-CDR1: RSSQSLVHSNGNTYLH (SEQ ID NO. 4); ii) LC-CDR2: KLSNRFS (SEQ ID NO. 5); iii) LC-CDR3: SQSTHVPLT (SEQ ID NO. 6); iv) HC-CDR1: NYGVS (SEQ ID NO. 7); v) HC-CDR2: TINSNGGSKYYPDSVKG (SEQ ID NO. 8); vi) HC-CDR3: DVWLRRQWYFDV (SEQ ID NO. 9); or a functional variant with 99% amino acid sequence identity to any one of amino acid sequences i) to vi).
15. The antibody according to claim 12, wherein the antibody is a chimeric humanised antibody.
16. The antibody according to claim 12, the antibody is a monoclonal antibody.
17. (canceled)
18. (canceled)
19. An inhibitor of Rubicon interaction with Leucine-rich repeat kinase 2 (LRRK2) comprising a compound able to block interaction of LRRK2 with Threonine 166 and/or Serine 189 of the Rubicon protein.
20. The inhibitor according to claim 19, wherein the compound comprises an antibody.
21.-26 (canceled)
27. A method of treating a subject in need having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) comprising: administering a compound able to block interaction of LRRK2 with Threonine 166 and/or Serine 189 of the Rubicon protein.
28. The method according to claim 27, wherein the compound comprises an antibody which is capable of binding to Rubicon phosphorylated at Threonine 166 and/or phosphorylated at Serine 189.
29. The method according to claim 28, wherein the antibody is a chimeric humanised antibody.
30. The method according to claim 28, wherein the antibody is a monoclonal antibody.
31. (canceled)
32. (canceled)
Description
BREIF DESCRIPTION OF THE DRAWINGS
[0018] In the figures, which illustrate, by way of non-limiting examples only, embodiments of the present invention may include,
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION
[0028] Throughout this document, unless otherwise indicated to the contrary, the terms “comprising”, “consisting of”, “having” and the like, are to be construed as non-exhaustive, or in other words, as meaning “including, but not limited to”.
[0029] Furthermore, throughout the document, unless the context requires otherwise, the word “include” or variations such as “includes” or “including” will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers.
[0030] Unless defined otherwise, all other technical and scientific terms used herein have the same meaning as is commonly understood by a skilled person to which the subject matter herein belongs.
[0031] It was observed that LRRK2 kinase interacts with Rubicon RUN domain. LRRK2 is a serine/threonine kinase and Rubicon RUN domain contains 12 serine residues and three threonine residues. Rubicon phosphor-null mutants where a single serine/threonine residue was substituted with alanine were cloned to delineate RUN domain residues that are critical to LRRK2 function. LRRK2 kinase assays utilising wild-type or mutant LRRK2 were used to methodically screen for LRRK2-specific phosphosites. The consensus Rubicon phosphosites identified were threonine 166 (T166) and serine 189 (S189). If Rubicon mediates LRRK2-induced toxicity via LRRK2 kinase activity, then Rubicon phosphor-null mutants T166A and/or S189A will rescue LRRK2-induced toxicity.
[0032] Identifying LRRK2 substrates is key to elucidate the physiological function of LRRK2. Here, a novel LRRK2 substrate being Rubicon is reported and LRRK2-specific phosphosites are identified.
[0033] Accordingly, in various embodiments, an in vitro method of detecting phosphorylation of a Rubicon protein comprising: isolating proteins from a sample; contacting the isolated proteins with an antibody that hybridises to a phosphorylated Threonine at 166 of a Rubicon protein to form a complex; detecting the complex wherein detection of the complex that varies from a predetermined value indicates that the sample comes from a subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0034] The availability of a diagnostic assay that can be quantified and be easily carried out with minimal patient sample will enhance PD clinical diagnosis with added certainty. In various embodiments the use of sensitive ELISA detection is easily implemented in clinical settings. In various embodiments the use of blood samples such as serum samples or monocyte fraction samples further enhances the ease of implementation in clinical settings.
[0035] As used herein the term “sample” refers to a sample obtained from a subject such as an animal or a patient. In various embodiments the sample is obtained from a patient, and may be e.g. a blood, fluid or tissue sample. In various embodiments the sample is a blood or blood-derived sample. That is, the sample may be whole blood obtained from the patient, or may be derived from a quantity of blood obtained from the patient. In some embodiments, a blood derived sample may be quantity of blood plasma or serum derived from the subject's blood. In some embodiments, a blood derived sample may be quantity of monocyte fractions or patient-derived macrophage cell lines derived from the subject's blood.
[0036] In various embodiments the sample may be lung fluid. In various embodiments the sample may be tissue such as lung tissue, gastrointestinal tissue or brain tissue. In various embodiments the sample may be brain tissue.
[0037] In various embodiments, a sample is obtained from the patient suspected of having a disease associated with Leucine-rich repeat kinase 2 (LRRK2). In various embodiments, diseases associated with Leucine-rich repeat kinase 2 (LRRK2) include but are not limited to Parkinson's disease (PD), chronic inflammation, such a Crohn's disease and mycobacterial infections such as tuberculosis.
[0038] In various embodiments the methods comprise a step of obtaining a sample from the subject. In various embodiments the sample may be obtained and then stored, e.g. at −80° C. The stored sample can be thawed and analysed in accordance with the methods of the invention.
[0039] In various embodiments, a sample is obtained from the patient at a pre-determined time point in relation to a proposed or contemporaneous course of treatment of the disease associated with Leucine-rich repeat kinase 2 (LRRK2). In various embodiments samples are obtained from the patient at more than one time point in relation to a proposed or contemporaneous course of treatment of the disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0040] In various embodiments the subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) is treated with a compound able to block interaction of LRRK2 with Threonine 166 and/or Serine 189 of the Rubicon protein. Blocking the interaction prevents phosphorylation of Threonine 166 and/or Serine 189 of the Rubicon protein slowing the deterioration of motor skills and/or extending life span. In various embodiments the subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) is treated with a compound able to block interaction of LRRK2 with a phosphorylated Threonine 166 of the Rubicon protein. Blocking the interaction after phosphorylation of Threonine 166 and/or Serine 189 of the Rubicon protein will also have the effect of slowing the deterioration of motor skills and/or extending life span. In various embodiments the compound comprises a treatment antibody. In various embodiments the treatment antibody is a monoclonal antibody. In various embodiments the treatment antibody is a chimeric humanised antibody. In various embodiments the subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) is treated with a compound able to block interaction of LRRK2 with a phosphorylated Threonine 166 of the Rubicon protein.
[0041] In various embodiments the sample is or has been obtained from the patient up to 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months, 6 months or 1 year prior to a therapeutic intervention to treat the disease.
[0042] In various embodiments the sample is or has been obtained from the patient during the course of a therapeutic intervention to treat the disease. In various embodiments the sample is or has been obtained from the patient after commencement of a therapeutic intervention to treat the disease.
[0043] In various embodiments the sample is or has been obtained from the patient up to 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months, 6 months or 1 year after a therapeutic intervention to treat the disease (such as after commencement, i.e. first administration of, the therapeutic intervention). In various embodiments the sample is or has been obtained from the patient not more than 1 year, 6 months, 5 months, 4 months, 3 months, 2 months, 4 weeks, 3 weeks, 2 weeks, 13 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days or 1 day after a therapeutic intervention to treat the disease (such as after commencement, i.e. first administration of, the therapeutic intervention).
[0044] In various embodiments the sample is or has been obtained from the patient on or after completion of the course of a therapeutic intervention to treat the disease. In various embodiments the sample is or has been obtained from the patient up to 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 3 weeks, 4 weeks, 2 months, 3 months, 4 months, 5 months, 6 months or 1 year after completion of the course of a therapeutic intervention to treat the disease. In various embodiments the sample is or has been obtained from the patient not more than 1 year, 6 months, 5 months, 4 months, 3 months, 2 months, 4 weeks, 3 weeks, 2 weeks, 13 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days or 1 day after completion of the course of a therapeutic intervention to treat the disease. In various embodiments the sample is obtained from the patient post-mortem.
[0045] As used herein the term “Rubicon protein” refers to RUN domain protein as Beclin-1 interacting and cysteine-rich containing. In various embodiments the Rubicon protein has an amino acid sequence set forth in SEQ ID NO. 1 or functional variants thereof that retains one or more of the known functions of Rubicon such as interact with Beclin-1, interact with Vps34, interact with UVRAG, interact with Rab7 or inhibition of autophagy and involvement in phagocytosis and immune responses. A functional variant may have one or more substitution, deletion or additional amino acid to SEQ ID NO. 1 that retains one or more of the known functions of Rubicon. In various embodiments a functional variant comprise a sequence sharing 60%, or 70% or 80% or 90% or 95% or 96% or 97% or 98% or 99% sequence homology with SEQ ID NO. 1. As used herein Threonine at 166 refers to a Threonine in the 166th amino acid of SEQ ID NO. 1 or a Threonine somewhere in the vicinity of the 166th amino acid of a functional variant. Serine at 189 refers to a Serine in the 189th amino acid of SEQ ID NO. 1 or a Serine somewhere in the vicinity of the 189th amino acid of a functional variant.
[0046] As used herein the term “a disease associated with Leucine-rich repeat kinase 2 (LRRK2)” refers to any disease that has identified LRRK2 of SEQ ID NO. 3 as a risk factor. In various embodiments a disease associated with LRRK2 are selected from Parkinson's disease; chronic inflammation such as Crohn's disease or ulcerative colitis; and bacterial infections such as mycobacterial infections. In various embodiments a disease associated with LRRK2 is Parkinson's disease. In various embodiments the disease associated with LRRK2 may comprise an intact LRRK2 represented as the amino acid sequence set forth in SEQ ID NO. 3. In various other embodiments the disease associated with LRRK2 may comprise mutations including additions, deletions or substitutions within the LRRK2 protein of SEQ ID NO. 3.
[0047] In various embodiments the antibody is a monoclonal antibody. In various embodiments the antibody is a chimeric humanised antibody.
[0048] In various embodiments the antibody-Rubicon complex may be detected and/or measured by various methods well known in the art, for example by western blot, immunohistochemistry, immunocytochemistry, flow cytometry, ELISA, ELISPOT, reporter-based methods, etc. In various embodiments the antibody-Rubicon complex is detected with an enzyme linked immunosorbent assay (ELISA). In various embodiments, the ELISA detection may be via direct ELISA that permits calculation of the absolute amount. In various embodiments, the ELISA detection may be via indirect ELISA. In various embodiments, the ELISA detection may be via sandwich ELISA which may provide more specific quantification. In various embodiments, the ELISA detection may be via any method that allows detection of antibody-Rubicon complex.
[0049] In various embodiments, the predetermined value is the threshold for the normal range in a healthy individual that has no disease associated with Leucine-rich repeat kinase 2 (LRRK2) wherein variation from the predetermined value there is an indication that disease is present. In various embodiments, the predetermined value is a percentage, or a ratio of Rubicon protein phosphorylated at Threonine 166 of SEQ ID NO. 1 in relation to the total amount Rubicon protein in the sample. In various embodiments detection of the complex above a predetermined value indicates that the sample comes from a subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2). In various other embodiments, detection of the complex below a predetermined value indicates that the sample comes from a subject having a disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0050] In various embodiments, the in vitro method further comprises removing blocking proteins prior to contacting the isolated proteins with the antibody. In various embodiments the blocking protein may comprise albumin. In various embodiments the blocking protein may be removed by filtration, centrifugation, tagged precipitation or any method known in the art to remove specific proteins. Advantageously, the method is sensitive and specific enough to detect Rubicon protein phosphorylated at Threonine 166 in all blood samples. Generally, however, albumin removal from serum samples permits enhanced detection where serum samples are used.
[0051] In various embodiments, an antibody which is capable of binding to Rubicon phosphorylated at Threonine 166 is provided.
[0052] In various embodiments, the antibody comprises at least one variable region incorporating the CDR selected from amino acid sequences i) to vi):
[0053] i) LC-CDR1: RSSQSLVHSNGNTYLH (SEQ ID NO. 4);
[0054] ii) LC-CDR2: KLSNRFS (SEQ ID NO. 5);
[0055] iii) LC-CDR3: SQSTHVPLT (SEQ ID NO. 6);
[0056] iv) HC-CDR1: NYGVS (SEQ ID NO. 7);
[0057] v) HC-CDR2: TINSNGGSKYYPDSVKG (SEQ ID NO. 8);
[0058] vi) HC-CDR3: DVWLRRQWYFDV (SEQ ID NO. 9); and a functional variant with 99% amino acid sequence identity to any one of amino acid sequences i) to vi).
[0059] In various embodiments, the antibody comprises amino acid sequences:
[0060] i) LC-CDR1: RSSQSLVHSNGNTYLH (SEQ ID NO. 4);
[0061] ii) LC-CDR2: KLSNRFS (SEQ ID NO. 5);
[0062] iii) LC-CDR3: SQSTHVPLT (SEQ ID NO. 6);
[0063] iv) HC-CDR1: NYGVS (SEQ ID NO. 7);
[0064] v) HC-CDR2: TINSNGGSKYYPDSVKG (SEQ ID NO. 8);
[0065] vi) HC-CDR3: DVWLRRQWYFDV (SEQ ID NO. 9); or a functional variant with 99% amino acid sequence identity to any one of amino acid sequences i) to vi).
[0066] In various embodiments, the antibody comprises amino acid sequences set forth in SEQ ID NO. 12 and SEQ ID NO. 13 or a functional variant with 99% amino acid sequence identity to SEQ ID NO. 12 and SEQ ID NO. 13.
[0067] In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of at least 1:30. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of at least 1:90. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of at least 1:270. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of at least 1:810. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of at least 1:2,430. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of between 1:8 and 1:2,500. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of between 1:10 and 1:2,500. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of between 1:20 and 1:2,500. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of between 1:80 and 1:2,500. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of between 1:250 and 1:2,500. In various embodiments, the functional variant comprises an antibody that is capable of binding to Rubicon phosphorylated at Threonine 166 at a supernatant dilution of between 1:800 and 1:2,500.
Polyclonal Antibodies
[0068] In various embodiments the antibody may comprise polyclonal antibodies. Methods of preparing polyclonal antibodies are known to the skilled artisan. Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired, an adjuvant.
[0069] Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. The intensity of the response is determined by several factors including the size of the immunogen molecule, its chemical characteristics, and how different it is from the animal's own proteins. Most natural immunogens are proteins with a molecular weight above 5 kDa that come from sources phylogenically far removed from the host animal (i.e., human proteins injected into rabbits or goats). It is desirable to use highly purified proteins as immunogens, since the animal will produce antibodies to even small amounts of impurities present as well as to the major component. The antibody response increases with repeated exposure to the immunogen, so a series of injections at regular intervals is needed to achieve both high levels of antibody production and antibodies of high affinity.
[0070] In various embodiments the antibody engages, hybridizes to or binds the Rubicon protein phosphorylated at Threonine 166. In various embodiments the antibody engages, hybridizes to or binds the Rubicon protein at Threonine 166. In various embodiments the antibody engages, hybridizes to or binds the Rubicon protein at phosphorylated Threonine 166. In various embodiments the amino acid sequence will be selected from the region of about 117 to 189 in the Rubicon protein. Sequences of at least 5, 6, 7, 8, 9, 10, 15, 20, 25, 30 amino acids from this region in SEQ ID NO. 1 will generally be used to generate those antibodies. In various embodiments the amino acid sequence is SEQ ID NO. 2. Desirably, the sequence selected will generate an antibody that specifically interferes with binding of Rubicon and LRRK2.
[0071] Not all immunogenic molecules will however generate the level of antibody desired. To increase the intensity of the immune response immunogens are combined with complex mixtures called adjuvants. Adjuvants are a mixture of natural or synthetic compounds that, when administered with antigens, enhance the immune response. Adjuvants are used to (1) stimulate an immune response to an antigen that is not inherently immunogenic, (2) increase the intensity of the immune response, (3) preferentially stimulate either a cellular or a humoral response (i.e., protection from disease versus antibody production). Examples of adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
[0072] If the immunogen is still unable to generate an acceptable response, it may be conjugated to a carrier protein that is more immunogenic. Small molecules such as drugs, organic compounds, and peptides and oligosaccharides with a molecular weight of less than 2-5 kDa like, for example, SEQ ID NO.: 2, are not usually immunogenic, even when administered in the presence of adjuvant. In order to generate an immune response to these compounds, it is necessary to attach them to a protein or other compound, termed a carrier that is immunogenic. When attached to a carrier protein the small molecule immunogen is called a hapten. Haptens are also conjugated to carrier proteins for use immunoassays. The carrier protein provides a means of attaching the hapten to a solid support such as a microtiter plate or nitrocellulose membrane. When attached to agarose they may be used for purification of the anti-hapten antibodies. They may also be used to create a multivalent antigen that will be able to form large antigen-antibody complexes. When choosing carrier proteins, remember that the animal will form antibodies to the carrier protein as well as to the attached hapten. It is therefore relevant to select a carrier protein for immunization that is unrelated to proteins that may be found in the assay sample. If haptens are being conjugated for both immunization and assay, the two carrier proteins should be as different as possible. This allows the antiserum to be used without having to isolate the anti-hapten antibodies from the anti-carrier antibodies.
[0073] In various embodiments the immunizing agent is SEQ ID NO. 2 conjugated to a protein known to be immunogenic in the mammal being immunized.
[0074] Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin (KLH), serum albumin, bovine thyroglobulin, soybean trypsin inhibitor, and a toxoid, for example tetanus toxoid.
[0075] KLH is a respiratory protein found in molluscs. Its large size makes it very immunogenic, and the large number of lysine residues available for conjugation make it very useful as a carrier for haptens. The phylogenic separation between mammals and molluscs increases the immunogenicity and reduces the risk of cross-reactivity between antibodies against the KLH carrier and naturally occurring proteins in mammalian samples.
[0076] KLH is offered both in its native form, for conjugation via amines, and succinylated, for conjugation via carboxyl groups. Succinylated KLH may be conjugated to a hapten containing amine groups (such as a peptide) via cross-linking with carbodiimide between the newly introduced carboxyl groups of KLH and the amine groups of the hapten. Protocols for conjugation of haptens to carrier proteins are known in the art.
[0077] The immunization protocol may be selected by one skilled in the art without undue experimentation. Protocols for preparing immunogens, immunization of animals, and collection of antiserum may be found in reference material available to a person skilled in the art.
Monoclonal Antibodies
[0078] In various embodiments the antibodies may, alternatively, be monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975), Nature, 256:495. In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent as described above to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro.
[0079] Generally, either peripheral blood lymphocytes (“PBLs”) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
[0080] Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, Calif. and the American Type Culture Collection, Manassas, Va. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies.
[0081] The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against Rubicon protein phosphorylated at Threonine 166.
[0082] After the desired hybridoma cells are identified, the clones may be subcloned by limiting dilution procedures and grown by standard methods. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells may be grown in vivo as ascites in a mammal.
[0083] The monoclonal antibodies secreted by the subclones may be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
[0084] The monoclonal antibodies may also be made by recombinant DNA methods known in the art.
[0085] The antibodies may be monovalent antibodies. Methods for preparing monovalent antibodies are well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain cross-linking. Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent cross-linking.
[0086] In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly, Fab fragments, can be accomplished using routine techniques known in the art.
Human and Chimeric Humanized Antibodies
[0087] The antibodies of the invention may further comprise chimeric humanized antibodies or human antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′)2 or other antigen-binding sub-sequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
[0088] Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization can be essentially performed following the methods known in the art, by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies, wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
[0089] Human antibodies can also be produced using various techniques known in the art, including phage display. Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire.
Bispecific Antibodies
[0090] In various embodiment bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for Rubicon protein phosphorylated at Threonine 166, the other one is for another compound having Rubicon protein phosphorylated at Serine 189.
[0091] Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities.
[0092] In various embodiments, an antibody as described herein is provided for use in the treatment of a disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0093] As mentioned above, in various embodiments the term “a disease associated with Leucine-rich repeat kinase 2 (LRRK2)” refers to any disease that has identified LRRK2 of SEQ ID NO. 3 as a risk factor. In various embodiments a disease associated with LRRK2 are selected from Parkinson's disease; chronic inflammation such as Crohn's disease or ulcerative colitis; and bacterial infections such as mycobacterial infections. In various embodiments a disease associated with LRRK2 is Parkinson's disease.
[0094] In various embodiments the disease associated with Leucine-rich repeat kinase 2 (LRRK2) is Parkinson's disease.
[0095] In various embodiments, an inhibitor of Rubicon interaction with Leucine-rich repeat kinase 2 (LRRK2) comprising a compound able to block interaction of LRRK2 with Threonine 166 of the Rubicon protein is provided.
[0096] Current LRRK2 inhibitors directly targets LRRK2 kinase and cause adverse side effects when tested in in vivo models. Blocking or targeting specific phosphosites of LRRK2 substrate Rubicon protein has an indirect effect on the kinase. This exerts more control as the inhibition effects are confined to interactions between LRRK2 and Rubicon and pathways related to this interaction rather than affecting the generic function of LRRK2 alone.
[0097] In various embodiments the inhibitor compound comprises an antibody. In various embodiments the compound comprises a chimeric humanised antibody. In various embodiments the compound comprises a monoclonal antibody.
[0098] In various embodiments, an inhibitor as described herein above may be provided for use in the treatment of a disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0099] As mentioned above, in various embodiments the term “a disease associated with Leucine-rich repeat kinase 2 (LRRK2)” refers to any disease that has identified LRRK2 of SEQ ID NO. 3 as a risk factor. In various embodiments a disease associated with LRRK2 are selected from Parkinson's disease; chronic inflammation such as Crohn's disease or ulcerative colitis; and bacterial infections such as mycobacterial infections. In various embodiments the inhibitor is for use in the treatment of the disease associated with Leucine-rich repeat kinase 2 (LRRK2) being Parkinson's disease.
[0100] In various embodiments, use of an antibody as described herein above or an inhibitor as described herein above in the manufacture of a medicament for the treatment of a disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0101] As mentioned above, in various embodiments the term “a disease associated with Leucine-rich repeat kinase 2 (LRRK2)” refers to any disease that has identified LRRK2 of SEQ ID NO. 3 as a risk factor. In various embodiments a disease associated with LRRK2 are selected from Parkinson's disease; chronic inflammation such as Crohn's disease or ulcerative colitis; and bacterial infections such as mycobacterial infections. In various embodiments the use of the antibody or the inhibitor in the manufacture of a medicament for the treatment of a disease associated with Leucine-rich repeat kinase 2 (LRRK2) is for Parkinson's disease.
[0102] In various embodiments, a method of treating a subject in need having a disease associated with Leucine-rich repeat kinase 2 (LRRK2) comprising: administering a compound able to block interaction of LRRK2 with Threonine 166 and/or Serine 189 of the Rubicon protein.
[0103] In various embodiments, the compound is able to block interaction of LRRK2 with phosphorylated Threonine 166 and/or Serine 189 of the Rubicon protein. Blocking the interaction either before or after phosphorylation of Threonine 166 and/or Serine 189 of the Rubicon protein will have the effect of slowing the deterioration of motor skills and/or extending life span.
[0104] In various embodiments the compound used in the method comprises an antibody as described herein above. In various embodiments the antibody is a chimeric humanised antibody as described herein above. In various embodiments the antibody is a monoclonal antibody as described herein above.
[0105] In various embodiments, the compound is administered any suitable way known in the art. In various embodiments, the compound is administered by injection. In various embodiments, the compound is administered by direct injection to the site of interaction of LRRK2 with Threonine 166 and/or Serine 189 of the Rubicon protein that is responsible for causing the disease associated with Leucine-rich repeat kinase 2 (LRRK2).
[0106] In various embodiments, a kit comprising an antibody described herein above, and detection reagents for detecting a disease associated with Leucine-rich repeat kinase 2 (LRRK2) is provided.
[0107] In various embodiments the detection reagents are those used for an enzyme linked immunosorbent assay (ELISA). In various embodiments, the detection reagents are those used for direct ELISA. In various embodiments, the detection reagents are those used for indirect ELISA. In various embodiments, the detection reagents are those used for sandwich ELISA. In various embodiments, the detection reagents are those used for any method that allows detection of antibody-Rubicon complex. In various embodiments, depending on the method used the detection reagents may be selected from any one of: antigens to coat the microtiter plate; blocking reagents for unbound sites to prevent false positives; anti IgG conjugated enzymes; substrates that react with the enzyme to permit detection by colour change, fluorescence or any other means known in the art; additional reagents such as wash buffers, stop solutions, stabilizers; and any combination thereof.
[0108] In various embodiments, the kit may comprise a microtiter plate precoated with the antibodies described herein above. This will facilitate more rapid detection and reduce the chance of contamination.
[0109] As mentioned above, in various embodiments the term “a disease associated with Leucine-rich repeat kinase 2 (LRRK2)” refers to any disease that has identified LRRK2 of SEQ ID NO. 3 as a risk factor. In various embodiments a disease associated with LRRK2 are selected from Parkinson's disease; chronic inflammation such as Crohn's disease or ulcerative colitis; and bacterial infections such as mycobacterial infections.
[0110] In various embodiments the disease associated with Leucine-rich repeat kinase 2 (LRRK2) is Parkinson's disease.
EXAMPLES
[0111] Post-mortem human substantia nigra brain tissue was stained for endogenous LRRK2 (green fluorescence) and Rubicon (red fluorescence) expression. The extent of LRRK2 and Rubicon co-localisation (yellow fluorescence) was analysed by confocal microscopy and co-localisation statistics revealed a high degree of correlation between LRRK2 and Rubicon (
TABLE-US-00001 TABLE 1 Analysis of co-localization of LRRK2 and Rubicon Co-localization statistics Value Interpretation Pearson's coefficient 0.7286 Strong correlation
[0112] Two methods of LRRK2 kinase assay was used to screen for Rubicon phosphor-null mutants. The first method quantified the extent of Rubicon phosphorylation by LRRK2 kinase and determined T166 and S189 as the consensus LRRK2-specific phosphosites (
[0113] The in vivo effect of LRRK2 and Rubicon was consequently studied by co-expressing human LRRK2 and Rubicon in drosophila. Rubicon mutant lines based on previously identified phosphosites were generated: T166A, S189A, T166A+S189A drosophila Rubicon mutant (DM) and deletion 117-189 (del). T166A yielded no transformants after attempting three insertion sites on two chromosomes and S189A yielded transformants but lacked protein expression when verified by western blotting. As a result, all subsequent studies were carried out with WT, DM and del Rubicon lines after confirmed protein expression. Comparable to the human condition, the drosophila dopaminergic (DA) system is also involved in locomotor control. As distinct clusters of DA neurons identified by positive tyrosine hydroxylase (TH) staining are detectable in the adult fly brain, drosophila viability was assessed based on climbing ability, lifespan and TH-positive expression. First, the co-expression of Rubicon mutants significantly improved the ability of WT-LRRK2 and LRRK2-G2019S drosophila climbing until Day 50. After which, there was a sharp decline in performance that is characteristic of the drosophila model (
[0114] Drosophila climbing assay statistical analysis in Table 2 was carried out using multiple comparison with Tukey post-hoc test. Statistical significance is achieved when p<0.05 (bold values).
TABLE-US-00002 TABLE 2a LRRK2-WT climbing assay statistical analysis LWT + LWT + DAY Control LR-WT RWT RDM 30 Control — — — — 30 LR-WT 0.0005 — — — 30 LWT + 0.0360 0.3559 — — RWT 30 LWT + 0.9950 0.0002 0.0154 — RDM 30 LWT + 0.9688 0.0009 0.0319 0.9977 Rdel 40 Control — — — — 40 LR-WT <.0001 — — — 40 LWT + <.0001 0.9736 — — RWT 40 LWT + 0.0820 <.0001 <.0001 — RDM 40 LWT + 0.0003 0.0339 0.0935 0.0500 Rdel 50 Control — — — — 50 LR-WT <.0001 — — — 50 LWT + <.0001 0.0739 — — RWT 50 LWT + 0.0195 <.0001 <.0001 — RDM 50 LWT + <.0001 0.0227 0.0001 <.0001 Rdel 60 Control — — — — 60 LR-WT <.0001 — — — 60 LWT + <.0001 0.0061 — — RWT 60 LWT + <.0001 0.9728 0.0241 — RDM 60 LWT + 0.0022 0.1005 <.0001 0.0364 Rdel
TABLE-US-00003 TABLE 2b G2019S climbing assay statistical analysis GS + GS + Day Control G20195 RWT RDM 30 Control — — — — 30 G2019S 0.0016 — — — 30 GS + <.0001 0.3543 — — RWT 30 GS + 0.5960 0.0517 0.0006 — RDM 30 GS + Rdel 0.9694 0.0003 <.0001 0.2568 40 Control — — — — 40 G2019S <.0001 — — — 40 GS + <.0001 0.9897 — — RWT 40 GS + 0.0023 <.0001 <.0001 — RDM 40 GS + Rdel 0.0027 <.0001 <.0001 1.0000 50 Control — — — — 50 G2019S <.0001 — — — 50 GS + <.0001 0.3031 — — RWT 50 GS + <.0001 <.0001 <.0001 — RDM 50 GS + Rdel <.0001 <.0001 <.0001 0.9860 60 Control — — — — 60 G2019S 0.0001 — — — 60 GS + 0.0116 0.3811 — — RWT 60 GS + <.0001 0.9998 0.3015 — RDM 60 GS + Rdel 0.0176 0.2933 0.9998 0.2265
[0115] Drosophila lifespan statistical analysis was carried out using multiple comparison with Tukey-Kramer method. Statistical significance is achieved when p<0.05 (bold values).
TABLE-US-00004 TABLE 3a LRRK2-WT Lifespan statistical analysis Stratum1 Stratum2 Tukey CTRL LR-WT <.0001 CTRL LR-WTXR- <.0001 DM CTRL LR-WTXR- 0.0015 Del CTRL LR-WTXR- <.0001 WT LR-WT LR-WTXR- 0.0364 DM LR-WT LR-WTXR- <.0001 Del LR-WT LR-WTXR- 1.0000 WT LR-WTXR- LR-WTXR- 0.0548 DM Del LR-WTXR- LR-WTXR- 0.0497 DM WT LR-WTXR- LR-WTXR- <.0001 Del WT
TABLE-US-00005 TABLE 3b G2019S Lifespan statistical analysis Stratum1 Stratum2 Tukey CTRL G2019S <.0001 CTRL G2019S X 0.0721 RDM CTRL G2019S X <.0001 Rdel CTRL G2019S X <.0001 RWT G2019S G2019S X <.0001 RDM G2019S G2019S X 0.0279 Rdel G2019S G2019S X 0.0036 RWT G2019S X G2019S X 0.0004 RDM Rdel G2019S X G2019S X 0.0037 RDM RWT G2019S X G2019S X 0.9802 Rdel RWT
TABLE-US-00006 TABLE 4 Statistical significance of Drosophila tyrosine hydroxylase (TH) neuronal staining in aged transgenic flies. Aged (Day 60) transgenic fly brains were stained for TH neuronal clusters in five regions (PPL1, PPL2, PPM1/2, PPM3, PAL) and counted. Statistical significance was analysed using the Student's T-test after adjusting for multiple comparisons. Control LR-WT LWT + RWT LWT + RDM Control — — — — LR-WT PPL1, PPL2, PPM3, — — — PPM1/2 LVVT + RWT PPL2, PPM3, PPL1 — — PPM1/2 LWT + RDM PPM3 PPL2, PPM3, PPM1/2 PPL2, PPM1/2 LWT + Rdel PPL2, PPM3, PPL1, PPM3 — PPL1, PPL2, PPM1/2 PPM1/2 Control G2019S GS + RWT GS + RDM Control — — — — G2019S PPL2, PPM3, — — — PPM1/2 GS + RWT PPM3, PPM1/2 PPL2 — — GS + RDM PPL2 PPL2, PPM3, PPL1, PPL2, PPM3 — PPM1/2 GS + Rdel PPL1, PPL2 PAL, PPL1, PPL2, PAL, PPL1, PPL2, — PPM3, PPM1/2 PPM3, PPM1/2 Unpaired T-test Statistically significant decrease Statistically significant increase
[0116] After demonstrating that Rubicon T166 and S189 phosphor-null mutant is able to rescue LRRK2-induced toxicity in vivo, the significance of pT166 Rubicon in human PD samples using the customised pT166 Rubicon sandwich ELISA described herein was next investigated. Firstly, human serum from a local PD cohort harbouring Asian LRRK2 mutations was analysed. PD patient serum, regardless of wild-type or mutant LRRK2, had significantly higher pT166 Rubicon expression compared to healthy controls (
[0117] Post-mortem human brain samples were fractionated into soluble and membrane-associated protein fractions and subsequently analysed for pT166 Rubicon expression. Post-mortem human brain sections stained for LRRK2 and Rubicon showed that PD brain had an overall lower expression compared to control brain (
TABLE-US-00007 TABLE 5 Statistical significance of Human serum from a Singapore PD cohort harbouring LRRK2 variant mutations was analysed by pT166 Rubicon sandwich ELISA. Statistical significance was analysed using the Mann-Whitney test. Whole table statistical analysis using 1 way-ANOVA (Kruskal-Wallis test): P = 0.0168 Control- Control - PD - PD - Mann-Whitney Test LR WT LR mutants LR WT LR mutants Control - LR WT — 0.0.917 0.0433 0.0172 Control - LR mutants — — 0.0717 0.0127 PD - LR WT — — — PD - LR mutants — — 0.4285 —
TABLE-US-00008 TABLE 6 Statistical analysis of LRRK2 macrophage ELISA. Over-expressed Rubicon Endogenous Rubicon Multiple T-test P = 0.0154 P = 0.0227
TABLE-US-00009 TABLE 7 Statistical significance of Human brain samples from post- mortem Human brains samples were analysed by pT166 Rubicon sandwich ELISA. Statistical significance was analysed using one-way ANOVA and statistical significance is achieved when P <0.05. Cytosolic pT166 Rubicon Membrane pT166 Rubicon One-way P = 0.022 P = 0.0004 ANOVA
[0118] The altered expression of pT166 Rubicon in PD serum and post-mortem PD brain compared to healthy controls displayed its potential as a PD diagnostic biomarker.
[0119] In vivo, the co-expression of Rubicon phosphor-null mutants was able to rescue LRRK2-induced toxicity. This suggests that Rubicon phosphosites, T166 and S189, are possible drug target sites for LRRK2-linked diseases. Many drugs have off-target effects, therefore an allosteric inhibitor to LRRK2-specific substrate sites will enhance precision and minimise adverse off-target effects.
[0120] An antibody was formed using the synthesized peptide DAHV{pThr}AMLQCLEAVE (SEQ ID NO. 2) conjugated to Keyhole limpet hemocyanin (KLH) and the resultant immunogen peptide was used to generate phosphor-specific antibody in a mammal.
[0121] Few bona fide LRRK2 substrates have been identified to date. Among them, not many were methodically screened for LRRK2-specific phosphosites.
[0122] Polyclonal antibodies were developed in 3 Balb/c mice and 3 C57 mice using the synthesized peptide DAHV{pThr}AMLQCLEAVE (SEQ ID NO. 2) conjugated to Keyhole limpet hemocyanin (KLH). Test bleeds were taken after the 3.sup.rd and 5.sup.th immunisation with the peptide conjugate. To test titer and specificity of the antibodies 98 well plates were coated with either SEQ ID NO. 2: DAHV{pThr}AMLQCLEAVE or SEQ ID NO. 14: DAHVTAMLQCLEAVE epitopes, whereby the sequence surrounding T166 of the Rubicon protein of SEQ ID NO. 1 was either phosphorylated or not phosphorylated. Samples of pre-immunised serum and antiserum collected after the 3.sup.rd and 5.sup.th immunisation were then used in an indirect ELISA assay in phosphate buffered saline, pH 7.4 to detect the phosphorylated antigen SEQ ID NO. 2 or the un-phosphorylated antigen SEQ ID NO. 14 across a series of supernatant dilutions. The secondary antibody was a peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcy Fragment Specific (min X Hu, Boy Hrs Sr Prot). The results are listed in table 8. The dilution extended to 1:512,000, however the results for the full range of dilution is not listed.
TABLE-US-00010 TABLE 8 ELISA results for polyclonal antibodies. SEQ ID Serum Supernatant dilution Blank NO. type sample 1:1,000 1:2,000 1:4,000 1:8,000 1:16,000 1:32,0000 PBS Titer coating Pre- 1 0.08 — — — — — 0.06 <1,000 2 immunisation 0.09 — — — — — 0.08 <1,000 14 serum 2 0.07 — — — — — 0.06 <1,000 2 0.06 — — — — — 0.08 <1,000 14 antiserum 1 1.62 0.96 0.62 0.40 0.25 0.16 0.06 32,000 2 collected 0.09 0.08 0.07 0.07 0.06 0.06 0.08 <1,000 14 after the 3.sup.rd 2 2.31 1.27 0.74 0.45 0.31 0.19 0.06 64,000 2 immunisation 0.1 0.8 0.08 0.06 0.07 0.06 0.08 <1,000 14 antiserum 1 2.62 2.06 1.84 1.29 0.81 0.44 0.06 512,000 2 collected 1.13 0.71 0.35 0.21 0.14 0.10 0.08 16,000 14 after the 4.sup.rd 2 2.64 2.17 1.78 1.19 0.75 0.42 0.06 512,000 2 immunisation 1.72 1.15 0.77 0.50 0.34 0.19 0.08 64,000 14 antiserum 1 2.89 2.60 1.98 1.88 1.07 0.71 0.06 64,000 2 collected 1.99 1.57 1.00 0.75 0.42 0.25 0.08 16,000 14 after the 5.sup.rd 2 2.59 2.41 1.88 1.41 0.96 0.51 0.06 64,000 2 immunisation 2.00 1.77 1.00 0.94 0.57 0.51 0.08 64,000 14
[0123] Monoclonal antibodies were developed against the target site and 5 primary clones were selected with 2 monoclonal cell lines being established for each clone. To test titer and specificity of the antibodies 98 well plates were coated with either SEQ ID NO. 2: DAHV{pThr}AMLQCLEAVE or SEQ ID NO. 14: DAHVTAMLQCLEAVE epitopes, whereby the sequence surrounding T166 of the Rubicon protein of SEQ ID NO. 1 was either phosphorylated or not phosphorylated. All of the 10 antibody cell lines were then used in an indirect ELISA assay in phosphate buffered saline, pH 7.4 to detect the phosphorylated antigen SEQ ID NO. 2 or the un-phosphorylated antigen SEQ ID NO. 14 across a series of supernatant dilutions. The secondary antibody was a peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcy Fragment Specific (min X Hu, Boy Hrs Sr Prot). The results are listed in table 9.
TABLE-US-00011 TABLE 9 ELISA results of hybridoma culture supernatant Primary SEQ ID clone Cell Supernatant dilution Blank NO. No. lines 1:10 1:30 1:90 1:270 1:810 1:2,430 PBS Titer coating isotype 1 4B9-1 2.60 2.56 2.54 2.33 1.83 0.98 0.08 >2,430 2 IgG2a,K 0.07 0.07 0.07 0.06 0.06 0.06 0.08 <10 14 4B9-2 2.57 2.55 2.36 2.11 1.32 0.72 0.08 >2,430 2 IgG2a,K 0.09 0.08 0.07 0.06 0.06 0.06 0.08 <10 14 2 6A1-1 2.60 2.31 1.95 1.31 0.59 0.24 0.08 >2,430 2 IgG2a,K 0.07 0.06 0.06 0.06 0.06 0.05 0.08 <10 14 6A1-2 2.59 2.30 2.12 1.45 0.88 0.49 0.08 >2,430 2 IgG2a,K 0.06 0.06 0.06 0.06 0.06 0.06 0.08 <10 14 3 9B7-1 2.65 2.64 2.44 2.05 1.48 1.05 0.08 >2,430 2 IgG2,K 0.07 0.06 0.06 0.06 0.05 0.05 0.08 <10 14 9B7-2 2.75 2.63 2.59 1.99 1.32 0.80 0.08 >2,430 2 IgG2,K 0.07 0.07 0.07 0.06 0.06 0.06 0.08 <10 14 4 9D1-1 2.46 2.27 2.18 2.14 1.60 1.02 0.08 >2,430 2 IgG2a,K 0.09 0.07 0.07 0.07 0.06 0.06 0.08 <10 14 9D1-2 2.51 2.46 2.42 2.36 1.93 1.36 0.08 >2,430 2 IgG2a,K 0.15 0.15 0.06 0.06 0.06 0.06 0.08 <10 14 5 12H1-1 2.39 2.34 2.30 1.97 1.51 0.99 0.08 >2,430 2 IgG2a,K 0.07 0.07 0.06 0.06 0.06 0.05 0.08 <10 14 12H2-2 2.45 2.43 2.38 2.12 1.60 0.95 0.08 >2,430 2 IgG2a,K 0.08 0.07 0.07 0.06 0.05 0.05 0.08 <10 14
[0124] A specific monoclonal antibody against the identified target site was customised and a sandwich ELISA using the customised pT166 Rubicon antibody was developed. The pT166 Rubicon sandwich ELISA was validated with human PD serum and brain samples. The developed pT166 Rubicon sandwich ELISA may be used as a diagnostic assay for PD.
[0125] The produced monoclonal antibody was sequenced. Total RNA was isolated from the hybridoma cells following the technical manual of TRIzol® Reagent. Total RNA was then reverse-transcribed into cDNA using either isotype-specific anti-sense primers or universal primers following the technical manual of PrimeScript™ 1st Strand cDNA Synthesis Kit. Antibody fragments of heavy chain and light chain were amplified according to the standard operating procedure (SOP) of rapid amplification of cDNA ends (RACE) of GenScript. Amplified antibody fragments were cloned into a standard cloning vector separately. Colony PCR was performed to screen for clones with inserts of correct sizes. The consensus sequence is provided below. All 5 clones screened had at least 99% amino acid sequence identity. Similarly, analysis found at least 96% sequence identity in both the heavy chain (96.53% nucleotide identity) and the light chain (98.64% nucleotide identity).
TABLE-US-00012 Heavy chain: cDNA sequence (420 bp) Signal sequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, SEQ ID NO. 10: ATGAACTTAGGGCTCAGCTTCATTTTCCTTGCCCTTATTTTAAAAGGTGTCCAGTGTGAG GTGCAGCTGGTGGAGTCTGGGGGAGGCTTAGTGCAGCCTGGAGGGTCCCTGAAACTC TCCTGTGCAGCCTCTGGATTCACTTTCACTAATTATGGCGTGTCTTGGGTTCGCCAGAC TCCAGACAAGAGGCTGGAGTTGGTCGCAACCATTAATAGTAATGGTGGTAGTAAATAT TATCCAGACAGTGTGAAGGGCCGATTCACCATTTCCAGAGACACTGCCAAGAACACCC TGTACCTGCATATGAGCAGTCTGAAGTCTGAGGACACAGCCATGTATTACTGTGCAAGA GATGTATGGTTACGACGTCAGTGGTACTTCGATGTCTGGGGCGCAGGGACCACGGTC ACCGTCTCCTCA. Light chain: DNA sequence (393 bp) Signal sequence-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, SEQ ID NO. 11: ATGAAGTTGCCTGTTAGGCTGTTGGTGCTGATGTTCTGGATTCCTGCTTCCAGCAGTGA TGTTGTGATGACCCAAACTCCTCTCTCCCTGCCTGTCAGTCTTGGAGATCCAGCCTCCA TCTCTTGCAGATCTAGTCAGAGCCTTGTACACAGTAATGGAAACACCTATTTACATTG GTACCTGCAGAAGACAGGCCAGTCTCCAAAGCTCCTGATCTACAAACTTTCCAACCGA TTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCA AGATCAGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGTACACA TGTTCCTCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA. Light chain: Amino acid sequence (131 aa) Signal peptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, SEQ ID NO. 12: MKLPVRLLVLMFWIPASSSDVVMTQTPLSLPVSLGDPASISCRSSQSLVHSNGNTYLHWYL QKTGQSPKLLIYKLSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPLTF GAGTKLELK. Heavy chain: Amino acid sequence (140 aa) Signal peptide-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, SEQ ID NO. 13: MNLGLSFIFLALILKGVQCEVQLVESGGGLVQPGGSLKLSCAASGFTFTNYGVSWVRQTPD KRLELVATINSNGGSKYYPDSVKGRFTISRDTAKNTLYLHMSSLKSEDTAMYYCARDVWLR RQWYFDVWGAGTTVTVSS.
[0126] Identified LRRK2-specific Rubicon phosphosites, T166 and s189, LRRK2-linked toxicity was able to be rescued in vivo, highlighting the phosphosites potential as drug target sites.
[0127] Current work aims to build on pT166 Rubicon as a diagnostic biomarker for PD. This is achieved by assaying a small amount of patient serum protein (2 μg) with the developed pT166 Rubicon sandwich ELISA.
[0128] The quantified pT166 Rubicon expression in patient serum will determine if the assayed sample belongs to healthy control or PD group based on pre-set thresholds. Ideally, if pT166 Rubicon expression varies between short disease duration (<5 years) and long disease duration (>5 years), the quantified pT166 Rubicon expression will be able to reveal if PD is early stage or late stage.
[0129] In various embodiments Rubicon is an amino acid sequence represented by SEQ ID NO.1:
TABLE-US-00013 MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWS KYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALH VEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQ YIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHE SPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERR STSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEM SSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHS SNAESSSSNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEG QTLTVTSGAKKSHIRSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSE VSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLE KENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKI RLRRQQIRTKNLLPMYQEAEHGSFRVTSSSSQFSSRDSAQLSDSGSADE VDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVAMGLLKQF EGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIR VRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKR LRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSKDLLIKI WNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELL DSFDTVPGHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCM LCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPR CERLQARREALARQSLESYLSDYEEEPAEALALEAAVLEAT
[0130] Whereby the phosphosites T166 and S189 are represented as the bold underlined amino acids.
TABLE-US-00014 SEQ ID NO. 2: DAHV{pThr}AMLQCLEAVE. SEQ ID NO. 3: MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSE RASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQS LMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGK ITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQL TEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSG NVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEF VVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGE EDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDED GHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGI HLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTV MKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFK NDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDS VLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGIGHLLAKILVSSLYR FKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQ KDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADA NQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDS QIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQT NIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSS MDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQR HSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASE REYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQ LCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDP TVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLR LKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMT ILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLREL LFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLD VSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQ QRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGID VKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDL SKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKIT KELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVV GQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENE LPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEG CPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEY LLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEI SPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLK ITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWAL YSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILA DLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKH TSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQ QDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNA AIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYS FGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMV EKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMV ATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALV HLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFS KQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCL SESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDS NIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKEN KESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYN FCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDIN LPHEVQNLEKHIEVRKELAEKMRRTSVE
[0131] It should be further appreciated by the person skilled in the art that variations and combinations of features described above, not being alternatives or substitutes, may be combined to form yet further embodiments falling within the intended scope of the invention.
[0132] As would be understood by a person skilled in the art, each embodiment, may be used in combination with other embodiment or several embodiments.