USE OF A MANGANESE SUPEROXIDE DISMUTASE WITH HIGH STABILITY IN THE PREVENTION OR TREATMENT OF CEREBRAL STROKE
20220168400 · 2022-06-02
Assignee
Inventors
Cpc classification
A61P9/10
HUMAN NECESSITIES
International classification
A61P9/10
HUMAN NECESSITIES
Abstract
The present invention relates to the use of a manganese superoxide dismutase with high stability and a pharmaceutical composition thereof in the prevention or treatment of cerebral stroke. The amino acid sequence of the manganese superoxide dismutase with high stability of the present invention is set forth in SEQ ID NO: 4. The manganese superoxide dismutase with high stability provided by the present invention can significantly prevent and reduce the cerebral injury after cerebral stroke, and has good prevention and treatment effects on cerebral stroke.
Claims
1. A method for preventing or treating cerebral stroke, comprising administering a manganese superoxide dismutase with high stability to a person in need, wherein the amino acid sequence of the manganese superoxide dismutase with high stability is set forth in SEQ ID NO: 4.
2. The method according to claim 1, wherein a medicament comprising the manganese superoxide dismutase with high stability is administered by oral or injection route; preferably, the injection is intravenous injection or intraperitoneal injection.
3. The method according to claim 1, wherein the dosage form of a medicament comprising the manganese superoxide dismutase with high stability is a tablet, a capsule, a powder injection, an injection or an aerosol.
4. The method according to claim 1, wherein a medicament comprising the manganese superoxide dismutase with high stability further comprises one or more pharmaceutically acceptable excipients; preferably, the one or more pharmaceutically acceptable excipients is a diluent, a binder, a wetting agent, a disintegrating agent, a solvent and/or a buffer.
5. The method according to claim 1, wherein the cerebral stroke is ischemic cerebral stroke or hemorrhagic cerebral stroke.
6. A pharmaceutical composition for preventing or treating of cerebral stroke, the pharmaceutical composition consists of an active ingredient and pharmaceutically acceptable excipient(s), wherein the active ingredient is a manganese superoxide dismutase with high stability, and the amino acid sequence thereof is set forth in SEQ ID NO: 4; preferably, the pharmaceutically acceptable excipient(s) is a diluent, a binder, a wetting agent, a disintegrating agent, a solvent and/or a buffer.
7. The pharmaceutical composition according to claim 6, wherein the activity of the superoxide dismutase in the pharmaceutical composition is 200 U-200000 U/day, preferably 2000 U-200000 U/day. (Currently Amended) A method for preventing or treating of cerebral stroke, comprising administering a pharmaceutical composition comprising a manganese superoxide dismutase with high stability to a person in need, wherein the amino acid sequence of the manganese superoxide dismutase with high stability is set forth in SEQ ID NO: 4; preferably, the method of administration is oral administration or injection administration; more preferably, the cerebral stroke is ischemic cerebral stroke or hemorrhagic cerebral stroke.
9. The method according to claim 8, wherein the dose of the manganese superoxide dismutase with high stability is 200 U-200000 U/day, preferably 2000 U-200000 U/day.
10. (canceled)
11. The method according to claim 2, wherein the dosage form of a medicament comprising the manganese superoxide dismutase with high stability is a tablet, a capsule, a powder injection, an injection or an aerosol.
12. The method according to claim 2, wherein a medicament comprising the manganese superoxide dismutase with high stability further comprises one or more pharmaceutically acceptable excipients; preferably, the one or more pharmaceutically acceptable excipients is a diluent, a binder, a wetting agent, a disintegrating agent, a solvent and/or a buffer.
13. The method according to claim 3, wherein a medicament comprising the manganese superoxide dismutase with high stability further comprises one or more pharmaceutically acceptable excipients; preferably, the one or more pharmaceutically acceptable excipients is a diluent, a binder, a wetting agent, a disintegrating agent, a solvent and/or a buffer.
14. The method according to claim 2, wherein the cerebral stroke is ischemic cerebral stroke or hemorrhagic cerebral stroke.
15. The method according to claim 3, wherein the cerebral stroke is ischemic cerebral stroke or hemorrhagic cerebral stroke.
16. The method according to claim 4, wherein the cerebral stroke is ischemic cerebral stroke or hemorrhagic cerebral stroke.
17. The method according to claim 1, wherein the dose of the manganese superoxide dismutase with high stability is 200 U-200000 U/day, preferably 2000 U-200000 U/day.
18. The method according to claim 2, wherein the dose of the manganese superoxide dismutase with high stability is 200 U-200000 U/day, preferably 2000 U-200000 U/day.
19. The method according to claim 3, wherein the dose of the manganese superoxide dismutase with high stability is 200 U-200000 U/day, preferably 2000 U-200000 U/day.
20. The method according to claim 4, wherein the dose of the manganese superoxide dismutase with high stability is 200 U-200000 U/day, preferably 2000 U-200000 U/day.
21. The method according to claim 5, wherein the dose of the manganese superoxide dismutase with high stability is 200 U-200000 U/day, preferably 2000 U-200000 U/day.
Description
DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION OF THE INVENTION
[0027] The present invention will be further described below in conjunction with examples, but these examples do not constitute any limitation to the present invention.
[0028] After years of research, the applicant has found that MS-SOD can regulate the treatment target of stroke-related risk factors, neuroinflammation responses and post stroke complications. Accordingly, in this study, the applicant has evaluated and detected the situation of cerebral injury, neurological deficit and the like, by establishing a middle artery embolism ischemic model in mice, a cerebral ischemia model in zebrafish and a cerebral hemorrhage model in zebrafishes, thereby analyzing the prevention and treatment effects of MS-SOD on cerebral stroke.
[0029] Unless otherwise specified, the reagents and instruments used in the following examples are all conventional reagents and instruments in the art, and are commercially available. The experimental methods and scoring methods used in the following examples are all conventional methods in the art, and the selection and setting of parameters are also conventional choices. Those skilled in the art can implement the methods without any doubt and obtain the corresponding results based on the content described.
EXAMPLE 1
Preparation of a Manganese Superoxide Dismutase with High Stability (MS-SOD)
[0030] Using the genome of Thermus thermophilus HB27 (purchased from the ATCC cell bank of the United States, accession number: ATCC BAA-163) as a template, the following primers were used to carry out the amplification to obtain the target gene: forward primer: 5′-aagaattcatgccgtacccgttcaagct-3′ (SEQ ID NO: 1) and reverse primer: 5′-ctgtcgactcaggctttgttgaagaac-3′ (SEQ ID NO: 2); the amplified product was recovered using a recovery kit (purchased from Sangon Biotech (Shanghai) Co., Ltd.), double-digested with enzymes EcoRI and Sal I and ligated into the plasmid vector pET28a(+) (purchased from Sangon Biotech (Shanghai) Co., Ltd.) which was double-digested with the same enzymes. The resulting recombinant plasmid was transformed into competent E. coli BL21 (DE3) (purchased from Sangon Biotech (Shanghai) Co., Ltd.). The strain with the correct MS-SOD nucleotide sequence was screened by sequencing, and the strain was cultured to obtain MS-SOD protein. The nucleotide sequence of the gene encoding MS-SOD is as follows:
TABLE-US-00001 (SEQ ID NO: 3) atgccgtacccgttcaagcttcctgacctaggctacccctacgaggccc tcgagccccacattgacgccaagaccatggagatccaccaccagaagca ccacggggcctacgtgacgaacctcaacgccgccctggagaagtacccc tacctccacggggtggaggtggaggtcctcctgaggcacctcgccgccc ttccccaggacatccagaccgccgtgcgcaacaacgggggcgggcacct gaaccacagcctcttctggaggctcctcacccccgggggggccaaggag cccgtgggggagctgaagaaggccattgacgagcagttcgggggcttcc aggccctcaaggagaagctcacccaggcggccatgggccggttcggctc gggctgggcctggctcgtgaaggaccccttcggcaagctccacgtcctc tccacccccaaccaagacaaccccgtgatggagggcttcacccccatcg tgggcattgacgtctgggagcacgcctactacctcaagtaccagaaccg ccgggccgattacctccaggccatctggaacgtcctcaactgggacgtg gccgaggagttcttcaataaagcctga.
[0031] The amino acid sequence of MS-SOD is as follows:
TABLE-US-00002 (SEQ ID NO: 4) MPYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYP YLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKE PVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVL STPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWDV AEEFFKKA.
EXAMPLE 2
Experiments of MS-SOD on Cerebral Ischemia Model in Mice
1. Source of Animals
[0032] Male C57BL/6J wild-type mice were all purchased from Guangdong Experimental Animal Center. The male C57BL/6J wild-type mice were 8 weeks old, when they were subjected to establish middle cerebral artery occlusion (MCAO) model.
2. Grouping and Treatment of Mice
[0033] According to different intervention means of MS-SOD, the mice were divided into the following groups:
[0034] (1) Control group (10 mice): healthy mice aged 8 weeks;
[0035] (2) Model group (10 mice): middle cerebral artery occlusion model group without intervention of MS-SOD; the process of model establishment is shown in section 3 below;
[0036] (3) MS-SOD1 group (10 mice): mice aged 4 weeks were fed with drinking water supplemented with MS-SOD for 4 weeks (3 U/day/g body weight), and then subjected to establish middle cerebral artery occlusion model;
[0037] (4) MS-SOD2 group (10 mice): after establishing middle cerebral artery occlusion model, the mice were intragastrically administered with MS-SOD 600 U once when they waked up from the anesthesia.
3. Establishment of Middle Cerebral Artery Occlusion Model
[0038] The process of MCAO model establishment in the mice of groups (2)-(4) was as follows: the mice were weighed and anaesthetized with tribromoethanol (0.2 ml/10 g body weight); then a midline incision of about 1 cm in the neck was made and the tissue was carefully dissected to expose the right carotid trigonum; the right common carotid artery, the external carotid artery (dissected as far up as possible to the anterior cranial bifurcation) and the internal carotid artery were separated carefully; the proximal side of common carotid artery was ligated (slipknot), the small branches of the external carotid artery were broken by coagulation with the tip of electric coagulator, the proximal side (slipknot) and the distal side (fast knot) of external carotid artery were both ligated; the external carotid artery was cut and a thread (with an appropriate size selected according to the body weight of the mouse) was inserted in the direction of the external carotid artery, and the insertion was stopped when slight resistance was felt (approximately when the thread was marked (1 cm from the head) at bifurcation of the common carotid artery); the thread was fixed, and the skin was then sutured; the common carotid artery was opened after the middle cerebral artery was occluded for 60 minutes, and the cerebral infarction detection was performed at 72 hours after ischemia reperfusion. During the operation, a thermostatic blanket was used to maintain the core body temperature of the mouse at 37+0.5° C., until the mouse was awakened after the anesthesia effect, thereby preventing the hypothermic brain protection from affecting the establishment of the cerebral ischemia model in mice.
4. Experimental Methods
(1) Modified Neurological Severity Score
[0039] The procedure was performed on each group of mice. The mental state, fur luster and brightness, autonomous activity, body movement, ingestive situation and changes in body weight of all mice were observed at 24 hours after MCAO model establishment. Modified Bederson and Longa method was used to evaluate behavioral function on a 4-point scale. The mice in groups 2-4 were scored by double blind method. Score 0: no obvious nervous functional deficiency symptoms; score 1: inability to fully extend the paralyzed side forelimb and when the mouse tail was lifted 30 cm off the ground, the left forelimb showed wrist flexion, elbow flexion, shoulder internal rotation or a combination thereof; score 2: the rat turned in a circle to the paralyzed side when walking; score 3: when walking, the body of rat tilted to the paralyzed side or tilted to the left side when the shoulder was gently pushed; score 4: inability to walk or loss of consciousness.
(2) Evaluation of Cerebral Infarction Area in Mice
[0040] At 24 hours after MCAO model establishment, the head was cut off and the brain was taken after anesthesia. The brain was frozen at −20□ for 15 min and then coronal sections with a thickness of 1.5 mm were made. The brain sections were quickly placed in 1% 2,3,5-triphenyltetrazolium chloride (TTC) in phosphate buffer, and incubated at 37° C. in the dark for about 10 minutes. The normal brain tissue was stained dark red and the cerebral infarction territory was not stained (grayish-white). The infarction area of each territory was measured by ImageJ software. For the model, the applicant formulated a formula of edema corrected infarction area: Infarction area=direct injury area−(area of the ipsilateral hemisphere of the body−area of the contralateral hemisphere of the body). The total infarction area was calculated by integrating the infarction territories between sections.
(3) Detection of Tight Junction Proteins in the Intestinal Barrier
[0041] Intestinal tissue of each mouse in each group was obtained and frozen. The frozen intestinal tissue was homogenized in a mammalian tissue lysis buffer on ice, and centrifuged at 1,4000 rpm for 15 minutes to isolate proteins. Protein concentration was determined using the BCA method. An equal amount of each intestinal tissue homogenate sample was loaded onto 12% SDS-PAGE and transferred to a polyvinylidene fluoride membrane (Millipore Corporation, Bedford, Mass., USA). The membrane was blocked with 5% skimmed milk in TBST buffer at room temperature for 60 minutes, and then incubated with the primary antibodies against occludin, claudin-4, and ZO-1 (Zona occludens 1) overnight at 4° C. The membrane was then incubated with the appropriate secondary antibody conjugated with horseradish peroxidase (Santa Cruz Biotechnology Inc, Santa Cruz, Canada) for 1 hour at 37° C., the signal was visualized using an enhanced chemiluminescence (ECL) detection system (Amersham), and the intensity of spectral band was determined by ImageJ software.
(4) Statistical Analysis
[0042] Finally, the differences of different intervention conditions and MCAO model establishment on the degree of cerebral injury and neurological severity in mice were analyzed. All data were expressed as mean ±standard deviation. SPSS 20.0 software was used for statistics, and repeated measurement analysis of variance was used for statistical analysis. Bonferroni method was used for comparison between groups, P<0.05 was considered to indicate a statistically significant difference.
5. Results
[0043] The cerebral sections of mice in each group were shown in
[0044] Intestinal tight junction proteins were detected by Western Blot in cecum samples of three mice that respectively randomly selected from the model group, the control group and the MS-SOD1 group. The results were shown in
EXAMPLE 3
Experiments of MS-SOD on Treating Ischemic Cerebral Stroke Model in Zebrafish
1. Source of Animals
[0045] Zebrafishes were provided by Hunter Biotechnology, Inc.
2. Grouping of Animals
[0046]
TABLE-US-00003 Experiment group 1 normal control group Experiment group 2 model control group Experiment group 3 positive control drug aspirin 50 μg/mL Experiment group 4 MS-SOD 222 μg/mL Experiment group 5 MS-SOD 667 μg/mL Experiment group 6 MS-SOD 2000 μg/mL
[0047] Wherein the specific activity of MS-SOD was 5 U/μg
3. Model Establishment
[0048] Melanin allele mutated Albino strain zebrafish at 2 days post fertilization (2 dpf) was administered with an aqueous ponatinib solution (1 μg/mL) for 18 hours to establish a cerebral ischemia model in zebrafish.
4. Experimental Method
[0049] 180 melanin allele mutated Albino strain zebrafishes at 2 days post fertilization (2 dpf) were randomly selected. 30 zebrafishes were treated in each well (experiment group), and aqueous MS-SOD solutions with concentrations of 222, 667 and 2000 μg/mL were administrated respectively, the concentration of positive control drug aspirin was 50 μg/m L, and the normal control group and the model control group were set at the same time. The volume of each well was 3 mL. After MS-SOD treatment for a period of time, except for the normal control group, all the other experiment groups were simultaneously administrated with aqueous ponatinib solution to induce the cerebral ischemia model in zebrafish. After 18 hours of co-treatment with MS-SOD and ponatinib, 20 fish were randomly selected from each well and stained with o-Dianisidine. After staining, photos were taken and data were collected to count the number of zebrafish with cerebral ischemia and calculate the incidence of cerebral ischemia in zebrafish of each experiment group.
5. Experimental Results
[0050] Compared with 0% (0/20) in the normal control group, the incidence of cerebral ischemia in the zebrafishes of the model control group was 100% (20/20), p<0.001, indicating that the cerebral ischemia model in zebrafish was successfully established. Compared with the model control group, the incidence of cerebral ischemia in the zebrafishes of the positive control drug aspirin 50 μg/mL group was 35% (7/20), p<0.001, the improvement effect on cerebral ischemia was 65%, indicating that aspirin had a significant improvement effect on cerebral ischemia in zebrafish. Compared with 100% (20/20) in the model control group, when the concentrations of MS-SOD were 222, 667 and 2000 μg/mL, the incidences of cerebral ischemia were 40% (8/20), 35% (7/20) and 45% (9/20) respectively, p<0.001 & p<0.001 & p<0.001, the improvement effects on cerebral ischemia were 60%, 65% and 55% respectively, indicating that MS-SOD had a significant therapeutic effect on cerebral ischemia in zebrafish under the experimental concentration conditions. The specific results are shown in Table 1,
TABLE-US-00004 TABLE 1 Improvement effect of MS-SOD on cerebral ischemia in zebrafish (n = 20) Number of Improvement zebrafish Incidence effect on Concen- with of cerebral cerebral tration cerebral ischemia ischemia Group (μg/mL) ischemia (%) (%) Normal — 0 0 — control group Model — 20 100 — control group Aspirin 50 7 35*** 65*** MS-SOD 222 8 40** 60*** 667 7 35*** 65*** 2000 9 45*** 55*** Compared with the model control group: ***p < 0.001.
EXAMPLE 4
Evaluation of Improvement Effect of MS-SOD on Cerebral Hemorrhage
Source of Animals
[0051] Zebrafishes were provided by Hunter Biotechnology, Inc.
1. Concentration Groups
[0052]
TABLE-US-00005 Experiment group 1 normal control group Experiment group 2 model control group Experiment group 3 positive control drug icariin 30 μM Experiment group 4 MS-SOD 222 μg/mL Experiment group 5 MS-SOD 667 μg/mL Experiment group 6 MS-SOD 2000 μg/mL
[0053] Wherein the specific activity of MS-SOD was 5 U/μg
2. Model Establishment
[0054] 1 dpf wild-type AB strain zebrafish was administered with an aqueous simvastatin solution (0.5 μM) for 18 hours to establish a cerebral hemorrhage model in zebrafish.
3. Experimental Method
[0055] 180 wild-type AB strain zebrafishes at 1 day post fertilization (1 dpf) were randomly selected and put in a six-well plate, 30 per well (experiment group). Simvastatin was used to induce a cerebral hemorrhage model in zebrafish. Aqueous MS-SOD solutions with concentrations of 222, 667 and 2000 μg/mL were administrated respectively, the concentration of positive control drug icariin was 30 μM, and the normal control group and the model control group were set at the same time. The volume of each well was 3 mL. After 18 hours of co-treatment with MS-SOD and simvastatin, 30 zebrafishes from each group were selected and observed under a microscope, photos were taken and saved. The number of zebrafish with cerebral hemorrhage was counted, and the incidence of cerebral hemorrhage in zebrafish of each experiment group was calculated.
4. Experimental Results
[0056] Results: the incidence of cerebral hemorrhage in the zebrafishes of the model control group was 83% (25/30), the incidence of cerebral hemorrhage in the zebrafishes of the positive control drug icariin 30 μM group was 57% (17/30), the improvement effect on cerebral hemorrhage was 32%; when the concentrations of MS-SOD were 222, 667 and 2000 μg/mL, the incidences of cerebral hemorrhage were 60% (18/30), 67% (20/30) and 57% (17/30) respectively, the improvement effect on cerebral hemorrhage was 28%, 20% and 32% respectively, indicating that MS-SOD had a significant improvement effect on cerebral hemorrhage in zebrafish. The specific results are shown in Table 2,
TABLE-US-00006 TABLE 2 Improvement effect of MS-SOD on cerebral hemorrhage in zebrafish (n = 30) Number of Improvement zebrafish Incidence effect on Concen- with of cerebral cerebral tration cerebral hemorrhage hemorrhage Group (μg/mL) hemorrhage (%) (%) Normal — 0 0 — control group Model — 25 83 — control group Icariin 30 μM 17 56* 32* MS-SOD 222 18 60 28 667 20 67 20 2000 17 57* 32* Compared with the model control group: *p < 0.05.
EXAMPLE 5
Evaluation of Behavioral Improvement Effect of MS-SOD on Cerebral Hemorrhage
Source of Animals
[0057] Zebrafishes were provided by Hunter Biotechnology, Inc.
1. Concentration Groups
[0058]
TABLE-US-00007 Experiment group 1 normal control group Experiment group 2 model control group Experiment group 3 positive control drug icariin 30 μM Experiment group 4 MS-SOD 222 μg/mL Experiment group 5 MS-SOD 667 μg/mL Experiment group 6 MS-SOD 2000 μg/mL
[0059] Wherein the specific activity of MS-SOD was 5 U/μg
2. Model Establishment
[0060] 5 dpf wild-type AB strain zebrafish was administered with an aqueous simvastatin solution (0.5 μM) for 18 hours to establish a cerebral hemorrhage model in zebrafish.
3. Experimental Method
[0061] 180 wild-type AB strain zebrafishes at 5 days post fertilization (5 dpf) were randomly selected and put in a six-well plate, 30 per well (experiment group). Aqueous MS-SOD solutions with concentrations of 222, 667 and 2000 μg/mL were administrated respectively, the concentration of positive control drug icariin was 30 μM, and the normal control group and the model control group were set at the same time. The volume of each well was 3 mL. After treatment of zebrafishes with samples for 4 hours, except for the normal control group, the other experiment groups were treated with simvastatin for 18 hours to establish the cerebral hemorrhage model. After the treatment, 10 zebrafishes from each group were randomly selected to measure the movement velocity (V) of zebrafish using a behavioral analyzer. The statistical significance of the movement velocity was used to evaluate the behavioral improvement effect of MS-SOD on cerebral hemorrhage. The formula of the behavioral improvement effect of MS-SOD on cerebral hemorrhage was as follows:
[0062] Statistical analysis was performed using variance analysis and Dunnett's T-test, and p<0.05 indicated a significant difference.
4. Experimental Results
[0063] Results: compared with the normal control group (198 mm/s), the movement velocity of the zebrafishes in the model control group was 80 mm/s, p<0.001, indicating that the model was successfully established; compared with the model control group (80 mm/s), the movement velocity of the zebrafishes in the positive control drug icariin 30 μM group was 106 mm/s, p<0.05, the movement improvement effect was 22%, indicating that the icariin had a significant improvement effect on the movement velocity of zebrafish after cerebral hemorrhage stroke; compared with the model control group, when the concentrations of MS-SOD were 222, 667 and 2000 μg/mL, the movement velocities of the zebrafishes were 78, 88 and 143 mm/s respectively, p>0.05 & p>0.05 & p<0.05, the movement improvement effects were −2%, 7% and 53%, indicating that MS-SOD at 2000 μg/mL had a significant behavioral improvement effect on cerebral hemorrhage. The results are shown in Table 3,
TABLE-US-00008 TABLE 3 Quantitative evaluation of the movement improvement effect of MS-SOD after cerebral ischemia (n = 10) Movement Concen- velocity Movement tration (mm/s) improvement Group (μg/mL) (mean ± SE) effect (%) Normal control — 198 ± 13 — group Model control — 80 ± 7 — group Icariin 25 106 ± 7* 22* MS-SOD 222 78 ± 4 −2 667 88 ± 3 7 2000 143 ± 24* 53* Compared with the model control group, *p < 0.05.
EXAMPLE 6
Evaluation of Improvement Effect of MS-SOD on Blood Flow Volume of Cerebral Hemorrhage
Source of Animals
[0064] Zebrafishes were provided by Hunter Biotechnology, Inc.
1. Concentration Groups
[0065]
TABLE-US-00009 Experiment group 1 normal control group Experiment group 2 model control group Experiment group 3 positive control drug icariin 30 μM Experiment group 4 MS-SOD 222 μg/mL Experiment group 5 MS-SOD 667 μg/mL Experiment group 6 MS-SOD 2000 μg/mL
[0066] Wherein the specific activity of MS-SOD was 5 U/μg
2. Model establishment
[0067] 3 dpf wild-type AB strain zebrafish was administered with an aqueous simvastatin solution (0.5 μM) for 18 hours to establish a cerebral hemorrhage model in zebrafish.
3. Experimental Method
[0068] 180 wild-type AB strain zebrafishes at 3 days post fertilization (3 dpf) were randomly selected and put in a six-well plate, 30 per well (experiment group). Aqueous MS-SOD solutions with concentrations of 222, 667 and 2000 μg/mL were administrated respectively, the concentration of positive control drug icariin was 30 μM, and the normal control group (the zebrafishes were treated with water for fish) and the model control group were set at the same time. The volume of each well was 3 mL. After treatment of zebrafishes with samples for 4 hours, except for the normal control group, the other experiment groups were treated with simvastatin for 18 hours to establish the cerebral hemorrhage model. After the treatment, 10 zebrafishes from each group were randomly selected and placed in a heart rate and blood flow analysis system to record blood flow video of zebrafish, and analyze the blood flow volume (O) of zebrafish. The statistical significance of the blood flow volume was used to evaluate the improvement effect of MS-SOD on blood flow volume of cerebral hemorrhage. The formula of the improvement effect of MS-SOD on blood flow volume of cerebral hemorrhage was as follows:
[0069] Statistical analysis was performed using variance analysis and Dunnett's T-test, and p<0.05 indicated a significant difference. 4. Experimental results Results:, compared with the normal control group (0.30 nL/s), the blood flow volume of the zebrafishes in the model control group was 0.13 nL/s, p<0.001, indicating that the model was successfully established; the blood flow volume of the zebrafishes in the positive control drug icariin 30 μM group was 0.18 nL/s, p>0.05, the movement improvement effect was 29%, indicating that the improvement effect of icariin on the blood flow volume of cerebral hemorrhage was not obvious; compared with the model control group, when the concentrations of MS-SOD were 222, 667 and 2000 μg/mL, the blood flow volumes of the zebrafishes were 0.23, 0.25 and 0.25 nL/s respectively, p<0.01 & p<0.001 & p<0.001, the improvement effects on blood flow volume were 59%, 71% and 71% respectively, indicating that MS-SOD had a significant improvement effect on the blood flow volume of cerebral hemorrhage. The specific results are shown in Table 4 and
TABLE-US-00010 TABLE 4 Quantitative evaluation of the improvement effect of MS-SOD on the blood flow volume of cerebral hemorrhage (n = 10) Blood flow Blood flow volume Concen- volume improve- tration (nL/s) ment effect Group (μg/mL) (mean ± SE) (%) Normal control group — 0.30 ± 0.016 — Model control group — 0.13 ± 0.014 — Icariin 30 μM 0.18 ± 0.025 29 MS-SOD 222 0.23 ± 0.014** 59** 667 0.25 ± 0.024*** 71*** 2000 0.25 ± 0.019*** 71*** Compared with the model control group, **p < 0.01, ***p < 0.001.
[0070] All documents mentioned in the present invention are cited as references in this application, and each document is individually cited as a reference. In addition, it should be understood that after reading the above content of the present invention, those skilled in the art can make various changes or modifications to the present invention, and these equivalent and alternative forms also fall within the scope defined by the claims of the present application.