ANTIBODIES THAT BIND PSMA AND GAMMA-DELTA T CELL RECEPTORS
20230272110 · 2023-08-31
Inventors
- Robertus Cornelis Roovers (Utrecht, NL)
- Johannes Jelle Van Der Vliet (Amsterdam, NL)
- Lisa Anna KING (Amsterdam, NL)
- Paul Willem Henri Ida Parren (Utrecht, NL)
- Victoria IGLESIAS GUIMARAIS (Utrecht, NL)
- David LUTJE HULSIK (Utrecht, NL)
- Peter Alexander Gerardus Maria MACHIELSEN (Utrecht, NL)
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K16/3069
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Provided herein are antibodies capable of binding human PSMA and capable of binding a human Vγ9Vδ2 T cell receptor. In particular, provided herein are pharmaceutical compositions comprising the antibodies capable of binding human PSMA and capable of binding a human Vγ9VΩ T cell receptor and uses of the antibodies for medical treatment.
Claims
1. A multispecific antibody comprising a first antigen-binding region capable of binding human PSMA and a second antigen-binding region capable of binding a human Vγ9Vβ2 T cell receptor.
2. The multispecific antibody according to claim 1, wherein the multispecific antibody is a bispecific antibody.
3. The multispecific antibody according to claim 1, wherein the first antigen-binding region is a single-domain antibody.
4. The multispecific antibody according to claim 1, wherein the second antigen-binding region is a single-domain antibody.
5. The multispecific antibody according to claim 1, wherein the multispecific antibody competes for binding to human PSMA with an antibody having the sequence set forth in SEQ ID NO:2.
6. The multispecific antibody according to a claim 1, wherein the first antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:14, the VH CDR2 sequence set forth in SEQ ID NO:15 and the VH CDR3 sequence set forth in SEQ ID NO:16.
7. The multispecific antibody according to claim 1, wherein the first antigen-binding region is humanized, and wherein the first antigen-binding region comprises the sequence set forth in SEQ ID NO:2, or a sequence having at least 90% sequence identity to the sequence set forth in SEQ ID NO:2.
8. The multispecific antibody according to claim 1, wherein the multispecific antibody is able to activate human Vγ9Vβ2 T cells.
9. The multispecific antibody according to claim 1, wherein the multispecific antibody is capable of binding to human Vβ2.
10. The multispecific antibody according to claim 1, wherein the multispecific antibody competes for binding to human Vβ2 with an antibody having the sequence set forth in SEQ ID NO:5 or competes for binding to human Vβ2 with an antibody having the sequence set forth in SEQ ID NO:20.
11. The multispecific antibody according to claim 1, wherein the multispecific antibody binds the same epitope on human Vβ2 as an antibody having the sequence set forth in SEQ ID NO:5 or binds the same epitope on human Vβ2 as an antibody having the sequence set forth in SEQ ID NO:20.
12. The multispecific antibody according to claim 1, wherein the second antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:17, the VH CDR2 sequence set forth in SEQ ID NO:18 and the VH CDR3 sequence set forth in SEQ ID NO:19 or comprises the VH CDR1 sequence set forth in SEQ ID NO:21, the VH CDR2 sequence set forth in SEQ ID NO:22 and the VH CDR3 sequence set forth in SEQ ID NO:23.
13. The multispecific antibody according to claim 1, wherein the second antigen-binding region is humanized, and wherein the second antigen-binding region comprises the sequence set forth in SEQ ID NO:5, or a sequence having at least 90% sequence identity to the sequence set forth in SEQ ID NO:5.
14. The multispecific antibody according to claim 1, wherein the first antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:14, the VH CDR2 sequence set forth in SEQ ID NO:15 and the VH CDR3 sequence set forth in SEQ ID NO:16 and wherein the second antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:15, the VH CDR2 sequence set forth in SEQ ID NO:18 and the VH CDR3 sequence set forth in SEQ ID NO:19.
15. The multispecific antibody according to claim 1, wherein the multispecific antibody is capable of binding to human Vg9.
16. The multispecific antibody according to claim 1, wherein the multispecific antibody is capable of mediating killing of PSMA-expressing cells by Vγ9Vβ2 T cells.
17. The multispecific antibody according to claim 1, wherein the multispecific antibody is capable of mediating killing of human PSMA-expressing cells from a prostate cancer patient.
18. The multispecific antibody according to claim 1, wherein the first antigen-binding region and second antigen-binding region are covalently linked via a peptide linker.
19. The multispecific antibody according to claim 18, wherein the peptide linker comprises the sequence set forth in SEQ ID NO:6.
20. The multispecific antibody according to claim 1, wherein the first antigen-binding region capable of binding human PSMA is located N-terminally of the second antigen-binding region capable of binding a human Vγ9Vβ2 T cell receptor.
21. The multispecific antibody according to claim 1, wherein the multispecific antibody further comprises a half-life extension domain.
22. The multispecific antibody according to claim 20, wherein the multispecific antibody has a terminal half-life that is longer than about 168 hours when administered to a human subject.
23. The multispecific antibody according to claim 1, wherein the multispecific antibody comprises an Fc region.
24. The multispecific antibody according to claim 23, wherein the Fc region is a heterodimer comprising two Fc polypeptides, wherein the first antigen-binding region is fused to the first Fc polypeptide and the second antigen-binding region is fused to the second Fc polypeptide and wherein the first and second Fc polypeptides comprise asymmetric amino acid mutations that favor the formation of heterodimers over the formation of homodimers.
25. The multispecific antibody according to claim 24, wherein the CH3 regions of the Fc polypeptides comprise said asymmetric amino acid mutations, wherein the first Fc polypeptide comprises a T366W substitution and the second Fc polypeptide comprises T366S, L368A and Y407V substitutions, or vice versa, wherein the amino acid positions correspond to human IgG1 according to the EU numbering system.
26. The multispecific antibody according to claim 24, wherein the cysteine residues at position 220 in the first and second Fc polypeptides have been deleted or substituted, and wherein the amino acid positions correspond to human IgG1 according to the EU numbering system.
27. The multispecific antibody according claim 24, wherein the first and second Fc polypeptides further comprise a mutation at position 234 and/or 235, wherein the first and second Fc polypeptide comprise an L234F and an L235E substitution, and wherein the amino acid positions correspond to human IgG1 according to the EU numbering system.
28. The multispecific antibody according to claim 24, wherein the first antigen-binding region comprises the sequence set forth in SEQ ID NO:2, the second antigen-binding region comprises the sequence set forth in SEQ ID NO:5 and wherein the first Fc polypeptide comprises the sequence set forth in SEQ ID NO:12 and the second Fc polypeptide comprises the sequence set forth in SEQ ID NO:13, or the first Fc polypeptide comprises the sequence set forth in SEQ ID NO:12 and the second Fc polypeptide comprises the sequence set forth in SEQ ID NO:13.
29. A pharmaceutical composition comprising a multispecific antibody according to claim 1, and a pharmaceutically-acceptable excipient.
30. The pharmaceutical composition according to claim 29, wherein the pharmaceutical composition comprises a buffer, sucrose, polysorbate 80 and methionine, and wherein the pH of the composition is between 5.4 and 7.4.
31. The A medicament comprising a multispecific antibody according to claim 1.
32. The A method of treating cancer comprising administration of the multispecific antibody according to claim 1.
33. A method of treating prostate cancer comprising administration of the multispecific antibody according to claim 1.
34. The A method of treating cancers in which PSMA is expressed on the tumor neo-vasculature or tumor-associated endothelial cells of primary or metastatic tumors comprising cancers selected from colorectal cancer, lung cancer, breast cancer, endometrial and ovarian cancer, gastric cancer, renal cell cancer, urothelial cancer, hepatocellular cancer, oral squamous cancer, thyroid tumors and glioblastomas comprising administration of the multispecific antibody according to claim 1.
35. A method of treating an adenoid cystic carcinoma of the head and neck comprising administration of the multispecific antibody according to claim 1.
36. A method of treating a disease comprising administration of a multispecific antibody according to claim 1.
37. The method according to claim 36, wherein the disease is cancer.
38. A nucleic acid construct encoding the multispecific antibody according to claim 1.
39. An expression vector comprising a nucleic acid construct according to claim 38.
40. A host cell comprising a nucleic acid construct according to claim 38.
41. A method for production of the multispecific antibody as defined in claim 1 comprising (co-)expression of one or more nucleic acid constructs encoding the multispecific antibody in a suitable host cell, followed by purification of the produced recombinant antibody.
42. The multispecific antibody according to claim 1, wherein the multispecific antibody binds the same epitope on human PSMA as an antibody having the sequence set forth in SEQ ID NO:2.
43. The multispecific antibody according to claim 16, wherein the PSMA-expressing cells comprise LNCaP cells.
44. The pharmaceutical composition according to claim 30, wherein the pH of the composition is between 5.4 and 6.1.
45. A host cell comprising an expression vector according to claim 39.
46. The host cell according to claim 40, wherein the host cell is a mammalian host cell.
47. The host cell according to claim 46, wherein the mammalian host cell is a CHO cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0028] The term “human PSMA”, when used herein, refers to the human Prostate-Specific Membrane Antigen protein, also known as glutamate carboxypeptidase 2 (EC:3.4.17.21), cell growth-inhibiting gene 27 protein, Folate hydrolase 1, Folylpoly-gamma-glutamate carboxypeptidase (FGCP), glutamate carboxypeptidase II (GCPII), membrane glutamate carboxypeptidase (mGCP), N-acetylated-alpha-linked acidic dipeptidase I (NAALADase I) or pteroylpoly-gamma-glutamate carboxypeptidase (UniProtKB-Q04609 (FOLH1_HUMAN)), Isoform I, set forth in SEQ ID NO:24.
[0029] The term “human Vβ2”, when used herein, refers to the TRDV2 protein, T cell receptor delta variable 2 (UniProtKB-AOJD36 (AOJD36_HUMAN) gives an example of a Vβ2 sequence).
[0030] The term “human Vγ9”, when used herein, refers to the TRGV9 protein, T cell receptor gamma variable 9 (UniProtKB-Q99603_HUMAN gives an example of a Vγ9 sequence).
[0031] The term “antibody” is intended to refer to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half-life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an effector activity). The antigen-binding region (or antigen-binding domain) which interacts with an antigen may comprise variable regions of both the heavy and light chains of the immunoglobulin molecule or may be a single-domain antigen-binding region, e.g. a heavy chain variable region only. The constant regions of an antibody, if present, may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells and T cells) and components of the complement system such as C1q, the first component in the classical pathway of complement activation. In some embodiments, however, the Fc region of the antibody has been modified to become inert, “inert” means an Fc region which is at least not able to bind any Fcγ Receptors, induce Fc-mediated cross-linking of FcRs, or induce FcR-mediated cross-linking of target antigens via two Fc regions of individual antibodies. In a further embodiment, the inert Fc region is in addition not able to bind C1q. In one embodiment, the antibody contains mutations at positions 234 and 235 (Canfield and Morrison (1991) J Exp Med 173:1483), e.g. a Leu to Phe mutation at position 234 and a Leu to Glu mutation at position 235. In another embodiment, the antibody contains a Leu to Ala mutation at position 234, a Leu to Ala mutation at position 235 and a Pro to Gly mutation at position 329. In another embodiment, the antibody contains a Leu to Phe mutation at position 234, a Leu to Glu mutation at position 235 and an Asp to Ala at position 265.
[0032] The Fc region of an immunoglobulin is defined as the fragment of an antibody which would be typically generated after digestion of an antibody with papain which includes the two CH2-CH3 regions of an immunoglobulin and a connecting region, e.g. a hinge region. The constant domain of an antibody heavy chain defines the antibody isotype, e.g. IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgM, IgD, or IgE. The Fc-region mediates the effector functions of antibodies with cell surface receptors called Fc receptors and proteins of the complement system.
[0033] The term “hinge region” as used herein is intended to refer to the hinge region of an immunoglobulin heavy chain. Thus, for example the hinge region of a human IgG1 antibody corresponds to amino acids 216-230 according to the EU numbering.
[0034] The term “CH2 region” or “CH2 domain” as used herein is intended to refer to the CH2 region of an immunoglobulin heavy chain. Thus, for example the CH2 region of a human IgG1 antibody corresponds to amino acids 231-340 according to the EU numbering. However, the CH2 region may also be any of the other subtypes as described herein.
[0035] The term “CH3 region” or “CH3 domain” as used herein is intended to refer to the CH3 region of an immunoglobulin heavy chain. Thus, for example the CH3 region of a human IgG1 antibody corresponds to amino acids 341-447 according to the EU numbering. However, the CH3 region may also be any of the other subtypes as described herein.
[0036] Reference to amino acid positions in the Fc region/Fc domain in the present invention is according to the EU-numbering (Edelman et al., Proc Natl Acad Sci USA. 1969 May; 63(1):78-85; Kabat et al., Sequences of proteins of immunological interest. 5th Edition-1991 NIH Publication No. 91-3242).
[0037] As indicated above, the term antibody as used herein, unless otherwise stated or clearly contradicted by context, includes fragments of an antibody that retain the ability to specifically bind to the antigen. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term “antibody” include (i) a Fab′ or Fab fragment, i.e. a monovalent fragment consisting of the VL, VH, CL and CH1 domains, or a monovalent antibody as described in WO2007059782; (ii) F(ab′)2 fragments, i.e. bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting essentially of the VH and CH1 domains; and (iv) a Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody. Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain antibodies or single chain Fv (scFv), see for instance Bird et al., Science 242, 423-426 (1988) and Huston et al., PNAS USA 85, 5879-5883 (1988)). Such single chain antibodies are encompassed within the term antibody unless otherwise indicated by context. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility. The term antibody, unless specified otherwise, also includes polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies and humanized antibodies, and antibody fragments provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
[0038] In some embodiments of the antibodies of the invention, the first antigen-binding region or the antigen-binding region, or both, is a single domain antibody. Single domain antibodies (sdAb, also called Nanobody®, or VHH) are well known to the skilled person, see e.g. Hamers-Casterman et al. (1993) Nature 363:446, Roovers et al. (2007) Curr Opin Mol Ther 9:327 and Krah et al. (2016) Immunopharmacol Immunotoxicol 38:21. Single domain antibodies comprise a single CDR1, a single CDR2 and a single CDR3. Examples of single domain antibodies are variable fragments of heavy-chain-only antibodies, antibodies that naturally do not comprise light chains, single domain antibodies derived from conventional antibodies, and engineered antibodies. Single domain antibodies may be derived from any species including mouse, human, camel, llama, shark, goat, rabbit, and cow. For example, naturally occurring VHH molecules can be derived from antibodies raised in Camelidae species, for example in camel, dromedary, llama, alpaca and guanaco. Like a whole antibody, a single domain antibody is able to bind selectively to a specific antigen. Single domain antibodies may contain only the variable domain of an immunoglobulin chain, i.e. CDR1, CDR2 and CDR3 and framework regions.
[0039] The term “immunoglobulin” as used herein is intended to refer to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) chains and one pair of heavy (H) chains, all four potentially inter-connected by disulfide bonds. The term “immunoglobulin heavy chain”, “heavy chain of an immunoglobulin” or “heavy chain” as used herein is intended to refer to one of the chains of an immunoglobulin. A heavy chain is typically comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH) which defines the isotype of the immunoglobulin. The heavy chain constant region typically is comprised of three domains, CH1, CH2, and CH3. The heavy chain constant region further comprises a hinge region. Within the structure of the immunoglobulin (e.g. IgG), the two heavy chains are inter-connected via disulfide bonds in the hinge region. Equally to the heavy chains, each light chain is typically comprised of several regions; a light chain variable region (VL) and a light chain constant region (CL). Furthermore, the VH and VL regions may be subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. CDR sequences may be determined by use of various methods, e.g. the methods provided by Choitia and Lesk (1987) J. Mol. Biol. 196:901 or Kabat et al. (1991) Sequence of protein of immunological interest, fifth edition. NIH publication. Various methods for CDR determination and amino acid numbering can be compared on www.abysis.org (UCL).
[0040] The term “isotype” as used herein, refers to the immunoglobulin (sub)class (for instance IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) or any allotype thereof, such as IgG1m(za) and IgG1m(f) that is encoded by heavy chain constant region genes. Each heavy chain isotype can be combined with either a kappa (κ) or lambda (A) light chain. An antibody of the invention can possess any isotype.
[0041] The term “parent antibody”, is to be understood as an antibody which is identical to an antibody according to the invention, but wherein the parent antibody does not have one or more of the specified mutations. A “variant” or “antibody variant” or a “variant of a parent antibody” of the present invention is an antibody molecule which comprises one or more mutations as compared to a “parent antibody”. Amino acid substitutions may exchange a native amino acid for another naturally occurring amino acid, or for a non-naturally occurring amino acid derivative. The amino acid substitution may be conservative or non-conservative. In the context of the present invention, conservative substitutions may be defined by substitutions within the classes of amino acids reflected in one or more of the following three tables:
Amino Acid Residue Classes for Conservative Substitutions
[0042]
TABLE-US-00001 Acidic Residues Asp (D) and Glu (E) Basic Residues Lys (K), Arg (R), and His (H) Hydrophilic Uncharged Residues Ser (S), Thr (T), Asn (N), and Gln (Q) Aliphatic Uncharged Residues Gly (G), Ala (A), Val (V), Leu (L), and Ile (I) Non-polar Uncharged Residues Cys (C), Met (M), and Pro (P) Aromatic Residues Phe (F), Tyr (Y), and Trp (W)
Alternative Conservative Amino Acid Residue Substitution Classes
[0043]
TABLE-US-00002 1 A S T 2 D E 3 N Q 4 R K 5 I L M 6 F Y W
Alternative Physical and Functional Classifications of Amino Acid Residues
[0044]
TABLE-US-00003 Alcohol group-containing residues S and T Aliphatic residues I, L, V, and M Cycloalkenyl-associated residues F, H, W, and Y Hydrophobic residues A, C, F, G, H, I, L, M, R, T, V, W, and Y Negatively charged residues D and E Polar residues C, D, E, H, K, N, Q, R, S, and T Positively charged residues H, K, and R Small residues A, C, D, G, N, P, S, T, and V Very small residues A, G, and S Residues involved in turn A, C, D, E, G, H, K, N, Q, R, S, formation P, and T Flexible residues Q, T, K, S, G, N, D, E, and R
In the context of the present invention, a substitution in a variant is indicated as:
[0045] Original amino acid-position-substituted amino acid;
[0046] The three-letter code, or one letter code, are used, including the codes Xaa and X to indicate amino acid residue. Accordingly, the notation “T366W” means that the variant comprises a substitution of threonine with tryptophan in the variant amino acid position corresponding to the amino acid in position 366 in the parent antibody.
[0047] Furthermore, the term “a substitution” embraces a substitution into any one of the other nineteen natural amino acids, or into other amino acids, such as non-natural amino acids. For example, a substitution of amino acid T in position 366 includes each of the following substitutions: 366A, 366C, 366D, 366G, 366H, 366F, 366I, 366K, 366L, 366M, 366N, 366P, 366Q, 366R, 366S, 366E, 366V, 366W, and 366Y.
[0048] The term “full-length antibody” when used herein, refers to an antibody which contains all heavy and light chain constant and variable domains corresponding to those that are normally found in a wild-type antibody of that isotype.
[0049] The term “chimeric antibody” refers to an antibody wherein the variable region is derived from a non-human species (e.g. derived from rodents) and the constant region is derived from a different species, such as human. Chimeric antibodies may be generated by genetic engineering. Chimeric monoclonal antibodies for therapeutic applications are developed to reduce antibody immunogenicity.
[0050] The term “humanized antibody” refers to a genetically engineered non-human antibody, which contains human antibody constant domains and non-human variable domains modified to contain a high level of sequence homology to human variable domains. This can be achieved by grafting of the six non-human antibody complementarity-determining regions (CDRs), which together form the antigen binding site, onto a homologous human acceptor framework region (FR). In order to fully reconstitute the binding affinity and specificity of the parental antibody, the substitution of framework residues from the parental antibody (i.e. the non-human antibody) into the human framework regions (back-mutations) may be required. Structural homology modeling may help to identify the amino acid residues in the framework regions that are important for the binding properties of the antibody. Thus, a humanized antibody may comprise non-human CDR sequences, primarily human framework regions optionally comprising one or more amino acid back-mutations to the non-human amino acid sequence, and, optionally, fully human constant regions. Optionally, additional amino acid modifications, which are not necessarily back-mutations, may be introduced to obtain a humanized antibody with preferred characteristics, such as affinity and biochemical properties. Humanization of non-human therapeutic antibodies is performed to minimize its immunogenicity in man while such humanized antibodies at the same time maintain the specificity and binding affinity of the antibody of non-human origin.
[0051] The term “multispecific antibody” refers to an antibody having specificities for at least two different, such as at least three, typically non-overlapping, epitopes. Such epitopes may be on the same or on different target antigens. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types.
[0052] The term “bispecific antibody” refers to an antibody having specificities for two different, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types.
[0053] Examples of different classes of bispecific antibodies include but are not limited to (i) IgG-like molecules with complementary CH3 domains to force heterodimerization; (ii) recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; (iii) IgG fusion molecules, wherein full length IgG antibodies are fused to extra Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; (v) Fab fusion molecules, wherein different Fab-fragments are fused together, fused to heavy-chain constant-domains, Fc-regions or parts thereof; and (vi) ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, Nanobodies®) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, Nanobodies®) are fused to each other or to another protein or carrier molecule fused to heavy-chain constant-domains, Fc-regions or parts thereof.
[0054] Examples of IgG-like molecules with complementary CH3 domains molecules include but are not limited to the Triomab® (Trion Pharma/Fresenius Biotech), the Knobs-into-Holes (Genentech), CrossMAbs (Roche) and the electrostatically-matched (Amgen, Chugai, Oncomed), the LUZ-Y (Genentech, Wranik et al. J. Biol. Chem. 2012, 287(52): 43331-9, doi: 10.1074/jbc.M112.397869. Epub 2012 Nov. 1), DIG-body and PIG-body (Pharmabcine, WO2010134666, WO2014081202), the Strand Exchange Engineered Domain body (SEEDbody)(EMD Serono), the Biclonics (Merus, WO2013157953), FcΔAdp (Regeneron), bispecific IgG1 and IgG2 (Pfizer/Rinat), Azymetric scaffold (Zymeworks/Merck), mAb-Fv (Xencor), bivalent bispecific antibodies (Roche, WO2009080254) and DuoBody® molecules (Genmab).
[0055] Examples of recombinant IgG-like dual targeting molecules include but are not limited to Dual Targeting (DT)-Ig (GSK/Domantis, WO2009058383), Two-in-one Antibody (Genentech, Bostrom, et al 2009. Science 323, 1610-1614), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star), Zybodies™ (Zyngenia, LaFleur et al. MAbs. 2013 March-April; 5(2):208-18), approaches with common light chain, KABodies (NovImmune, WO2012023053) and CovX-body® (CovX/Pfizer, Doppalapudi, V. R., et al 2007. Bioorg. Med. Chem. Lett. 17,501-506).
[0056] Examples of IgG fusion molecules include but are not limited to Dual Variable Domain (DVD)-Ig (Abbott), Dual domain double head antibodies (Unilever; Sanofi Aventis), IgG-like Bispecific (ImClone/Eli Lilly, Lewis et al. Nat Biotechnol. 2014 February; 32(2):191-8), Ts2Ab (MedImmune/AZ, Dimasi et al. J Mol Biol. 2009 Oct. 30; 393(3):672-92) and BsAb (Zymogenetics, WO2010111625), HERCULES (Biogen Idec), scFv fusion (Novartis), scFv fusion (Changzhou Adam Biotech Inc) and TvAb (Roche).
[0057] Examples of Fc fusion molecules include but are not limited to ScFv/Fc Fusions (Academic Institution, Pearce et al Biochem Mol Biol Int. 1997 September; 42(6):1179), SCORPION (Emergent BioSolutions/Trubion, Blankenship J W, et al. AACR 100th Annual meeting 2009 (Abstract #5465); Zymogenetics/BMS, WO2010111625), Dual Affinity Retargeting Technology (Fc-DART™) (MacroGenics) and Dual(ScFv)2-Fab (National Research Center for Antibody Medicine—China).
[0058] Examples of Fab fusion bispecific antibodies include but are not limited to F(ab)2 (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock® (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech).
[0059] Examples of ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE®) (Micromet, Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DART™) (MacroGenics), Single-chain Diabody (Academic, Lawrence FEBS Lett. 1998 Apr. 3; 425(3):479-84), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack, WO2010059315) and COMBODY molecules (Epigen Biotech, Zhu et al. Immunol Cell Biol. 2010 August; 88(6):667-75), dual targeting Nanobodies® (Ablynx, Hmila et al., FASEB J. 2010), dual targeting heavy chain only domain antibodies.
[0060] In the context of antibody binding to an antigen, the terms “binds” or “specifically binds” refer to the binding of an antibody to a predetermined antigen or target (e.g. human PSMA or Vβ2) to which binding typically is with an affinity corresponding to a K.sub.D of about 10.sup.−6 M or less, e.g. 10.sup.−7 M or less, such as about 10.sup.−8 M or less, such as about 10.sup.−9 M or less, about 10.sup.−10 M or less, or about 10.sup.−11 M or even less, e.g. when determined using flow cytometry as described in the Examples herein. Alternatively, apparent K.sub.D values can be determined using for instance surface plasmon resonance (SPR) technology in a BIAcore T200 instrument using the antigen as the ligand and the binding moiety or binding molecule as the analyte. Specific binding means that the antibody binds to the predetermined antigen with an affinity corresponding to a K.sub.D that is at least ten-fold lower, such as at least 100-fold lower, for instance at least 1,000-fold lower, such as at least 10,000-fold lower, for instance at least 100,000-fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. The degree with which the affinity is lower is dependent on the K.sub.D of the binding moiety or binding molecule, so that when the K.sub.D of the binding moiety or binding molecule is very low (that is, the binding moiety or binding molecule is highly specific), then the degree with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000-fold. The term “K.sub.D” (M), as used herein, refers to the dissociation equilibrium constant of a particular interaction between the antigen and the binding moiety or binding molecule.
[0061] In the context of the present invention, “competition” or “able to compete” or “competes” refers to any detectably significant reduction in the propensity for a particular binding molecule (e.g. a PSMA antibody) to bind a particular binding partner (e.g. PSMA) in the presence of another molecule (e.g. a different PSMA antibody) that binds the binding partner. Typically, competition means an at least about 25 percent reduction, such as an at least about 50 percent, e.g. an at least about 75 percent, such as an at least 90 percent reduction in binding, caused by the presence of another molecule, such as an antibody, as determined by, e.g., ELISA analysis or flow cytometry using sufficient amounts of the two or more competing molecules, e.g. antibodies. Additional methods for determining binding specificity by competitive inhibition may be found in for instance Harlow et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Colligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc, and Wiley InterScience N. Y., (1992, 1993), and Muller, Meth. Enzymol. 92, 589-601 (1983)). In one embodiment, the antibody of the present invention binds to the same epitope on PSMA as antibody LV1050 and/or to the same epitope on Vδ2 as antibody 5C8 or 6H4. Methods for determining the epitope of a binding molecule, such as an antibody, are known in the art.
[0062] The terms “first” and “second” antigen-binding regions when used herein do not refer to their orientation/position in the antibody, i.e. they have no meaning with regard to the N- or C-terminus. The terms “first” and “second” only serve to correctly and consistently refer to the two different antigen-binding regions in the claims and the description.
[0063] “Capable of binding a Vγ9Vδ2-TCR” means that the binding molecule can bind a Vγ9Vδ2-TCR, but does not exclude that the binding molecule binds to one of the separate subunits in the absence of the other subunit, i.e. to the Vγ9 chain alone or to the Vδ2 chain alone. For example, antibody 5C8 is an antibody that binds the Vγ9Vδ2-TCR, but also binds the Vδ2 chain when the Vδ2 chain is expressed alone.
[0064] The term does also not exclude that the antibody is specific for the combination of the two chains.
[0065] “% sequence identity”, when used herein, refers to the number of identical nucleotide or amino acid positions shared by different sequences (i.e., % identity=# of identical positions/total # of positions×100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment. The percent identity between two nucleotide or amino acid sequences may e.g. be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci 4, 11-17 (1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
FURTHER ASPECTS AND EMBODIMENTS OF THE INVENTION
[0066] As described above, in a first main aspect, the invention relates to a multispecific antibody comprising a first antigen-binding region capable of binding human PSMA and a second antigen-binding region capable of binding a human Vγ9Vβ2 T cell receptor.
[0067] In one embodiment, the multispecific antibody is a bispecific antibody. In another embodiment, the first antigen-binding region is a single-domain antibody. In another embodiment, the second antigen-binding region is a single-domain antibody. In a further embodiment, both the first antigen-antigen binding region and the second antigen-binding region are single-domain antibodies. In a further embodiment, the multispecific antibody is a bispecific antibody, wherein the first antigen-binding region is a single-domain antibody and the second antigen-binding region is a single-domain antibody,
[0068] In one embodiment, the multispecific antibody competes (i.e. is able to compete) for binding to human PSMA with an antibody having the sequence set forth in SEQ ID NO:2, preferably the multispecific antibody binds the same epitope on human PSMA as an antibody having the sequence set forth in SEQ ID NO:2. In one embodiment, the multispecific antibody binds to an epitope on human PSMA which comprises one or more, or all, of the following amino acid residues: R190, S197, R204, S317, R320, S322, K324, H618, S631, K729, R730 and Y733, wherein numbering is according to UniProt sequence Q04609-1. In a further embodiment, the first antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:14, the VH CDR2 sequence set forth in SEQ ID NO: 15 and the VH CDR3 sequence set forth in SEQ ID NO:16.
[0069] In a further embodiment, the first antigen-binding region is humanized, wherein preferably the first antigen-binding region comprises or consists of: [0070] the sequence set forth in SEQ ID NO:2, or [0071] a sequence having at least 90%, such as least 92%, e.g. at least 94%, such as at least 96%, e.g. at least 98% sequence identity to the sequence set forth in SEQ ID NO:2.
[0072] As described above, the multispecific antibody of the invention comprises a second antigen-binding region capable of binding a human Vγ9Vβ2-T cell receptor. In one embodiment, the multispecific antibody is able to activate human Vγ9Vβ2 T cells. The activation of the Vγ9Vδ2 T cells may be measured through gene-expression and/or (surface) marker expression (e.g., activation markers, such as CD25, CD69, or CD107a) and/or secretory protein (e.g., cytokines or chemokines) profiles. In a preferred embodiment, the multispecific antibody is able to induce activation (e.g. upregulation of CD69 and/or CD25 expression) resulting in degranulation marked by an increase in CD107a expression (see e.g. Example 5) and/or cytokine production (e.g. TNFα, IFNγ) by Vγ9Vδ2 T cells. Preferably, a multispecific antibody of the present invention is able to increase the number of cells positive for CD107a at least 2-fold, such as at least 5-fold, when tested as described in Example 5 herein. In another preferred embodiment, the multispecific antibody of the invention has an EC50 value for increasing the percentage of CD107a positive cells of 50 pM or less, such as 25 pM or less, e.g. 20 pM or less, such as 15 pM or less, e.g. 10 pM or less, or even 5 pM or less, such as 2 pM or less or 1 pM or less when tested using Vγ9Vδ2 T cells and LNCaP target cells as described herein in Example 5.
[0073] In one embodiment of the multispecific antibody of the invention, the multispecific antibody is capable of binding to human Vβ2. Vδ2 is part of the delta chain of the Vγ9Vδ2-TCR. An antibody capable of binding to human Vβ2 may bind an epitope that is entirely located within the Vβ2 region or bind an epitope that is a combination of residues in Vβ2 region and the constant region of the delta chain. In another embodiment, the multispecific antibody is capable of binding to human Vγ9. Vγ9 is part of the gamma chain of Vγ9Vδ2-TCR. An antibody capable of binding to human Vγ9 may bind an epitope that is entirely located within the Vγ9 region or bind an epitope that is a combination of residues in Vγ9 region and the constant region of the gamma chain. Several such antibodies which bind to Vδ2 or Vγ9 have been described in WO2015156673 and their antigen-binding regions at least the CDR sequences thereof can be incorporated in the multispecific antibody of the invention. Other examples of antibodies from which a Vγ9Vδ2-TCR-binding region might be derived are TCR Vγ9 antibody 7A5 (ThermoFisher) (Oberg et al. (2014) Cancer Res 74:1349) and antibodies B1.1 (ThermoFisher) and 5A6.E9 (ATCC HB 9772), both described in Neuman et al. (2016) J Med Prim 45:139.
[0074] In one embodiment, the multispecific antibody competes for binding to human Vβ2 with an antibody having the sequence set forth in SEQ ID NO:5 or competes for binding to human Vβ2 with an antibody having the sequence set forth in SEQ ID NO:20. In a further embodiment, the multispecific antibody binds the same epitope on human Vβ2 as an antibody having the sequence set forth in SEQ ID NO:5 or binds the same epitope on human Vβ2 as an antibody having the sequence set forth in SEQ ID NO:20.
[0075] In one embodiment of the multispecific antibody of the invention, the second antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO: 17, the VH CDR2 sequence set forth in SEQ ID NO:18 and the VH CDR3 sequence set forth in SEQ ID NO: 19 or comprises the VH CDR1 sequence set forth in SEQ ID NO:21, the VH CDR2 sequence set forth in SEQ ID NO:22 and the VH CDR3 sequence set forth in SEQ ID NO:23.
[0076] In one embodiment of the multispecific antibody of the invention, the second antigen-binding region is humanized.
[0077] In a further embodiment, the second antigen-binding region comprises or consists of [0078] the sequence set forth in SEQ ID NO:5, or [0079] a sequence having at least 90%, such as least 92%, e.g. at least 94%, such as at least 96%, e.g. at least 98% sequence identity to the sequence set forth in SEQ ID NO:5.
[0080] In one embodiment of the multispecific antibody of the invention, the first antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO: 14, the VH CDR2 sequence set forth in SEQ ID NO:15 and the VH CDR3 sequence set forth in SEQ ID NO: 16 and wherein the second antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:17, the VH CDR2 sequence set forth in SEQ ID NO: 18 and the VH CDR3 sequence set forth in SEQ ID NO: 19.
[0081] In another embodiment of the multispecific antibody of the invention, the first antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO: 14, the VH CDR2 sequence set forth in SEQ ID NO:15 and the VH CDR3 sequence set forth in SEQ ID NO: 16 and wherein the second antigen-binding region comprises the VH CDR1 sequence set forth in SEQ ID NO:21, the VH CDR2 sequence set forth in SEQ ID NO:22 and the VH CDR3 sequence set forth in SEQ ID NO:23.
[0082] In one embodiment, the multispecific antibody of the invention is capable of mediating killing of PSMA-expressing cells, e.g. LNCaP cells, 22Rv1 cells or VCaP cells through activation of Vγ9Vδ2 T cells. Preferably, the antibody is capable of inducing killing of LNCaP cells through activation of Vγ9Vδ2 T cells with an EC50 value of 50 pM or less, such as 25 pM or less, e.g. 20 pM or less, such as 15 pM or less, e.g. 10 pM or less, or even 5 pM or less, such as 2 pM or less or 1 pM or less when tested as described in Example 6 herein.
[0083] In another embodiment, the antibody is capable of inducing killing of LNCaP, 22Rv1 or VCaP cells through activation of Vγ9Vδ2 T cells with an EC50 value of 50 pM or less, such as 25 pM or less, e.g. 20 pM or less, such as 15 pM or less when tested after 24 hours as described in Example 13 herein, preferably both at a 1:1 and a 1:10 effector to target cell ratio.
[0084] In another embodiment, the multispecific antibody of the invention is capable of binding to the PSMA positive prostate cancer cell line LNCaP with an EC50 of 50 nM or less, such as 20 nM or less, e.g. 10 nM of less, when tested as described in Example 7 herein. In another embodiment, the multispecific antibody of the invention is capable of binding to Vγ9Vδ2 T cells with an EC50 of 10 nM or less, such as 5 nM or less, e.g. 2 nM of less, when tested as described in Example 7 herein. In another embodiment, the multispecific antibody of the invention is capable of binding to recombinant human PSMA protein with a KD value of 100 nM or less, such as 50 nM or less, when tested as described in Example 11 herein. In another embodiment, the multispecific antibody of the invention is capable of binding to human Vγ9Vδ2-Fc with a KD value of 10 nM or less, such as 5 nM or less, e.g. 2 nM or less, such as 1 nM or less when tested as described in Example 11 herein.
[0085] In a further embodiment, the multispecific antibody is capable of mediating killing of human PSMA-expressing cells from a prostate cancer patient. Killing of human PSMA-expressing cells from a prostate cancer patient may e.g. be determined as described in Example 10 herein. In one embodiment, the multispecific antibody of the invention is capable of mediating specific cell death of more than 25%, such as more than 50%, at a concentration of 50 nM, as determined in the assays described in Example 10 or Example 14 herein.
[0086] In a further embodiment, the multispecific antibody is not capable of mediating killing of PSMA-negative cells, such as PSMA negative human cells. In another embodiment, the multispecific antibody does not induce IL-2, IL-4, IL-6, IL-10 or TNF a in whole blood from healthy donors at concentrations up to 280 nM, when tested as described in Example 16 herein. In another embodiment, the multispecific antibody induces more than 10-fold less IL-8 and/or more than 50-fold less IFNγ than Campath® in whole blood from healthy donors when tested as described in Example 16 herein.
[0087] In one embodiment, the first antigen-binding region and the second antigen-binding region are covalently linked to each other via a peptide linker, e.g. a linker having a length of from 1 to 20 amino acids, e.g. from 1 to 10 amino acids, such as 2, 3, 4, 5, 6, 7, 8 or 10 amino acids. In one embodiment, the peptide linker comprises or consists of the sequence GGGGS, set forth in SEQ ID NO:6.
[0088] In some embodiments, the first antigen-binding region capable of binding human PSMA is located N-terminally of the second antigen-binding region capable of binding a human Vγ9Vβ2 T cell receptor.
[0089] In one embodiment of the invention, the multispecific antibody further comprises a half-life extension domain. In one embodiment, the multispecific antibody has a terminal half-life that is longer than about 168 hours when administered to a human subject. Most preferably the terminal half-life is 336 hours or longer. The “terminal half-life” of an antibody, when used herein refers to the time taken for the serum concentration of the polypeptide to be reduced by 50%, in vivo in the final phase of elimination.
[0090] In one embodiment, the multispecific antibody comprises an Fc region. Various method for making bispecific antibodies have been described in the art, e.g. reviewed by Brinkmann and Kontermann (2017) MAbs 9:182. In one embodiment of the present invention, the Fc region is a heterodimer comprising two Fc polypeptides, wherein the first antigen-binding region is fused to the first Fc polypeptide and the second antigen-binding region is fused to the second Fc polypeptide and wherein the first and second Fc polypeptides comprise asymmetric amino acid mutations that favor the formation of heterodimers over the formation of homodimers (see e.g. Ridgway et al. (1996) ‘Knobs-into-holes’ engineering of antibody CH3 domains for heavy chain heterodimerization. Protein Eng 9:617). In a further embodiment hereof, the CH3 regions of the Fc polypeptides comprise said asymmetric amino acid mutations, preferably the first Fc polypeptide comprises a T366W substitution and the second Fc polypeptide comprises T366S, L368A and Y407V substitutions, or vice versa, wherein the amino acid positions correspond to human IgG1 according to the EU numbering system. In a further embodiment, the cysteine residues at position 220 in the first and second Fc polypeptides have been deleted or substituted, wherein the amino acid position corresponds to human IgG1 according to the EU numbering system. In a further embodiment, the region comprises the sequence set forth in SEQ ID NO:10.
[0091] In some embodiments, the first and/or second Fc polypeptides contain mutations that render the antibody inert, i.e. unable to mediate effector functions. In one embodiment, the first and second Fc polypeptides comprise a mutation at position 234 and/or 235, preferably the first and second Fc polypeptide comprise an L234F and an L235E substitution, wherein the amino acid positions correspond to human IgG1 according to the EU numbering system.
[0092] In a preferred embodiment, the first antigen-binding region comprises the sequence set forth in SEQ ID NO:2, the second antigen-binding region comprises the sequence set forth in SEQ ID NO:5 and [0093] the first Fc polypeptide comprises the sequence set forth in SEQ ID NO:12 and the second Fc polypeptide comprises the sequence set forth in SEQ ID NO:13, or [0094] the first Fc polypeptide comprises the sequence set forth in SEQ ID NO:12 and the second Fc polypeptide comprises the sequence set forth in SEQ ID NO: 13.
[0095] In a further embodiment, the antibody comprises or consists of the sequences set forth in SEQ ID NO:25 and SEQ ID NO:26.
[0096] In a further main aspect, the invention relates to a pharmaceutical composition comprising a multispecific antibody according to the invention as described herein and a pharmaceutically-acceptable excipient.
[0097] Antibodies may be formulated with pharmaceutically-acceptable excipients in accordance with conventional techniques such as those disclosed in (Rowe et al., Handbook of Pharmaceutical Excipients, 2012 June, ISBN 9780857110275). The pharmaceutically-acceptable excipient as well as any other carriers, diluents or adjuvants should be suitable for the antibodies and the chosen mode of administration. Suitability for excipients and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen antibody or pharmaceutical composition of the present invention (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.) upon antigen binding).
[0098] A pharmaceutical composition may include diluents, fillers, salts, buffers, detergents (e.g., a nonionic detergent, such as Tween-20 or Tween-80), stabilizers (e.g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition. Further pharmaceutically-acceptable excipients include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption-delaying agents and the like that are physiologically compatible with an antibody of the present invention.
[0099] In one embodiment, the pharmaceutical composition comprises a multispecific antibody of the invention (preferably an antibody comprising an Fc region), a buffer and an antioxidant, wherein the pH of the composition is between 5.4 and 7.4, such as between 5.4 and 6.1.
[0100] In a further embodiment, the pharmaceutical composition comprises a multispecific antibody of the invention, a buffer and methionine, wherein the pH of the composition is between 5.4 and 7.4, such as between 5.4 and 6.1.
[0101] In a further embodiment, the pharmaceutical composition comprises a multispecific antibody of the invention, a buffer, sucrose, polysorbate 80 and methionine, wherein the pH of the composition is between 5.4 and 7.4, such as between 5.4 and 6.1.
[0102] In a further embodiment, the pharmaceutical composition comprises a multispecific antibody of the invention, a histidine or sodium acetate buffer, sucrose, polysorbate 80 and methionine, wherein the pH of the composition is between 5.4 and 7.4, such as between 5.4 and 6.1.
[0103] Preferably, the buffer concentration is between 5 and 25 mM, such as 10 mM. Preferably, the sucrose concentration is between 100 and 500 mM, such as between 250 mM and 300 mM, e.g. 280 mM. Preferably, the polysorbate 80 concentration is between 0.005% and 0.1%, such between 0.01% and 0.05%, e.g. 0.02%. Preferably, the methionine concentration is between 0.2 mM and 5 mM, such between 0.5 mM and 2 mM, e.g. 1 mM. Preferably, the multispecific antibody in the composition comprises an Fc region.
[0104] Thus, in a preferred embodiment, the pharmaceutical composition comprises a multispecific antibody of the invention comprising an Fc region, a histidine or sodium acetate buffer, sucrose, polysorbate 80 and methionine, wherein the pH of the composition is between 5.4 and 7.4, such as between 5.4 and 6.1.
[0105] Thus, in a further preferred embodiment, the pharmaceutical composition comprises a multispecific antibody of the invention comprising an Fc region, a 10 M histidine or sodium acetate buffer, 280 mM sucrose, 0.02% polysorbate 80 and 1 mM methionine, wherein the pH of the composition is 5.5 or 6.0.
[0106] Preferably, such as Fc region is a heterodimer comprising two Fc polypeptides, wherein the first antigen-binding region is fused to the first Fc polypeptide and the second antigen-binding region is fused to the second Fc polypeptide and wherein the first and second Fc polypeptides comprise asymmetric amino acid mutations that favor the formation of heterodimers over the formation of homodimers. Preferably, the CH3 regions of the Fc polypeptides comprise said asymmetric amino acid mutations, wherein preferably the first Fc polypeptide comprises a T366W substitution and the second Fc polypeptide comprises T366S, L368A and Y407V substitutions, or vice versa. Furthermore, preferably, the cysteine residues at position 220 in the first and second Fc polypeptides have been deleted or substituted and/or the first and second Fc polypeptides further comprise a mutation at position 234 and/or 235, wherein preferably the first and second Fc polypeptide comprise an L234F and an L235E substitution.
[0107] Furthermore, preferably, the multispecific antibody in the composition comprises a first antigen-binding region comprising the sequence set forth in SEQ ID NO:2, a second antigen-binding region comprising the sequence set forth in SEQ ID NO:5 and [0108] the first Fc polypeptide comprises the sequence set forth in SEQ ID NO: 12 and the second Fc polypeptide comprises the sequence set forth in SEQ ID NO: 13, or [0109] the first Fc polypeptide comprises the sequence set forth in SEQ ID NO: 12 and the second Fc polypeptide comprises the sequence set forth in SEQ ID NO: 13 and the pharmaceutical composition comprises a 10 M histidine or sodium acetate buffer, 280 mM sucrose, 0.02% polysorbate 80 and 1 mM methionine, wherein the pH of the composition is 5.5 or 6.0. Preferably, the antibody concentration is between 0.1 mg/ml and 20 mg/ml, such as between 0.1 and 10 mg/ml, for example between 0.5 mg/ml and 2 mg/ml, such as 1 mg/ml.
[0110] In a further main aspect, the invention relates to the multispecific antibody according to the invention as described herein for use as a medicament.
[0111] A multispecific antibody according to the invention enables creating a microenvironment that is beneficial for killing of tumor cells, in particular PSMA-positive tumor cells, by Vγ9Vδ2 T cells.
[0112] Accordingly, in a preferred embodiment, the multispecific antibody is for use in the treatment of cancer. In a further preferred embodiment, the multispecific antibody is for use in the treatment of prostate cancer, such as metastatic or non-metastatic prostate cancer. In another embodiment, the multispecific antibody is for use in the treatment of cancers in which PSMA is expressed on the tumor neo-vasculature or tumor-associated endothelial cells of primary or metastatic tumors including from colorectal cancer, lung cancer, breast cancer, endometrial and ovarian cancer, gastric cancer, renal cell cancer, urothelial cancer, hepatocellular cancer, oral squamous cancer, thyroid tumors and glioblastomas. In another embodiment, the multispecific antibody is for use in the treatment of adenoid cystic carcinoma of the head and neck.
[0113] Similarly, the invention relates to a method of treating a disease comprising administration of a multispecific antibody according to the invention as described herein to a human subject in need thereof. In one embodiment, the disease is cancer, such as prostate cancer, e.g. metastatic or non-metastatic prostate cancer.
[0114] In some embodiments, the antibody is administered as monotherapy. However, antibodies of the present invention may also be administered in combination therapy, i.e., combined with other therapeutic agents relevant for the disease or condition to be treated.
[0115] “Treatment” or “treating” refers to the administration of an effective amount of an antibody according to the present invention with the purpose of easing, ameliorating, arresting, eradicating (curing) or preventing symptoms or disease states. An “effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. An effective amount of a polypeptide, such as an antibody, may vary according to factors such as the disease stage, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual. An effective amount is also one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects. An exemplary, non-limiting range for an effective amount of an antibody of the present invention is about 0.1 μg/kg to 100 mg/kg, such as about 1 μg/kg to 50 mg/kg, for example about 0.01 to 20 mg/kg, such as about 0.1 to 10 mg/kg, for instance about 0.5, about 0.3, about 1, about 3, about 5, or about 8 mg/kg. Administration may be carried out by any suitable route, but will typically be parenteral, such as intravenous, intramuscular or subcutaneous.
[0116] Multispecific antibodies of the invention are typically produced recombinantly, i.e. by expression of nucleic acid constructs encoding the antibodies in suitable host cells, followed by purification of the produced recombinant antibody from the cell culture. Nucleic acid constructs can be produced by standard molecular biological techniques well-known in the art. The constructs are typically introduced into the host cell using an expression vector. Suitable nucleic acid constructs and expression vectors are known in the art. Host cells suitable for the recombinant expression of antibodies are well-known in the art, and include CHO, HEK-293, Expi293F, PER-C6, NS/0 and Sp2/0 cells.
[0117] Accordingly, in a further aspect, the invention relates to a nucleic acid construct encoding a multispecific antibody according to the invention. In one embodiment, the construct is a DNA construct. In another embodiment, the construct is an RNA construct.
[0118] In a further aspect, the invention relates to an expression vector comprising a nucleic acid construct encoding a multispecific antibody according to the invention.
[0119] In a further aspect, the invention relates to a host cell, i.e. a recombinant host cell, such as a mammalian host cell, preferably a CHO cell comprising one or more nucleic acid constructs encoding a multispecific antibody according to the invention or an expression vector comprising a nucleic acid construct encoding a multispecific antibody according to the invention.
[0120] Accordingly, in a further aspect, the invention relates to production of a multispecific antibody of the invention, preferably a multispecific antibody of the invention comprising an Fc region, by (co-)expression of one or more nucleic acid constructs encoding the multispecific antibody in a suitable host cell, such as a mammalian host cell, e.g. a CHO cell, followed by purification of the produced recombinant antibody from the cell culture or the supernatant after removal of the cells.
TABLE-US-00004 TABLE 1 Sequence listing. SEQ ID. code Description Sequence 1 LV1044- VHH EVQLVESGGGLVQPGGSLTLSCAASRFMISEYSMH JVZ007 WVRQAPGKGLEWVSTINPAGTTDYAESVKGRFTIS RDNAKNTLYLQMNSLKPEDTAVYYCDGYGYRGQG TQVSS 2 LV1050 VHH EVQLVESGGGLVQPGGSLRLSCAASRFMISEYSMH WVRQAPGKGLEWVSTINPAGTTDYADSVKGRFTI SRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGQ GTQVTVSS 3 LV1051 VHH EVQLVESGGGSVQPGGSLRLSCAASRFMISEYSM HWVRQAPGKGLEWVSTINPAGTTDYADSVKGRFT ISRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGL GTQVTVSS 4 5C8 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYAM GWFRQAPGKEREFVAAISWSGGSTSYADSVKGRF TISRDNAKNTVYLQMNSPKPEDTAIYYCAAQFSGA DYGFGRLGIRGYEYDYWGQGTQVTVSS 5 5C8var1 VHH EVQLLESGGGSVQPGGSLRLSCAASGRPFSNYAM SWFRQAPGKEREFVSAISWSGGSTSYADSVKGRF TISRDNSKNTLYLQMNSLRAEDTAVYYCAAQFSGA DYGFGRLGIRGYEYDYWGQGTQVTVSS 6 linker GGGGS 7 LV1044- Bispecific Ab EVQLVESGGGLVQPGGSLTLSCAASRFMISEYSMH 5C8 WVRQAPGKGLEWVSTINPAGTTDYAESVKGRFTIS RDNAKNTLYLQMNSLKPEDTAVYYCDGYGYRGQG TQVTVSSGGGGSEVQLVESGGGLVQAGGSLRLSC AASGRPFSNYAMGWFRQAPGKEREFVAAISWSGG STSYADSVKGRFTISRDNAKNTVYLQMNSPKPEDT AIYYCAAQFSGADYGFGRLGIRGYEYDYWGQGTQ VTVSS 8 LV1050- Bispecific Ab EVQLVESGGGLVQPGGSLRLSCAASRFMISEYSMH 5C8var1 WVRQAPGKGLEWVSTINPAGTTDYADSVKGRFTI SRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGQ GTQVTVSSGGGGSEVQLLESGGGSVQPGGSLRLS CAASGRPFSNYAMSWFRQAPGKEREFVSAISWSG GSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAED TAVYYCAAQFSGADYGFGRLGIRGYEYDYWGQGT QVTVSSAAAEPEA 9 LV1051- Bispecific Ab EVQLVESGGGSVQPGGSLRLSCAASRFMISEYSM 5C8var1 HWVRQAPGKGLEWVSTINPAGTTDYADSVKGRFT ISRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGL GTQVTVSSGGGGSEVQLLESGGGSVQPGGSLRLS CAASGRPFSNYAMSWFRQAPGKEREFVSAISWSG GSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAED TAVYYCAAQFSGADYGFGRLGIRGYEYDYWGQGT QVTVSSAAAEPEA 10 Modified AAASDKTHTCPPCP hinge region sequence 11 wtIgG1 CH2 and CH3 APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV (G1m17, SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY G1m(z) RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT allotype) ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPG 12 IgG1 Heavy chain AAASDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLM L234F region ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN L235E constant AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK T366W variant CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG 13 IgG1 Heavy chain AAASDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLM L234F constant ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN L235E region AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK T366S variant CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD L368A ELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENN Y407V YKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG 14 LV1050 CDR1 RFMISEYSMH 15 LV1050 CDR2 TINPAGTTDYADSVKG 16 LV1050 CDR3 DGYGY 17 5C8var1 CDR1 NYAMS 18 5C8var1 CDR2 AISWSGGSTSYADSVKG 19 5C8var1 CDR3 QFSGADYGFGRLGIRGYEYDY 20 6H4 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGM GWFRQAPGKKREFVAGISWSGGSTDYADSVKGR FTISRDNAKNTVYLQMNSLKPEDTAVYYCAAVFSG AETAYYPSDDYDYWGQGTQVTVSS 21 6H4 CDR1 GRPFSNYGMG 22 6H4 CDR2 GISWSGGSTDYADSVKG 23 6H4 CDR3 VFSGAETAYYPSDDYDY 24 PSMA MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLL GFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIK KFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLD SVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSL FEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNY ARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKV KNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLP GGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIA EAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSW RGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVT RIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDP QSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDA EEFGLLGSTEWAEENSRLLQERGVAYINADSSIEG NYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLY ESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLG IASGRARYTKNWETNKFSGYPLYHSVYETYELVEKF YDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSA VKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMF LERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFP GIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQA AAETLSEVA 25 5C8var1 EVQLLESGGGSVQPGGSLRLSCAASGRPFSNYAM Fc SWFRQAPGKEREFVSAISWSGGSTSYADSVKGRF L234F TISRDNSKNTLYLQMNSLRAEDTAVYYCAAQFSGA L235E DYGFGRLGIRGYEYDYWGQGTQVTVSSAAASDKT T366W HTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPG 26 LV1050 EVQLVESGGGLVQPGGSLRLSCAASRFMISEYSMH Fc WVRQAPGKGLEWVSTINPAGTTDYADSVKGRFTI L234F SRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGQ L235E GTQVTVSSAAASDKTHTCPPCPAPEFEGGPSVFLF T366S PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY L368A VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD Y407V WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG 27 5C8var1 EVQLLESGGGSVQPGGSLRLSCAASGRPFSNYAM Fc SWFRQAPGKEREFVSAISWSGGSTSYADSVKGRF L234F TISRDNSKNTLYLQMNSLRAEDTAVYYCAAQFSGA L235E DYGFGRLGIRGYEYDYWGQGTQVTVSSAAASDKT T366W HTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK 28 LV1050 EVQLVESGGGLVQPGGSLRLSCAASRFMISEYSMH Fc WVRQAPGKGLEWVSTINPAGTTDYADSVKGRFTI L234F SRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGQ L235E GTQVTVSSAAASDKTHTCPPCPAPEFEGGPSVFLF T366S PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY L368A VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD Y407V WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK 29 LV1050- EVQLVESGGGLVQPGGSLRLSCAASRFMISEYSMH 5C8var1 WVRQAPGKGLEWVSTINPAGTTDYADSVKGRFTI -no-c- SRDNAKNTLYLQMNSLRAEDTAVYYCDGYGYRGQ tag GTQVTVSSGGGGSEVQLLESGGGSVQPGGSLRLS CAASGRPFSNYAMSWFRQAPGKEREFVSAISWSG GSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAED TAVYYCAAQFSGADYGFGRLGIRGYEYDYWGQGT QVTVSS 30 PSMA MARPLCTLLLLMATLAGALAGSHHHHHHGSKSSN var EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLA GTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLS YPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVS DIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERD MKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVI LYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILN LNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHP IGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVG PGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGA VEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIV RSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEW AEENSRLLQERGVAYINADSSIEGNYTLRVDCTPL MYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSP EFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTK NWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLT VAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADK IYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKF SERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGL PDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIES KVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA 31 huVdelta2 MQRISSLIHLSLFWAGVMSAIELVPEHQTVPVSIGV ECD- PATLRCSMKGEAIGNYYINWYRKTQGNTMTFIYRE Fc KDIYGPGFKDNFQGDIDIAKNLAVLKILAPSERDEG (hole)- SYYCACDTLGMGGEYTDKLIFGKGTRVTVEPRSQP His HTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKK ITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQH DNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKS CHKPKAIVHTEKVNMMSLTAAASDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLSCAVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLV SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGHHHHHH 32 huVgamma9 MLSLLHASTLAVLGALCVYGAGHLEQPQISSTKTLS ECD-Fc KTARLECVVSGITISATSVYWYRERPGEVIQFLVSI (knob)- SYDGTVRKESGIPSGKFEVDRIPETSTSTLTIHNVE C-tag KQDIATYYCALWEAQQELGKKIKVFGPGTKLIITDK QLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFP DVIKIHWEEKKSNTILGSQEGNTMKTNDTYMKFS WLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIK TDVITMDPKDNCSKDANDTLLLQLTNTSAAAASDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGAAAEPEA
EXAMPLES
Example 1: PBMC Isolation and Generation of Human Donor-Derived Vγ9Vβ2-T Cell Cultures
[0121] Whole blood was collected from healthy donor volunteers. Alternatively, buffy coats were obtained from blood supply service Sanquin and used for isolation of peripheral blood mononuclear cells (PBMC). PBMC were isolated using Lymphoprep™ density gradient centrifugation. Vγ9Vδ2-T cells were then isolated from healthy donor PBMC by magnetic-activated cell sorting (MACS) using a FITC-labeled anti-TCR Vδ2 mouse monoclonal antibody (Mab) in combination with goat anti-mouse IgG microbeads. Purified Vγ9Vδ2-T cells were stimulated every seven days with a feeder cell mix consisting of irradiated PBMC from two healthy donors and an Epstein Barr Virus transformed B cell line (JY) resuspended in Roswell Park Memorial Institute (RPMI) medium supplemented with 10 IU/mL IL-7, 10 ng/mL IL-15 and 50 ng/ml PHA. Expanded Vγ9Vδ2-T cell cultures were always tested for purity before being used for experiments and always found to be >95% Vγ9 and Vδ2 double positive.
Example 2: Humanization of the Anti-PSMA VHH JVZ-007 and Anti-Vγ9Vβ2 VHH 5C8
[0122] The amino acid sequence of the camelid-derived anti-PSMA VHH JVZ-007 (LV1044; SEQ ID NO:1) (J Nucl Med. 2015 July; 56(7):1094-9, supplemental data) was aligned to the human V gene database and the closest human germline match was found to be IGHV3-74*01. Based on sequence differences in the framework regions between the human and llama-derived sequence, two humanized variants (SEQ ID NO:2-3) were designed, see alignment in
[0123] JVZ-007 and these two mutants were then combined with anti-Vγ9Vδ2 VHH 5C8 (a Vδ2 binding antibody described in WO2015156673) (SEQ ID NO:4) or 5C8var1, a humanized variant of 5C8 (SEQ ID NO:5), in bispecific VHH format: anti-PSMA VHH-linker-anti Vγ9Vδ2 VHH. The sequence of the linker was GGGGS (SEQ ID NO:6). A C-terminal C-tag (EPEA sequence) preceded by three alanine residues was in some constructs added for purification and detection purposes. The sequences of the resulting constructs are set forth in SEQ ID NO:7-9.
Example 3: Design of a Half-Life Extended Version of the Bispecific VHH Format
[0124] A half-life extended version of the bispecific VHH format was designed, based on an Fc-containing format. VHH sequences were coupled to a slightly modified human IgG1 hinge region: Amino acid residues 216-230 (EU numbering) were changed to AAASDKTHTCPPCP (SEQ ID NO: 10). This omits the cysteine that normally bridges to the other heavy chain and replaces the ‘EPK’ upper hinge sequence with three alanines. This modified hinge was coupled to an IgG1 (G1m17, G1m(z) allotype sequence)-CH2 and -CH3 sequences (SEQ ID NO:11). The CH2 sequence was modified to contain Fc silencing mutations (L234F, L235E) and the CH3 sequence was modified to either contain a ‘knob’ mutation (T366W) (SEQ ID NO:12), or three mutations that create a ‘hole’ (T366S, L368A and Y407V) (SEQ ID NO: 13). This knob-into-hole (KiH) technology induces the preferential hetero-dimerization of the two chains. The resulting construct is schematically depicted in
Example 4: Cloning, Expression and Purification of Bispecific VHH Molecules and Fc-Containing Constructs
[0125] Amino acid sequences of bispecific VHH molecules were reverse-translated to cDNA and then codon-optimized for expression in human cells. Regulatory elements were added: an N-terminal Kozak sequence and C-terminal stop codon (including BamH1 and Not1 restriction sites for cloning) and the cDNA was made as a synthetic gene. cDNAs were cloned into a suitable vector and their sequences were verified. Expression of the proteins was performed by transient transfection of the resulting plasmids in HEK293_E cells. Proteins were purified from the culture supernatant by means of protein-A affinity chromatography and preparative size-exclusion chromatography.
[0126] The amino acid sequences of the two protein chains of Fc-containing constructs were reverse-translated into the encoding cDNA, necessary regulatory elements were added (Kozak sequence, stop codon and cloning sites BamH1 and Not1) and the cDNAs were codon-optimized for expression. The cDNAs were made by synthetic gene synthesis and expression plasmids encoding either of the two protein chains were made by cloning the cDNAs separately into a suitable vector. The resulting plasmids were sequence-verified and then used to transfect CHO cells grown in suspension using different ratios of the two plasmids (1:2, 1:1 and 2:1). Secreted proteins were purified from the culture supernatant using protein-A affinity chromatography and were buffer-exchanged to PBS. Proteins were further purified by preparative size-exclusion chromatography.
Example 5: Testing of Humanization Variants of Anti-PSMA VHH JVZ-007
[0127] Purified bispecific VHHs containing the humanization variants were tested for their ability to induce target-dependent T cell activation in a 4-hour degranulation assay. Vγ9Vδ2 T cells were isolated from PBMC by means of magnetic activated cell sorting (MACS) and expanded as described in Example 1. Expanded Vγ9Vδ2 T cells used for experiments were always checked for purity and found to be >95% double positive for Vγ9- and Vδ2 staining in FACS. Purified, expanded Vγ9Vδ2 T cells were incubated with the same number of PSMA-positive LNCaP (ATCC, cat. Nr. CRL-1740) target cells (effector: target (E:T) cell ratio of 1:1) and a concentration range of bispecific construct. After 4 hours of incubation, the percentage of T cells expressing CD107a was determined by staining in FACS.
[0128]
Example 6: Cytotoxicity Mediated by Bispecific VHH and Fc-Containing Counterpart
[0129] The two VHH sequences of bispecific VHH LV1050-5C8var1 were re-formatted into a half-life extended molecule containing a human IgG1 Fc as described above, resulting in the constructs set forth in SEQ ID NO:25 and SEQ ID NO:26 (5C8var1-Fc and LV1050-Fc).
[0130] Both the bispecific VHH construct LV1050-5C8var1 and the Fc-containing counterpart 5C8var1-Fc x LV1050-Fc (also termed LV1050-Fc x 5C8var1 herein) were tested for their ability to induce cytotoxicity of LNCaP cells through activation of Vγ9Vδ2 T cells.
[0131]
Example 7: Binding of LV1050-Fc x 5C8var1-Fc to Target Positive Cells in FACS
[0132] Bispecific Fc-containing construct 5C8var1-Fc x LV1050-Fc cloned, expressed and purified as described above. To test the binding of the molecule to PSMA, a concentration range of antibody was tested for binding to the PSMA positive prostate cancer cell line LNCaP and to the antigen negative cell line PC-3. Detection was performed with a polyclonal anti-human IgG antibody.
[0133] To test the binding of LV1050-Fc x 5C8var1-Fc to Vγ9Vδ2 T cells, a concentration range of the compound (100 nM and a half-log dilution thereof) was tested for binding in FACS staining using detection with two different monoclonal antibodies directed towards VHH (45H8 and 96A3F5; Genscript, cat. Nrs CP001/18L001614 and A01994 respectively).
[0134]
Example 8: Lead Bispecific Antibody LV1050-Fc x 5C8var1-Fc Induces Potent Target-Dependent T Cell Activation and Target Cell Lysis
[0135] To measure the potency of the bispecific T cell engager, target-positive LNCaP cells were incubated with a concentration range of the molecule and a fixed number of Vγ9Vδ2 T cells (effector:target ratio of 1:1). T cell activation was then measured by staining in FACS for CD107a expression on the T cells after four hours of incubation. Cytotoxicity was measured after 24 hours by measuring the number of viable cells in FACS (7AAD staining).
Example 9: Frequency Vγ9Vβ2-T Cells and Expression of Ligands in Patient-Derived Tumor and Normal Tissue
[0136] Prostate tumor tissue was obtained after radical prostatectomy from patients with non-metastatic prostate cancer. Both macroscopically normal tissue, as well as tumor tissue was analyzed. Tissue was cut into small pieces with a surgical blade and resuspended in dissociation medium composed of Iscove Modified Dulbecco Medium (IMDM) supplemented with 0.1% DNAse I (Roche), 0.14% Collagenase A, 100 IU/mL sodium penicillin/100 μg/mL streptomycin sulphate/2.0 mM L glutamine and 5% FCS. The tissue pieces were transferred to a sterile flask and incubated on a magnetic stirrer for 45 minutes at 37 degrees. After this incubation, the cell suspension was run through a 100 μM cell strainer. Tumor tissue was dissociated three times and normal tissue twice in total, after which cells were washed and prepared for viable cell count using trypan blue exclusion. Dissociated tumor- and normal tissues were analyzed for the presence of Vγ9Vδ2-T cells using staining in FACS with AF700 labeled anti-CD45 Mab, PerCP-Cy5.5 labeled anti-CD3 mAb, APC labeled anti-TCR Vγ9 mAb and BV711 labeled anti-TCR Vδ2 mAb. Expression of the targets EpCAM, PSMA and CD277 on tumor- and normal cells was determined using BV421 labeled anti-EpCAM Mab, FITC labeled anti-PSMA Mab and PE labeled anti-CD277 Mab.
[0137]
Example 10: Functional Analysis of LV1044-5C8 Using Patient-Derived Target Cells
[0138] To determine the potential of the bispecific constructs to mediate cytotoxicity Vγ9Vδ2-T cells against patient-derived target cells, dissociated tumor- and normal cell suspensions were incubated for 24 hours at 37° C. with or without 50 nM of compound and Vγ9Vδ2-T cell cultures in a 1:1 effector:target (E:T) ratio. The number of living target cells was determined using the life-death marker 7AAD and 123 count eBeads.
[0139]
Example 11: Affinity Determination LV1050-Fc x 5C8var1-Fc for Human PSMA and Vγ9Vβ2 TCR Using Biolayer Interferometry
[0140] The affinities of LV1050-Fc x 5C8var1-Fc for recombinant human PSMA and human Vγ9Vδ2 TCR were determined using biolayer interferometry (BLI). As ligand, 12.5 μg/mL biotinylated hPSMA or 5 μg/mL hVγ9Vδ2-Fc (consisting of SEQ ID NO:31 and 32) were loaded onto streptavidin biosensors. As analyte, two-fold serial dilutions of LV1050-Fc x 5C8var1-Fc were used: ranging from 3.125 to 200 nM in combination with ligand hPSMA; ranging from 0.03125 to 20 nM in combination with ligand hVγ9Vδ2-Fc. As shown in the Table 2, LV1050-Fc x 5C8var1-Fc binds with a K.sub.D value of 32±1.2 nM to human PSMA, and with a K.sub.D of 0.64±0.16 nM to the human Vγ9Vδ2 TCR.
TABLE-US-00005 TABLE 2 Affinity determination LV1050-Fc × 5C8var1-Fc for human PSMA and Vγ9Vδ2 TCR using biolayer interferometry K.sub.D (M) k.sub.on (1/Ms) k.sub.dis (1/s) Ligand mean SD k.sub.on (1/Ms) SD k.sub.dis (1/s) SD PSMA (n = 3) 3.16E−08 1.24E−09 3.07E+05 7.41E+03 9.69E−03 4.73E−04 Vγ9Vδ2 6.35E−10 1.60E−10 2.40E+05 8.64E+03 1.51E−04 3.40E−05 TCR (n = 4)
Example 12: Epitope Mapping
[0141] To determine the epitope on PSMA bound by the VHH incorporated in LV1050-Fc x 5C8var1-Fc, LV1050-5C8var1-no-c-tag (SEQ ID NO:29) (containing the identical PSMA binding VHH domain as LV1050-Fc x 5C8var1-Fc) was used in the epitope mapping technology developed by CovalX AG (Pimenova et al. (2008) J Mass Spectrom 43:185). In short, a recombinant, PSMA protein (SEQ ID NO: 30) was allowed to bind to LV1050-5C8var1-no-c-tag, cross-linked, exposed to different proteases and the resulting peptides, cross-linked or not, were analyzed by high-resolution mass spectrometry.
[0142] The results demonstrated the VHH to bind a conformational epitope which is shown in
Example 13: Further Functional Analysis of LV1050-Fc x 5C8var1-Fc Using Tumor Derived Cell Lines
[0143] The ability of LV1050-Fc x 5C8var1-Fc to induce PSMA-dependent Vγ9Vδ2-T cell activation was determined in a 4-hour in vitro assay using expression of the degranulation marker CD107a (LAMP-1) as read-out. Expanded Vγ9Vδ2 T cells isolated from PBMCs from healthy donors were cultured with PSMA-expressing prostate-derived cancer cell lines LNCaP, VCaP or 22Rv1 in a 1:1 effector: target cell ratio, in the absence or presence of different concentrations of LV1050-Fc x 5C8var1-Fc (ranging from 10 fM to 3.16 nM). Cells were harvested and the cell surface expression of CD107a was determined by flow cytometry. In the presence of all PSMA expressing tumor cell lines, LV1050-Fc x 5C8var1-Fc induced very potent Vγ9Vδ2-T cell activation (
TABLE-US-00006 TABLE 3 EC.sub.50 values of Vγ9Vδ2-T cell degranulation and Vγ9Vδ2-T cell mediated tumor cell cytotoxicity with LV1050-Fc × 5C8var1-Fc in in vitro assays using Vγ9Vδ2-T cells and PSMA positive tumor cell lines Target Tested Mean EC.sub.50 Number of Effector cell range E:T (nM) donors (n) and cells line (nM) ratio (±SD) experiments Degranulation after 4 hours Vγ9Vδ2-T LNCaP 3.2- 1:1 0.016 n = 10 (10 cells 0.000010 (0.0049) donors in 5 exp) Vγ9Vδ2-T 22Rv1 3.2- 1:1 0.029 n = 4 (4 cells 0.000032 (0.0049) donors in 2 exp) Vγ9Vδ2-T VCaP 3.2- 1:1 0.028 n = 4 (4 cells 0.000032 (0.0064) donors in 2 exp) Cytotoxicity after 24 hours Vγ9Vδ2-T LNCaP 3.2- 1:1 0.017 n = 10 (10 cells 0.000010 (0.013) donors in 7 exp, 4 donors tested twice) Vγ9Vδ2-T 22Rv1 3.2- 1:1 0.013 n = 4 (4 cells 0.000032 (0.0069) donors in 2 exp) Vγ9Vδ2-T VCaP 3.2- 1:1 0.015 n = 3 (3 cells 0.000032 (0.011) donors in 2 exp)
[0144] Next, the capacity of LV1050-Fc x 5C8var1-Fc to induce target-dependent, Vγ9Vδ2-T cell-mediated tumor cell killing was determined in the same co-cultures at 24 hours, using a luminescence assay to quantify the release of an intracellular protease from dying/dead tumor cells (CytoTox-Glo™ Cytotoxicity Assay, Promega). LV1050-Fc x 5C8var1-Fc induced strong, target-dependent and Vγ9Vδ2-T cell-mediated cytotoxicity of LNCaP, VCaP and 22Rv1 cells (
[0145] In addition, Vγ9Vδ2-T cells were not activated by LV1050-Fc x 5C8var1-Fc alone (in the absence of tumor cells), neither was lysis observed of tumor cells in which PSMA expression was abrogated (LNCaP.koPSMA)(
[0146] To study the effect of different E:T ratios on the potency of LV1050-Fc x 5C8var1-Fc (concentration range tested: 10 fM to 3.2 nM), the number of target LNCaP cells was kept constant (i.e. 50,000) in a 24-hour cytotoxicity assay, while the number of effector Vγ9Vδ2-T cells was varied to obtain different E:T ratios (1:1, 1:10 and 1:100). As shown in Table 4, mean EC.sub.50 values for Vγ9Vδ2-T cell-mediated cytotoxicity induced by LV1050-Fc x 5C8var1-Fc were comparable between E:T ratio 1:1 and 1:10 (17±13 pM and 9.9±6.5 pM, respectively), while at the E:T ratio of 1:100, the level of cytotoxicity observed was too low to accurately calculate an EC.sub.50 value. Even though the potency (EC.sub.50) of LV1050-Fc x 5C8var1-Fc in the assay was not affected, the maximum percentage of lysis observed was significantly lowered in the E:T ratio 1:10 compared to 1:1 E:T ratio (data not shown). Thus, the potency (i.e. EC.sub.50 measured in the assay) of LV1050-Fc x 5C8var1-Fc is not strongly affected by varying E:T ratios.
TABLE-US-00007 TABLE 4 EC.sub.20, EC.sub.50 and EC.sub.90 values of Vγ9Vδ2-T cell cytotoxicity mediated by LV1050-Fc × 5C8var1-Fc using different E:T ratios. Mean Mean Mean Number of E:T EC20 ± EC50 EC90 ± donors (n) ratio SD (pM) SD (pM) SD (pM) and experiments 1:1 4.3 ± 3.0 17 ± 13 79 ± 48 n = 10 (10 donors in 7 expts, 4 donors tested twice) 1:10 3.6 ± 1.3 9.9 ± 6.5 60 ± 59 n = 4 (4 donors in 2 expts)
Example 14: Functional Analysis of LV1050-Fc x 5C8var1-Fc Using Patient-Derived Target Cells
[0147] Patient-derived non-metastatic prostate cancer tissue was obtained and normal (non-malignant) and tumor tissue were processed as described in Example 9.
[0148] As a measure of activation of Vγ9Vδ2-T cells, upregulation of the degranulation marker CD107a (LAMP-1; detected using PE-labeled anti-human CD107a, Thermofisher) on Vγ9Vδ2-T cells present in the dissociated prostate samples (0.5-1×10.sup.5 dissociated cells from normal (non-malignant) or primary tumor tissue) was determined in the presence or absence of 50 nM LV1050-Fc x 5C8var1-Fc. After 4 hours, degranulation of Vγ9Vδ2-T cells was measured by CD107a expression and analyzed by a flow cytometry-based assay (determination of the percentage of EpCAM−/CD45+/CD3+/Vγ9+/Vδ2+/CD107a+ cells).
[0149] Also, the ability of LV1050-Fc x 5C8var1-Fc to trigger degranulation of Vγ9Vδ2-T cells in autologous patient PMBC cultured in the presence of prostate tumor or normal (non-malignant) tissue was determined. To this aim, the same method as above was used, with the exception that here autologous PBMC were added at an effector to target (E:T; PBMC:prostate cell) ratio of 10:1 and incubated for 24 hours.
[0150] In dissociated prostate cancer tissue, but not in non-malignant prostate tissue, LV1050-Fc x 5C8var1-Fc induced a statistically significant increase in degranulation of tissue infiltrating Vγ9Vδ2-T cells. A significantly higher percentage of CD107a-expressing Vγ9Vδ2-T cells was observed compared to incubation of tissue cells without the bispecific antibody (
[0151] In addition, the ability of LV1050-Fc x 5C8var1-Fc to activate Vγ9Vδ2-T cells in autologous PMBC upon co-culture with patient prostate tumor or normal (non-malignant) tissue was determined. Co-culture in the presence of LV1050-Fc x 5C8var1-Fc resulted in a significantly higher percentage of CD107a-expressing Vγ9Vδ2-T cells compared to incubation of tumor tissue cells and autologous PMBC alone (
[0152] The specific cytotoxicity induced by LV1050-Fc x 5C8var1-Fc was tested in co-cultures of prostate tumor cells or normal (non-malignant) prostate cells and autologous PBMC as described in Example 10, except that an E:T ratio of 10:1 was used. LV1050-Fc x 5C8var1-Fc induced statistically significant lysis of tumor cells in the presence of autologous PBMC, whereas normal (non-malignant) prostate cells were not lysed (
Example 15: In Vivo Therapeutic Efficacy of LV1050-Fc x 5C8var1-Fc
[0153] Immunodeficient NCG mice were subcutaneously inoculated with 5×10.sup.6 22Rv1 cells mixed with human PBMC in a 2:1 ratio (22Rv1:PBMC). PBMC from 2 donors showing different frequencies of Vγ9Vδ2-T cells in CD3+ T cells, donor #1 (21.9% Vγ9Vδ2-T cells) and donor #2 (8.8% Vγ9Vδ2-T cells), were used in this study. LV1050-Fc x 5C8var1-Fc (0.2 mg/kg or 2 mg/kg) or phosphate buffered saline (PBS) was administered IV every week (days 0, 7, 14 and 21) starting at the day of tumor cell- and PBMC inoculation. Tumor sizes were measured in two dimensions twice a week using a caliper. Mice were sacrificed when the mean tumor volume of a group exceeded 2,000 mm.sup.3.
[0154] For mice injected with PBMC from donor #1, LV1050-Fc x 5C8var1-Fc administration at 0.2 or 2 mg/kg resulted in statistically significant tumor growth inhibition (TGI) values of 91% and 78%, respectively, on day 34 (when mice in the control (PBS-treated) group were sacrificed:
Example 16: Whole Blood Cytokine Release Evaluation
[0155] An in vitro cytokine release assay was performed using a solution phase assay employing fresh whole blood from 30 healthy donors. Different concentrations of LV1050-Fc x 5C8var1-Fc (ranging from 280 to 8.75 nM) were incubated for 24 hours with whole blood and the levels of seven cytokines (IL-2, IL-4, IL-6, IL-8, IL-10, IFN-γ and tumor necrosis factor (TNF)α) in plasma were measured using an immunoassay. Erbitux® (cetuximab) and Campath® (alemtuzumab) were included in the assay as control compounds inducing low and high cytokine release in the clinic, respectively. Staphylococcal enterotoxin B (SEB) was used as a positive assay control for the release of all the cytokines tested.
[0156] A summary of the results is shown in Table 5. LV1050-Fc x 5C8var1-Fc only induced the release of IL-8 and IFN-γ. The LV1050-Fc x 5C8var1-Fc-induced release of IL-8 was comparable to that induced by Erbitux®, an antibody that is known not to induce cytokine release syndrome (CRS) (or is known to induce low levels of cytokines) in patients. LV1050-Fc x 5C8var1-Fc induced an IFN-γ release that was slightly higher when compared to Erbitux®, but the highest IFN-γ release observed was much lower than that induced by Campath®, an antibody clinically associated with CRS. Importantly, LV1050-Fc x 5C8var1-Fc did not induce any IL-6 release, a prominent cytokine in CRS (Tanaka et al (2016) Immunotherapy 8: 959).
[0157] In an in vitro cytokine release assay where LV1050-Fc x 5C8var1-Fc was coated to high-binding 96 wells plates prior to incubation with fresh whole blood from 10 healthy donors, similar results were obtained. Here, LV1050-Fc x 5C8var1-Fc induced very low (median) levels of IL-6 and IL-8, which were comparable to the low response comparator, Erbitux® and no TNFα release was observed. LV1050-Fc x 5C8var1-Fc induced higher (median) levels of IFN γ compared with Erbitux® at each concentration of the compound tested, yet median levels were substantially lower than that induced by Campath®.
TABLE-US-00008 TABLE 5 Cytokine release profile (pg/mL) induced by LV1050-Fc × 5C8var1-Fc in fresh blood samples of healthy donors. Test Article IL-2 IL-4 IL-6 IL-8 IL-10 IFN-γ TNFα PBS (negative control) 0 0 0 0 0 0 0 SEB (positive control) 24,470.9 53.3 5,613.2 8,936.3 1,010.3 61,792.2 4,302.2 Erbitux ® 280 nM 0 0 0 15.1 0 0 0 140 nM 0 0 0 24.8 0 1.1 0 70 nM 0 0 4.7 15.6 0 0.5 0 35 nM 0 0 17.4 20.0 0 0 0 17.5 nM 0 0 46.0 16.6 0 0 0 8.75 nM 0 0 6.2 15.4 0 3.6 0 Campath ® 280 nM 0 0 1,732.1 578.2 0.2 3,409.9 18.1 140 nM 0 0 1,360.3 392.7 0 4,029.0 12.9 70 nM 0 0 896.5 326.5 0 4,732.9 8.3 35 nM 0 0 714.9 255.5 0 5,313.4 14.5 17.5 nM 0 0 422.4 195.1 0 4,353.3 16.9 8.75 nM 0 0 400.9 180.5 0 4,932.2 20.6 LV1050-Fc × 280 nM 0 0 0 35.4 0 9.4 0 5C8var1-Fc 140 nM 0 0 0 25.4 0 24.4 0 70 nM 0 0 0 24.2 0 37.9 0 35 nM 0 0 0 20.3 0 49.6 0 17.5 nM 0 0 0 28.2 0 50.0 0 8.75 nM* 0 0 0 19.2 0 81.4 0
[0158] Median cytokine levels (pg/mL) for each drug/dose combination measured in fresh blood samples of 30 healthy donors by an in vitro cytokine release assay.
Example 17: Pharmacokinetics
[0159] LV1050-Fc x 5C8var1-Fc contains a human Fc domain, which is expected to extend the in vivo half-life of the compound by binding to the human FcRn receptor. To verify this, LV1050-Fc x 5C8var1-Fc was co-administered with a human IgG control in three single IV doses of 2 mg/kg, 5 mg/kg and 10 mg/kg in human FcRn Tg32 SCID mice (Jackson labs: JAX). Blood samples were collected at different time points (5 m, 8 h, 1, 3, 7, 10, 14, 17, 21 and 28 days) after administration and concentrations of LV1050-Fc x 5C8var1-Fc were assessed using an antigen capture ELISA. The results obtained in this model system show that LV1050-Fc x 5C8var1-Fc has a half-life in these transgenic mice that ranges between 140 and 172 hours (5.8-7.2 days,
[0160] The pharmacokinetics of LV1050-Fc x 5C8var1-Fc were also evaluated in non-human primates (NHP). Three female cynomolgus monkeys were given a single IV dose of LV1050-Fc x 5C8var1-Fc (0.14, 0.77 and 2.27 mg/kg (1 animal per dose)) using a 30-minute IV infusion. The half-life of LV1050-Fc x 5C8var1-Fc ranged between 150 and 166 hours (6.3-6.9 days) (
TABLE-US-00009 TABLE 6 Pharmacokinetic parameters of LV1050-Fc × 5C8var1-Fc in cynomolgus monkeys after a single IV dose. Adm. nC.sub.max nAUC.sub.0-∞ Animal dose T.sub.max C.sub.max (μg/mL)/ T.sub.1/2 AUC.sub.0-∞ (μg .Math. h/mL)/ Cl Vz ID (mg/kg) (hrs) (μg/mL) (mg/kg) (hrs) (μg .Math. h/mL) (mg/kg) (mL/h/kg) (mL/kg) 61 0.14 1 3.17 22.6 162.1 297.9 2127.9 0.47 109.9 62 0.77 1 17.1 22.2 150.0 1513.2 1965.2 0.51 110.1 63 2.27 1 53.6 23.6 165.9 5548.7 2444.4 0.41 97.9 CL = clearance; (n)C.sub.max = (normalized) maximum concentration after dosing; (n)AUC.sub.∞ = (normalized) area under the concentration versus time curve from time-point t = 0 h to infinity; T.sub.max = the time after dosing at which the maximum concentration reached; t.sub.1/2 = elimination half-life; V.sub.z = apparent volume of distribution.
Example 18: Homogeneous Product Irrespective of Transfection Ratio
[0161] cDNAs encoding the relevant two antibody heavy chains of LV1050-Fc x 5C8var1-Fc were each cloned in expression vectors suitable for manufacturing. Different ratio's, 1:1, 1:1.25, 1:1.5, 1.25:1 and 1.5:1, of expression vectors containing LV1050-Fc or 5C8var1-Fc were used for transfection of cells suitable for manufacturing. Cells were then selected for resistance to two different antibiotics and antibodies were produced from selected cell pools by means of fed batch production. Size Exclusion High Performance Liquid Chromatography (SE-HPLC) analysis of the produced antibodies revealed high product purities (dimer content): between 93.2% and 96.4% of the secreted protein was at the expected molecular seize, irrespective of the transfection ratio (main peak area in Table 7). Reverse Phase HPLCd (RP-HPLC) analysis was established to further distinguish the monomers (LV1050-Fc and 5C8var1-Fc) and homodimers (LV1050-Fc x LV1050-Fc and 5C8var1-Fc x 5C8var1-Fc) from intended LAVA heterodimers (LV1050-Fc x 5C8var1-Fc). All clone pool samples revealed a high content of intended heterodimer LAVA LV1050-Fc x 5C8var1-Fc between 86.1 and 94.9%. Clone pools DGC8-T1P, -T3P and -T5P revealed an elevated percentage of 5C8var1-Fcx5C8var1-Fc dimer.
TABLE-US-00010 TABLE 7 Results of SE-HPLC for clone pools obtained by transfection of different ratios of expression vectors containing LV1050-Fc or 5C8var1-Fc. rel. peak areas [%] Ratio HMW LMW Pool-ID. LV1050-Fc:5c8var1-Fc Species Main species DGC8-T1P 1:1 4.1 95.8 0.0 DGC8-T3P 1:1.25 4.5 94.1 1.4 DGC8-T5P .sup. 1:1.5 4.3 93.2 2.5 DGC8-T7P 1.25:1 3.6 96.4 0.1 DGC8-T9P 1.5:1.sup. 3.6 96.3 0.0 HMW—high molecular weight; LMW—low molecular weight
Example 19: Formulation of LV1050-Fc x 5C8var1-Fc
[0162] From a selected cell clone, LV1050-Fc x 5C8var1-Fc product was obtained by means of production in a bioreactor system, and after harvest and purification formulated at protein concentrations of 0.5 mg/mL and 10 mg/mL using four types of formulation buffers:
TABLE-US-00011 Buffer Formulation Buffer 1 10 mM Histidine + 280 mM Sucrose + 0.02% Polysorbate 80, pH 6.0 Buffer 2 10 mM Histidine + 280 mM Sucrose + 0.02% Polysorbate 80, pH 6.0 + 1 mM Methionine Buffer 3 10 mM Sodium acetate + 280 mM Sucrose + 0.02% Polysorbate 80, pH 5.5 Buffer 4 10 mM Sodium acetate + 280 mM Sucrose + 0.02% Polysorbate 80, pH 5.5 + 1 mM Methionine
[0163] Formulated samples were subjected to several storage conditions (defined below), for up to 12 weeks. Additionally, several stress tests were applied: [0164] Storage at 5° C.±3° C. [0165] Storage at −80° C.±10° C. [0166] Accelerated storage conditions at 25° C.±2° C./60% relative humidity (RH) t 5% [0167] Heat stress at 40° C.±2° C./75% RH±5% [0168] Freeze/Thaw cycles: The samples were completely frozen to −80±10° C. Subsequently, five freeze/thaw cycles have been performed after allowing samples to completely thaw at room temperature (15-25° C.). [0169] Agitation stress: Samples agitated at 240 rpm for 7 days at room temperature (EP15° C.-25° C.). [0170] Oxidation: The samples were spiked with 0.01% (v/v) hydrogen peroxide (H.sub.2O.sub.2) and incubated for 7 days at 25° C.±2° C./60% RH±5%. [0171] Photostability: >1.2 million lux hours and >200 watt hours/square meter of near ultra violet energy were applied at 25° C.±2° C./60% RH±5%.
[0172] Initial (=t0) 5° C.±3° C. samples served as a reference. Samples were analyzed using the following analytical methods:
TABLE-US-00012 Method Assessment Clarity Appearance Color Appearance pH pH A.sub.280 (UV/VIS) Content Stray light Integrity SE-HPLC Integrity Cation-exchange (CIEX)-HPLC Integrity Capillary electrophoresis sodium dodecyl sulfate (CE- Integrity SDS_(non-reduced) CE-SDS (reduced) Integrity Activity assay - PSMA binding ELISA Potency Peptide mapping Identity Differential scanning Integrity Liquid chromatography-mass spectrometry (LC-MS) Integrity (oxidation)
[0173] The results of the stability over time study were highly comparable for Clarity, Color, pH, A280 (UV-VIS), Stray light, SE-HPLC, CIEX-HPLC, CE-SDS and PSMA binding, Differential Scanning and Peptide Fingerprint for storage temperatures at −80° C. t 10° C., 5° C.±3° C. and 25° C.±2° C./60% RH±5%. The results of the measurements indicate that the product was highly stable with the chosen buffer conditions and only slight effects were observed over time.
[0174] Distinct effects were detected under stress conditions at 40° C.±2° C./75% RH±5% particularly at five weeks, enabling a differentiation between the tested buffers and concentrations. The CIEX-HPLC analyses of samples kept at 40° C.±2° C./75% RH t 5% and 5 weeks showed that at this timepoint the content of main variant dropped below 60% for all tested buffers and product concentrations. In the histidine-based formulation a slightly lower decrease was observed in main variant percentage compared to the acetate-based formulation.
[0175] The CE-SDS results revealed that storage over time at 40° C. resulted in a slight increase of LMW species of the product up to 5%. This effect was slightly more pronounced for the 10 mg/mL samples in buffer 1 and 3. Nevertheless, the antibody was found very stable, even under strong stress conditions as 40° C.±2° C./75% RH±5% for 5 weeks.
[0176] PSMA binding data for the 5 weeks' time point at 40° C.±2° C./75% RH±5% showed a strong increase in the EC.sub.50 for 10 mg/mL samples in buffer 1 and 3. The increase in the EC.sub.50 measured in the PSMA binding assay correlated with the slight increase in the relative HMW species amount observed in the SE-HPLC analysis from 0.3 and 0.2% to 0.6 and 0.7%, respectively.
[0177] The results from the stress tests (freeze/thawing (five F/T cycles), photo-, agitation- and oxidation stress) showed a different ranking than the temperature stability study. In the temperature stability study, 10 mg/mL samples in buffer 3 showed the highest amounts of results outside their predefined analytical threshold, whereas the stress stability study revealed increased results outside their predefined analytical threshold for 0.5 mg/mL samples in buffer 1 compared to the other conditions.
[0178] LC-MS analysis revealed that the addition of methionine (present in buffer 2 and buffer 4) to prevent oxidation of the product was effective.
[0179] In conclusion, LV1050-Fc x 5C8var1-Fc was most stable when formulated in buffer 2 and buffer 4. An overview of the sum of results outside their predefined analytical threshold for temperature stability, stress stability and overall stability (temperature plus stress) is shown in Table 8.
[0180] For final formulation, 10 mM Histidine+280 mM Sucrose+0.02% Polysorbate 80, pH 6.0+1 mM Methionine was chosen, at a protein concentration between 0.5 and 10 mg/mL.
TABLE-US-00013 TABLE 8 Sum of results outside their predefined analytical threshold for temperature stability, stress stability and overall stability (temperature plus stress). Buffer Buffer 1 Buffer 2 Buffer 3 Buffer 4 Protein conc. 0.5 10 0.5 10 0.5 10 0.5 10 (mg/mL) Temperature 0 2 0 0 1 6 0 0 stability Stress 11 5 5 4 5 5 5 4 stability Overall 11 7 5 4 6 11 5 4 stability