A FUSION PROTEIN COMPRISING AN ANTIGEN BINDING DOMAIN AND A CYTOKINE TRIMER DOMAIN
20230272026 · 2023-08-31
Inventors
- Kka Bi SON (Daejeon, KR)
- Jeong Hyeon BAK (US)
- Dae Hee LEE (US)
- Se Il JANG (US)
- Jung Min LEE (US)
- Ji Hye YOON (US)
- Jong Gwan JEONG (US)
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K14/70575
CHEMISTRY; METALLURGY
C07K2319/74
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present invention relates to a cytokine trimer domain in which a first monomer and a second monomer linked by linker (dimer) and a third monomer are coupled by a knob-into-hole and a novel type of fusion protein in which antibody and cytokine trimer domains are linked (receptor-antibody conjugated (cell) engager, RACE) prepared by replacing a constant region (Fc) of an antibody with the cytokine trimer domain, and RACE according to the present invention exhibits superior binding ability to the target receptor than the parent antibody as well as excellent simultaneous binding ability to the antigen and the target receptor, which can be usefully utilized as a bispecific pharmaceutical composition.
Claims
1-3. (canceled)
4. A fusion protein comprising a cytokine trimer domain consisting of a dimer including a first monomer and a second monomer, and a third monomer; and an antigen binding domain, wherein the trimer has a knob-into-hole structure formed by at least one amino acid residue of the first monomer or the second monomer and at least one amino acid residue of the third monomer.
5. The fusion protein of claim 4, a hole structure of the knob-into-hole structure is formed in the dimer including the first monomer and the second monomer, and a knob structure of the knob-into-hole structure is formed in the third monomer.
6. The fusion protein of claim 4, wherein the knob-into-hole structure is formed in a region other than a cytokine-receptor binding region.
7. The fusion protein of claim 4, wherein the at least one amino acid residue is located at a protein surface.
8. The fusion protein of claim 4, wherein the at least one amino acid residue of the first monomer and the at least one amino acid residue of the third monomer are located at a distance of 6 Å or less.
9. The fusion protein of claim 4, wherein the at least one amino acid residue of the second monomer and the at least one amino acid residue of the third monomer are located at a distance of 6 Å or less.
10. The fusion protein of claim 4, wherein the amino acid residue includes at least one selected from the group consisting of F92, F238, Q94, F144, V234, Q146, E148, F199, Y142, L203, R202, Q200, and A180.
11. The fusion protein of claim 4, wherein the amino acid residue includes at least one selected from the group consisting of F92W, F238V, Q94S, Q94Y, F1441, V234H, V234F, V234R, Q146S, E148G, F199L, Y142T, L203A, R202V, R202W, R202F, F199W, and A180E.
12. The fusion protein of claim 11, wherein the amino acid residue forms the knob-into-hole structure by at least one pair selected from the group consisting of a pair consisting of A180E and E148G, a pair consisting of V234R and R202V, and a pair of R202W and Q94S.
13-28. (canceled)
29. A method for producing antibody and tumor necrosis factor superfamily (TNFSF) trimeric fusion protein, wherein the tumor necrosis factor superfamily forms a trimer including a dimer including a first and second monomers of the tumor necrosis factor superfamily; and a third monomer of the tumor necrosis factor superfamily, the method comprising steps: 1) selecting one of two interfaces present between the dimer and the third monomer; 2) selecting an amino acid pair located at a distance of 6 Å or less between the first or second monomer and the third monomer located at the selected first interface in the first or second monomer; and from the third monomer; 3) forming a knob by inducing a mutation in the third monomer site in the selected amino acid pair to form a knob; 4) selecting the amino acid residues of the first or second monomers of a wild type (WT) causing a steric hindrance, which are paired with the knob of the third monomer; 5) forming a hole by inducing a mutation in the amino acid residue of the selected first or second monomer; and 6) inducing a knob-into-hole interaction between the knob of the third monomer and the hole of the first or second monomer, wherein a heavy chain of Fab is linked to the dimer and the third monomer.
30. The method of claim 29, wherein a knob-into-hole coupling is made at the selected interface in step 1), and a steric hindrance is induced between the monomers of the remaining unselected interface.
31. An antibody and tumor necrosis factor superfamily (TNFSF) trimeric fusion protein produced according to the method of claim 29.
32-34. (canceled)
35. The fusion protein of claim 4, wherein the antigen binding domain is an antibody or an antibody fragment.
36. The fusion protein of claim 35, wherein the antibody fragment includes a light chain variable region and a heavy chain variable region.
37. The fusion protein of claim 35, wherein the antibody fragment includes at least one selected from the group consisting of Fab, Fab′, F(ab′)2, scFv, di-scFv, and variable heavy chain domains of heavy chain antibody (VHH).
38. The fusion protein of claim 35, wherein the antibody fragment is characterized in that N-terminus or C-terminus is linked to a cytokine trimer.
39. The fusion protein of claim 35, wherein the antibody fragment is F(ab′)2 having the following structure: a first hinge of the F(ab′)2 is linked to the first monomer or the second monomer; and a second hinge of the F(ab′)2 is linked to the third monomer.
40. The fusion protein of claim 4, wherein the cytokine binds to a receptor in the form of a trimer in a natural state.
41. The fusion protein of claim 4, wherein the cytokine is tumor necrosis factor superfamily (TNFSF).
42. The fusion protein of claim 41, wherein the tumor necrosis factor superfamily includes at least one selected from the group consisting of TNFα, Dif, Necrosin, TNFβ, TNFSF1B, TNFγ, CD252, Gp34, CD134L, CD154, TRAP, Gp39, T-BAM, CD178, APTL, CD95L, CD70, CD153, and 4-1 BBL.
43. The fusion protein of claim 41, wherein the tumor necrosis factor superfamily is 4-1 BBL.
44. The fusion protein of claim 43, wherein the 4-1BBL includes an amino acid sequence represented by SEQ ID NO: 17.
45. The fusion protein of claim 43, wherein the 4-1BBL has the following structure: a first 4-1BBL monomer and a second 4-1BBL monomer are linked by a linker; and at least one amino acid residue of the first 4-1BBL monomer or the second 4-1BBL monomer and at least one amino acid residue of a third 4-1BBL monomer form a knob-into-hole structure.
Description
DESCRIPTION OF DRAWINGS
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
MODES OF THE INVENTION
[0047] Hereinafter, the present invention will be described in detail.
[0048] The present invention provides a fusion protein including an antigen binding domain and a cytokine trimer domain.
[0049] The cytokine trimer domain is characterized in that a dimer including a first monomer and a second monomer, and a third monomer are connected, and the dimer is characterized in that the first monomer and the second monomer are connected by a linker. The dimer is characterized in that the N or C terminus of the first monomer is interconnected with the N or C terminus of the second monomer by a linker.
[0050] Among the linkers known in the art, any linker capable of linking the first and second monomers of a cytokine may be used without limitation. In one embodiment of the present invention, it was linked by a short peptide linker between G.sub.1-G.sub.4S, in which G.sub.1 includes the sequence G, and the G.sub.4S includes the sequence GGGGS (SEQ ID NO: 34).
[0051] In particular, the cytokine can naturally form a trimer in the cytokine trimer domain of the present invention, but in the case where a fusion protein to which an antibody is bound is prepared by using the trimer structure in its natural state, mismatched disulfide bonds occur in the hinge portion connecting the Fab 3 portion of the antibody to each of the trimers, resulting in a problem of poor purity and productivity. Therefore, in order to increase productivity with higher purity, it is desirable to form a structure of knob-into-hole by at least one amino acid residue of the first or second monomer constituting the dimer and at least one amino acid residue of the third monomer. The knob-into-hole structure is preferably formed in a region other than the cytokine-receptor binding region.
[0052] In addition, the at least one amino acid residue is characterized in that it is located on the protein interface. In particular, since the first monomer and the second monomer are connected in tandem through a linker, a hole may be formed in the first monomer or in the second monomer depending on the interface position of the knob generated in the third monomer.
[0053] Through the knob-into-hole structure as described above, a selective interaction is induced between one of the first or second monomers constituting the dimer in which the hole is formed and the third monomer in which the knob is formed, and a steric hindrance may be induced at the interface between the remaining first or second monomer in which no holes are formed and the third monomer so as to induce interaction with the desired interface and to inhibit mismatch caused when a natural trimer is used. That is, for example, in the present invention, an interaction may be induced at the interface where the hole of the first monomer and the knob of the third monomer are formed, and a steric hindrance may be induced between the second monomer and the third monomer; or interaction may be induced at the interface where the hole of the second monomer and the knob of the third monomer are formed, and a steric hindrance may be induced between the first monomer and the third monomer.
[0054] Meanwhile, in protein-protein interaction, three important interactions [hydrogen bond=2.4-3.2 Å, hydrophobic interaction=3.2-3.9 Å, and charge interaction=˜4 Å] typically occur within a distance of 4 Å.
[0055] Therefore, in the amino acid residues of the first monomer, the second monomer or the third monomer of the present invention, at least one amino acid residue of the first monomer and amino acid residue of the third monomer may be located at a distance of 6 Å or less, and at least one amino acid residue of the second monomer and at least one amino acid residue of the third monomer may be located at a distance of 6 Å or less, preferably, the at least one amino acid residue of the first monomer and the at least one amino acid residue of the third monomer may be located at a distance of 4 Å or less, and the at least one amino acid residue of the second monomer and the at least one amino acid residue of the third monomer may be located at a distance of 4 Å or less, and more preferably, the at least one amino acid residue of the first monomer and the one amino acid residue of the third monomer may be located at a distance of 2 to 4 Å, and the at least one amino acid residue of the second monomer and the at least one amino acid residue of the third monomer may be located at a distance of 2 to 4 Å.
[0056] Therefore, the amino acid residue can be selected from amino acid residues located at a distance of 6 Å or less between the dimer and the monomer, preferably at a distance of 4 Å or less, and more preferably at a distance of 2 to 4 Å, and for example, when the cytokine consists of 4-1BBL monomers and dimers, it may be at least one selected from the group consisting of F92, F238, Q94, F144, V234, Q146, E148, F199, Y142, L203, R202, Q200, and A180.
[0057] The position of the amino acid mutation was determined based on the amino acid sequence of TNFSF9 (TNF superfamily member 9) of NCBI (accession number: NM_003811.3).
[0058] More preferably, amino acid mutation of each monomer may be induced, thereby forming a knob-into-hole structure. Accordingly, the amino acid residue may be at least one selected from the group consisting of F92W, F238V, Q94S, Q94Y, F1441, V234H, V234F, V234R, Q146S, E148G, F199L, Y142T, L203A, R202V, R202W, R202F, F199W, and A180E.
[0059] More preferably, the amino acid residue may be one in which two amino acid residues are paired to form a knob-into-hole. Even more preferably, the amino acid residue is characterized in that R202W and Q94S are paired to form a knob-into-hole structure.
[0060] For cytokines such as 4-1BBL, E148G of a dimer (first monomer and second monomer are linked by a linker) (hole formation) and A180E of a monomer (third monomer) (knob formation) can prepare a trimer that forms a knob-into-hole. In addition, R202V of a dimer (first monomer and second monomer are linked by a linker) (hole formation) and V234R of a monomer (third monomer) (knob formation) can prepare a trimer that forms a knob-into-hole. Further, Q94S of a dimer (first monomer and second monomer are linked by a linker) (hole formation) and R202W of a monomer (third monomer) (knob formation) can prepare a trimer that forms a knob-into-hole.
[0061] According to an embodiment of the present invention, for cytokines such as 4-1BBL, Q94S of a dimer (first monomer and second monomer are linked by a linker) (hole formation) and R202W of a monomer (third monomer) (knob formation) prepared a trimer that forms a knob-into-hole.
[0062] In addition, as shown in
[0063] In the fusion protein of the present invention, the antigen binding domain is an antibody or antibody fragment.
[0064] In the fusion protein of the present invention, any antibody or antibody fragment may be used without limitation, as long as the antibody or antibody fragment is capable of binding to the desired antigen. In an embodiment of the present invention, a fusion protein including any one antibody selected from the group consisting of rituximab, cetuximab, trastuzumab, and avelumab and a cytokine trimer domain was prepared.
[0065] The antibody fragment may include a light chain variable region and a heavy chain variable region and may preferably include at least one selected from the group consisting of Fab, Fab′, F(ab′)2, scFv, di-scFv, and VHH (variable heavy chain domains of heavy chain antibody).
[0066] In particular, the antibody fragment has an N-terminus or C-terminus linked to a cytokine trimer to form a fusion protein. More preferably, the antibody fragment may be F(ab′)2 having the following structure: the first hinge of F(ab′)2 is linked to a first monomer or a second monomer linked by a linker; and the second hinge of the F(ab′)2′ is linked to the third monomer.
[0067] In the fusion protein of the present invention, the cytokine is characterized in that it binds to the receptor in the form of a trimer in a natural state.
[0068] Therefore, the cytokine may preferably be a tumor necrosis factor superfamily (TNFSF) capable of trimer formation in a natural state. Preferably, it may be at least one selected from the group consisting of TNFα, Dif, Necrosin, TNFβ, TNFSF1B, TNFγ, CD252, Gp34, CD134L, CD154, TRAP, Gp39, T-BAM, CD178, APTL, CD95L, CD70, CD153, and 4-1 BBL and more preferably 4-1 BBL.
[0069] According to an embodiment of the present invention, in the fusion protein of the present invention, a globular protein domain exposed to the outside of the cell was used among the entire sequence of 4-1BB (Accession number: NM_003811.3) (G90-T241), and thus the 4-1BBL is characterized in that it includes the amino acid sequence represented by SEQ ID NO: 17.
TABLE-US-00001 (SEQ ID NO: 17) GMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKA GVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPP ASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLG LFRVT
[0070] Even more preferably, the trimer 4-1BBL included in the fusion protein may have the following structure: the first 4-1BBL monomer and the second 4-1BBL monomer are linked by a linker; and at least one amino acid residue of the first 4-1BBL monomer or the second 4-1BBL monomer and at least one amino acid residue of the third 4-1BBL monomer form a knob-into-hole structure.
[0071] The structure of the 4-1 BBL-based fusion protein prepared according to an embodiment of the present invention is shown in
[0072] In a specific embodiment of the cytokine trimer domain of the present invention based on the above, it may include a monomer including the amino acid sequence represented by SEQ ID NO: 1 and a dimer including the amino acid sequence represented by SEQ ID NO: 2. In the dimer, two monomers may be linked by a linker at the 170th amino acid sequence (G). Also, it may include a monomer including the nucleotide sequence represented by SEQ ID NO: 3 and a dimer including the nucleotide sequence represented by SEQ ID NO: 4. In the dimer, two monomers may be linked by a linker in GGA of the 508th to 510th nucleotide sequence.
[0073] In another specific embodiment of the cytokine trimer domain of the present invention, it may include a monomer including the amino acid sequence represented by SEQ ID NO: 5 (mutated from R to W in the 202nd amino acid sequence) and a dimer including the amino acid sequence represented by SEQ ID NO: 6 (mutated from Q to S in the 94th amino acid sequence). In the dimer, two monomers may be linked by a linker at the 170th amino acid sequence (G). In addition, the monomer and the dimer may form a knob-into-hole structure at the amino acid mutation position. Also, it may include a monomer including the nucleotide sequence represented by SEQ ID NO: 7 (mutated from AGA to TGG in the 202nd amino acid sequence) and a dimer including the nucleotide sequence represented by SEQ ID NO: 8 (mutated from CAG to AGC in the 94th amino acid sequence). In the dimer, two monomers may be linked by a linker in GGA of the 508th to 510th nucleotide sequence.
[0074] In still another specific embodiment of the cytokine trimer domain of the present invention, a monomer including the amino acid sequence represented by SEQ ID NO: 9 (mutated from A to E in the 180th amino acid sequence) and a dimer including the amino acid sequence represented by SEQ ID NO: 10 (mutated from E to G in the 148th amino acid sequence). In the dimer, two monomers may be linked by a linker at the 170th amino acid sequence (G). In addition, the monomer and the dimer may form a knob-into-hole structure at the amino acid mutation position. Also, it may include a monomer including the nucleotide sequence represented by SEQ ID NO: 11 (mutated from GCT to GAA in the 180th amino acid sequence) and a dimer including the nucleotide sequence represented by SEQ ID NO: 12 (mutated from CAA to GGA in the 148th amino acid sequence). In the dimer, two monomers may be linked by a linker in GGA of the 508th to 510th nucleotide sequence.
[0075] In yet another specific embodiment of the cytokine trimer domain of the present invention, a monomer including the amino acid sequence represented by SEQ ID NO: 13 (mutated from V to R in the 234th amino acid sequence) and a dimer including the amino acid sequence represented by SEQ ID NO: 14 (mutated from R to V in the 202nd amino acid sequence). In the dimer, two monomers may be linked by a linker at the 170th amino acid sequence (G). In addition, the monomer and the dimer may form a knob-into-hole structure at the amino acid mutation position. Also, it may include a monomer including the nucleotide sequence represented by SEQ ID NO: (mutated from GTG to AGA in the 234th amino acid sequence) and a dimer including the nucleotide sequence represented by SEQ ID NO: 16 (mutated from AGA to GTG in the 202nd amino acid sequence). In the dimer, two monomers may be linked by a linker in GGA of the 508th to 510th nucleotide sequence.
[0076] Therefore, the fusion protein of the present invention may preferably include any one cytokine trimer domain selected from the group consisting of a cytokine trimer domain including a monomer including the amino acid sequence represented by SEQ ID NO: 1 and a dimer including the amino acid sequence represented by SEQ ID NO: 2; a cytokine trimer domain including a monomer including the amino acid sequence represented by SEQ ID NO: 5 and a dimer including the amino acid sequence represented by SEQ ID NO: 6; a cytokine trimer domain including a monomer including the amino acid sequence represented by SEQ ID NO: 9 and a dimer including the amino acid sequence represented by SEQ ID NO: 10; and a cytokine trimer domain including a monomer including the amino acid sequence represented by SEQ ID NO: 13 and a dimer including the amino acid sequence represented by SEQ ID NO: 14.
[0077] It is clear to those skilled in the art that the amino acid sequences represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 13, and SEQ ID NO: 14 will be limited to including a mutation of the amino acid sequence exhibiting equivalent biological activity thereof. Such amino acid mutations are made based on the relative similarity such as hydrophobicity, hydrophilicity, charge, size, etc. of amino acid side chain substituents. According to the analysis of the size, shape, and type of amino acid side chain substituents, it can be seen that arginine, lysine, and histidine are all positively charged residues; alanine, glycine, and serine have similar sizes; and phenylalanine, tryptophan, and tyrosine have similar shapes. Therefore, based on these considerations, arginine, lysine, and histidine; alanine, glycine, and serine; and phenylalanine, tryptophan, and tyrosine can be biologically functional equivalents.
[0078] For the introduction of mutations, the hydropathic index of amino acids may be considered. Each amino acid is assigned a hydrophobicity index according to its hydrophobicity and charge: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystaine (+2.5); methionine (+1.9); alanine (+1.8); glycine (−0.4); threonine (−0.7); serine (−0.8); tryptophan (−0.9); tyrosine (−1.3); proline (−1.6); histidine (−3.2); glutamate (−3.5); glutamine (−3.5); aspartate (−3.5); asparagine (−3.5); lysine (−3.9); and arginine (−4.5).
[0079] The hydrophobic amino acid index is very important in imparting the interactive biological function of proteins or peptides. It is well known that substitution with an amino acid having a similar hydrophobic index can retain similar biological activities. When a mutation is introduced with reference to a hydrophobic index, the substitution is made between amino acids showing a hydrophobic index difference preferably within ±2, more preferably within ±1, even more preferably within ±0.5.
[0080] Meanwhile, it is also well known that the substitution between amino acids with similar hydrophilicity values leads to proteins or peptides with equivalent biological activity. The following hydrophilicity values are assigned to each amino acid residue: arginine (+3.0); lysine (+3.0); aspartate (+3.0±1); glutamate (+3.0±1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (−0.4); proline (−0.5±1); alanine (−0.5); histidine (−0.5); cysteine (−1.0); methionine (−1.3); valine (−1.5); leucine (−1.8); isoleucine (−1.8); tyrosine (−2.3); phenylalanine (−2.5); and tryptophan (−3.4).
[0081] When a mutation is introduced with reference to a hydrophilicity value, the substitution is made between amino acids showing a hydrophilicity value difference preferably within ±2, more preferably within ±1, and even more preferably within ±0.5.
[0082] Amino acid substitution in peptides that do not totally alter the activity of the molecule is known in the art. The substitution occurs the most commonly between amino acid residues, e.g., Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, and Asp/Gly.
[0083] Considering the mutation having the above-mentioned biological equivalent activity, the amino acid sequences represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 13, and SEQ ID NO: 14 of the present invention are interpreted to include sequences showing substantial identity with the sequence described in sequence lists. The substantial identity means a sequence showing at least 80% homology, more preferably 90% homology by aligning the amino acid sequence represented by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 13, and SEQ ID NO: 14 of the present invention with any other sequence as much as possible and analyzing the aligned sequence using algorithms commonly used in the art. The alignment method for sequence comparison may be any method known in the art without limitation.
[0084] In addition, the nucleotide sequences represented by SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, and SEQ ID NO: 16 may include a nucleotide sequence having 70% or more, more preferably 80% or more, even more preferably 90% or more, most preferably 95% or more sequence homology with the nucleotide sequences represented by SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 15, and SEQ ID NO: 16. The “% of sequence homology” for a nucleotide sequence is determined by comparing two optimally aligned sequences with a comparison region, and a portion of the nucleotide sequence in the comparison region may include addition or deletion (i.e., gap) compared to the reference sequence (without addition or deletion) for the optimal alignment of the two sequences.
[0085] As mentioned above, in the cytokine trimer domain of the fusion protein according to the present invention, the knob-into-hole structure is characterized in that it is generated through amino acid mutations that occur in monomers and dimers, respectively. This is to inhibit the formation of disulfide mismatched by misassembly of the sequence of the hinge portion connecting the antibody (Fab) in the trimer assembly of the tumor necrosis factor superfamily (TNFSF), which exists as a trimer in nature.
[0086] In addition, the present invention provides a polynucleotide encoding the fusion protein according to the present invention.
[0087] Further, the present invention provides a vector including a polynucleotide encoding the fusion protein according to the present invention.
[0088] A schematic diagram of the vector is shown in
[0089] In addition, the present invention provides a vector composition for producing a fusion protein including: a first vector in which a polynucleotide encoding the heavy chain of the Fab and a polynucleotide encoding the first monomer and the second monomer connected by a linker are operably linked; a second vector in which a polynucleotide encoding the heavy chain of the Fab and a polynucleotide encoding the third monomer are operably linked; and a third vector including a polynucleotide encoding the light chain of the Fab.
[0090] When the vector composition for producing a fusion protein is used, a dimer and a heavy chain of Fab in a trimer and a monomer and a heavy chain of Fab in a trimer, respectively, are prepared, and then the formation of a trimer may be induced.
[0091] In the present invention, the “vector” refers to a gene construct including the nucleotide sequence of a gene operably linked to a suitable regulatory sequence so as to express a target gene in a suitable host, and the regulatory sequence may include promoters capable of initiating transcription, any optional operator sequences to control such transcription, and sequences to control the termination of transcription and translation. The vector of the present invention is not particularly limited as long as it can replicate within a cell, and any vector known in the art may be used, for example, a plasmid, cosmid, phage particle, or viral vector.
[0092] In addition, the present invention provides a method for producing a fusion protein, the method including a step of infecting a host cell with a vector including a polynucleotide encoding the fusion protein according to the present invention.
[0093] In addition, the present invention provides a method for producing a fusion protein, the method including a step of infecting a host cell with the vector composition for producing the fusion protein of claim 1, the composition including: a first vector in which a polynucleotide encoding the heavy chain of the Fab and a polynucleotide encoding the first monomer and the second monomer connected by a linker are operably linked; a second vector in which a polynucleotide encoding the heavy chain of the Fab and a polynucleotide encoding the third monomer are operably linked; and a third vector including a polynucleotide encoding the light chain of the Fab.
[0094] In the present invention, the “recombinant vector” may be used as an expression vector of a target polypeptide capable of expressing the target polypeptide with high efficiency in an appropriate host cell when the gene encoding the target polypeptide to be expressed is operably linked, and the recombinant vector can be expressed in a host cell. The host cell may preferably be a eukaryotic cell, and according to the type of host cell, an expression control sequence such as a promoter, terminator, enhancer, etc., and a sequence for membrane targeting or secretion may be appropriately selected and combined in various ways depending on the purpose.
[0095] According to an embodiment of the present invention, the fusion protein including an antigen binding domain; and a cytokine trimer domain according to the present invention had superior antigen-binding ability than the parent antibody, and had the superior binding ability to the cytokine target receptor than the parent antibody, and they can bind at the same time. As a result, it was confirmed that each target (protein) could successfully induce binding of the expressed cells.
[0096] In addition, the present invention provides a method for producing antibody and tumor necrosis factor superfamily (TNFSF) trimeric fusion protein, in which the tumor necrosis factor superfamily forms a trimer including a dimer including a first and second monomers of the tumor necrosis factor superfamily; and a third monomer of the tumor necrosis factor superfamily, the method including steps: 1) selecting one of the two interfaces present between the dimer and the third monomer; 2) selecting an amino acid pair located at a distance of 6 Å or less between the first or second monomer and the third monomer located at the selected first interface in the first or second monomer; and from the third monomer; 3) forming a knob by inducing a mutation in the third monomer site in the selected amino acid pair; 4) selecting the amino acid residues of the first or second monomers of the wild type (WT) causing a steric hindrance, which are paired with the knob of the third monomer; 5) forming a hole by inducing a mutation in the amino acid residue of the selected first or second monomer; and 6) inducing a knob-into-hole interaction between the knob of the third monomer and the hole of the first or second monomer, in which the heavy chain of the Fab is linked to the dimer and the third monomer.
[0097] In step 2) of the method of producing the antibody and tumor necrosis factor superfamily trimeric fusion protein, the amino acid pair may be located at a distance of 6 Å or less, preferably 4 Å or less, and more preferably 2 to 4 Å between the first or second monomer and the third monomer located at the first interface.
[0098] In the method of producing the antibody and tumor necrosis factor superfamily trimeric fusion protein, the amino acid residue causing a steric hindrance to the knob may be inferred by changing the corresponding residue to any one amino acid residue selected from the group consisting of glycine (G), valine (V), serine (S), and alanine (A), which is a candidate, through simulation.
[0099] In addition, the knob-into-hole coupling is made at the interface selected in step 1), and steric hindrance is induced between the remaining monomers of the unselected interface. Interaction can be induced with the desired interface through the steric hindrance. Therefore, it is possible to inhibit the generation of mismatched disulfide in the hinge portion connecting the antibody (Fab), which may be induced when the fusion protein is produced using the native trimer.
[0100] According to an embodiment of the present invention, it was confirmed that in the case of a fusion protein combining an antibody with a cytokine to which the knob-into-hole structure is not applied, unpaired cysteine residues were found near the hinge region where cysteine residues pair to form a disulfide bond, or disulfide bonds in which all three hinges were asymmetrically paired were found.
[0101] Therefore, the production method according to the present invention is an optimal method for inhibiting heterogeneity due to abnormal disulfide bonds of the hinge portion in the produced antibody and tumor necrosis factor superfamily trimeric fusion protein to increase the productivity and purity of the fusion protein and is a method that can provide the fusion protein as a more stable therapeutic protein.
[0102] The dimer is characterized in that the first monomer and the second monomer are linked by a linker. The dimer is characterized in that the N or C terminus of the first monomer is interconnected with the N or C terminus of the second monomer by a linker. The linker may be used without limitation as long as it is a linker capable of linking the first and second monomers of the cytokine among linkers known in the art.
[0103] In addition, any antibody fragment (Fab) may be used without limitation, as long as it can bind to the desired antigen.
[0104] In addition, the present invention provides an antibody and tumor necrosis factor superfamily trimeric fusion protein produced by the above production method.
[0105] The description of the fusion protein described above is equally applicable to the antibody and tumor necrosis factor superfamily trimeric fusion protein produced by the production method.
[0106] Further, the present invention provides a pharmaceutical composition for functional improvement of immune cells to inhibit or treat a disease caused by the functional inactivation or impairment of host immune cells, the composition including the fusion protein according to the present invention.
[0107] In addition, the present invention provides a method for treating a disease caused by the functional inactivation or impairment of host immune cells, the method including a step of administering the fusion protein according to the present invention to a subject.
[0108] The subject is preferably a mammal, including a human and is a patient in need of treatment for a disease by functional inactivation or impairment of host immune cells, including all patients undergoing treatment for diseases caused by functional inactivation or impairment of host immune cells, patients who have been treated for diseases caused by functional inactivation or impairment of host immune cells, and patients in need of treatment for diseases caused by functional inactivation or impairment of host immune cells and may also include patients who have undergone surgery to treat diseases caused by functional inactivation or impairment of host immune cells.
[0109] In addition, the fusion protein of the present invention can be treated in combination with an existing drug or treatment method for treating a disease caused by the inactivation or impairment of the function of host immune cells. When the fusion protein of the present invention is co-treated, it may be treated simultaneously or sequentially with other drugs or methods for the treatment of diseases caused by the functional inactivation or impairment of host immune cells.
[0110] The disease caused by the functional inactivation or impairment of host immune cells may be any one or more selected from the group consisting of cancer, immune disease, autoimmune disease, central nervous disease, neurodegenerative disease, autoimmune disease, and inflammatory disease, in which cancer may be any one or more selected from the group consisting of breast cancer, lung cancer, colon cancer and colorectal cancer.
[0111] In the present invention, the pharmaceutical composition may be characterized by being in the form of capsules, tablets, granules, injections, ointments, powders, or beverages, and the pharmaceutical composition may be characterized by being targeted to humans. The pharmaceutical composition may be formulated in the form of oral preparations such as powders, granules, capsules, tablets, and aqueous suspensions, preparations for external use, suppositories, and sterile injectable solutions, respectively, according to conventional methods, and used, but is not limited thereto.
[0112] The pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier. As the pharmaceutically acceptable carrier, a binder, a glidant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a pigment, a fragrance, and the like may be used for oral administration, a buffer, a preserving agent, a pain-relieving agent, a solubilizer, an isotonic agent, a stabilizer, and the like may be used in admixture for injections, and a base, an excipient, a lubricant, a preserving agent, and the like may be used for topical administration. The formulations of the pharmaceutical composition of the present invention may be prepared in various ways by being mixed with the pharmaceutically acceptable carrier as described above. For example, for oral administration, the pharmaceutical composition may be formulated in the form of a tablet, a troche, a capsule, an elixir, a suspension, a syrup, a wafer, or the like. For injections, the pharmaceutical composition may be formulated in the form of unit dosage ampoules or multiple dosage forms.
[0113] Meanwhile, as examples of carriers, diluents, or excipients suitable for making preparations, lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methyl hydroxybenzoate, propyl hydroxybenzoate, talc, magnesium stearate, mineral oil, or the like may be used. In addition, a filler, an anti-coagulant, a lubricant, a wetting agent, a fragrance, an emulsifier, a preservative, and the like may further be included.
[0114] The route of administration of the pharmaceutical composition of the present invention includes, but is not limited to, oral, intravenous, intramuscular, intraarterial, intramedullary, intradural, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, sublingual, or rectal route. The term “parenteral” is meant to include subcutaneous, transdermal, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intradural, intralesional, and intra-cranial injection or infusion techniques. The pharmaceutical composition of the present invention may also be formulated as suppositories for intrarectal administration.
[0115] The pharmaceutical composition of the present invention may vary depending on a variety of factors, including the activity of a certain active ingredient used, the patient's age, body weight, general health status, sex, diet, time of administration, route of administration, rate of excretion, drug combination, and severity of a certain disease to be inhibited or treated. A dose of the pharmaceutical composition may vary depending on the patient's condition, body weight, severity of disease, drug form, route of administration, and duration, and may be appropriately selected by those skilled in the art. Preferably, taking all of the above factors into consideration, it is possible to administer an amount that can obtain the maximum effect with a minimum amount without side effects, and more preferably, it may be administered repeatedly several times a day at an effective dose of 1 to 10000 μg/body weight kg/day, even more preferably 10 to 1000 mg/body weight kg/day. The above dosage does not limit the scope of the present invention in any way.
[0116] The above-described contents of the present invention are equally applied to each other as long as they do not contradict each other, and it is also included in the scope of the present invention that those skilled in the art can implement with appropriate changes.
[0117] Hereinafter, the present invention will be described in detail through Examples, but the scope of the present invention is not limited only to the Examples below.
Experimental Example 1. Preparation of Cell Lines
[0118] The Freestyle293F cell line (Gibco™, R79007) was suspension cultured using a Freestyle 293F expression medium (Gibco™, 12338018) under a condition of 37° C. and 8% CO.sub.2 at 120 RPM. In addition, Raji-B cell line (CCL86™, ATCC), MDA-MB-231 cell line (HTB-26™, ATCC), and SW-480 cell line (10228, KCLB) were cultured using a culture medium in which RPMI1640 (Welgene) was added with 10% (v/v) fetal bovine serum (FBS, Gibco™) and PC-9 cell line (CVCL_B260) and HT-29 cell line (HTB-38™, ATCC) were cultured using a culture medium in which DMEM (Welgene) was added with 10% (v/v) FBS under a condition of 37° C. and 5% CO.sub.2.
Example 1. Preparation of Fusion Protein Linking Cytokine Trimer Domain and Antibody Domain
[0119] 1-1. Gene Preparation
[0120] For the construction of the fusion protein according to the present invention, the following three types of coding sequences were designed: 1) a light chain of an antibody, 2) a sequence in which a 4-1BB ligand monomer is linked to the C-terminus of the antigen-binding site of an antibody heavy chain, and 3) a sequence in which a 4-1BB ligand dimer is linked to the C-terminus of an antigen-binding site of an antibody heavy chain.
[0121] In this regard, a human 4-1BB ligand protein was used, and the corresponding gene (NM_003811.3) was synthesized using Geneart. In the present invention, the globular protein domain (G90-T241) exposed to the outside of the cell was used among the entire sequence of the 4-1BB ligand protein. Cloning and mutagenesis of genes were performed using gateway cloning.
[0122] 1-2. Construction of Vectors for Producing Fusion Proteins
[0123] In order to prepare a fusion protein in which the Fc region of an antibody is replaced with a cytokine trimer (hereinafter, referred to as receptor-antibody conjugated (cell) engager (RACE)), a first vector for Fab heavy chain and a cytokine dimer, a second vector for Fab heavy chain and the cytokine monomer and a third vector for the light chain were constructed.
[0124] At this time, in the trimer domain of 4-1BB ligand, which is a cytokine, amino acid residues for mutation formation were simulated and selected using Pymol software and Dynamut server (http://biosig.unimelb.edu.au/dynamut/).
[0125] A trimer domain was constructed using a partial sequence (G90-T241) of 4-1BB ligand as a unit. Specifically, in order to significantly improve the physical properties and purity of the prepared trimer and to inhibit homo-trimerization of the heavy chain containing the monomer, a trimer was formed using a knob-into-hole structure. To this end, 1) an antibody heavy chain including a 4-1BB ligand dimer and 2) an antibody heavy chain including a 4-1BB ligand monomer were used to form knob-into-hole on only one of the two interfaces present between the dimer and the monomer, and selective trimerization was achieved with minimal changes. A knob was formed in the 4-1BB ligand monomer, and a hole was formed in one of the dimers of the 4-1BB ligand. Each unit of the trimer and its bonding form are shown in
[0126] Structural analysis of the trimer domain formed as described above was performed using Pymol software (https://pymol.org/2/) based on the structure of the human 4-1BBL protein complex (PDB code: 6A3V, 2X29).
[0127] The interaction site between the 4-1BB ligand dimer and the monomer confirmed through this is shown in
[0128] As shown in
[0129] The mutation was induced in the amino acid residues derived as described above so as to form a knob-into-hole structure between the dimer and the monomer, and a schematic diagram of whether or not a knob-into-hole was formed in the wild type and each mutation was predicted through mutagenesis and is shown in
[0130] The 4-1BB ligand exists as a trimer in nature. In the assembly of the trimer, misassembly occurs in the sequence of the hinge portion connecting the antibody (Fab) to generate mismatched disulfide. In order to solve this problem, the present invention produced a trimer using a knob-into-hole structure.
[0131] As shown in
[0132] In consideration of the above, a first vector for the heavy chain-cytokine (dimer) into which the antibody and native cytokine sequences are inserted, a second vector for heavy chain-cytokine (monomer), and a third vector for antibody light chain were prepared. Thereafter, the dimers and monomers were mutagenized to induce the formation of a knob-into-hole structure.
[0133] More specifically, for the formation of the knob-into-hole structure, Q94S (hole formation) of the dimer (the first monomer and the second monomer are linked by a linker) and R202W (knob formation) of the monomer (third monomer) were produced to form knob-into-hole.
[0134] First, it was commissioned to Geneart (Thermofisher) to synthesize a template (antibody heavy chain, antibody light chain, 4-1BBL(WT) dimer, and monomer) to be used for cloning. At this time, the dimer was synthesized by adding a GGA (Glycine) sequence corresponding to the linker to the 508th to 510th nucleotide sequence. In addition, four types of antibodies were used as the antibody: rituximab (Drugbank accession number (DB00073)), cetuximab (Drugbank accession number (DB00002)), trastuzumab (Drugbank accession number (DB00072)), or avelumab (Drugbank accession number (DB11945)). Thereafter, cloning was performed for each using gateway cloning based on the pCMV vector. More specifically, antibody heavy chain-cytokine dimer in which 4-1BBL-linker-4-1BBL (dimer) is linked to the end of the antibody heavy chain (VH-CH1-hinge) into the multiple cloning site (MCS) of the pCMV vector was inserted to prepare a first vector. To this end, the first fragment for the heavy chain of the antibody, the second fragment for the first monomer among 4-1BBL dimers, and the third fragment for the second monomer among the 4-1BBL dimers were amplified using the primers in Table 1 below, and then gateway cloning was performed.
TABLE-US-00002 TABLE 1 SEQ ID Direction Sequence (5′.fwdarw.3′) NO First Forward tacacgtacttagtcgctgaagctcttcTATGGGATGGAGCT 18 Fragment ATATC First Reverse taggtacgaactcgattgacggctcttcATCCCCCCAGGAGT 19 Fragment TCAGG Second Forward tacacgtacttagtcgctgaagctcttcAGGAGGCATGTTTG 20 Fragment CCCAGC Second Reverse TaggtacgaactcgattgacggctcttcAGCCTCCTGTCACT 21 Fragment CTGAACAGGCC Third Forward tacacgtacttagtcgctgaagctcttcAGGCATGTTTGCCC 22 Fragment AGC Third Reverse aggtacgaactcgattgacggctcttcAGAGTTATGTCACT 23 Fragment CTGAACAGGCC
[0135] In addition, the second vector was prepared by inserting the antibody heavy chain-cytokine monomer linking 4-1BBL to the end of the antibody heavy chain (VH-CH1-hinge) into the MCS of the pCMV vector. To this end, the first fragment for the heavy chain of the antibody and the second fragment for the 4-1BBL monomer were amplified using the primers in Table 2 below, and then gateway cloning was performed.
TABLE-US-00003 TABLE 2 SEQ ID Direction Sequence (5′.fwdarw.3′) NO First Forward tacacgtacttagtcgctgaagctcttcTATGGGATGGAGCT 24 Fragment ATATC First Reverse taggtacgaactcgattgacggctctt 25 Fragment ATCCCCCCAGGAGTTCAGG Second Forward tacacgtacttagtcgctgaagctcttcAGGAGGCATGTTTG 26 Fragment CCCAGC Second Reverse aggtacgaactcgattgacggctcttcAGAGTTATGTCACT 27 Fragment CTGAACAGGCC
[0136] In addition, a third vector was prepared by inserting the antibody light chain into the MCS of the pCMV vector. At this time, the fragment was amplified using the primers in Table 3 below, and then gateway cloning was performed.
TABLE-US-00004 TABLE 3 SEQ ID Direction Sequence (5′.fwdarw.3′) NO Single Forward TACACGTACTTAGTCGCTGAAGCTCTTCTAG 28 Fragment ATCTGTGGCTGCACCA Single Reverse AGGTACGAACTCGATTGACGGCTCTTCATCT 29 Fragment CTTCACTTCCACCTT
[0137] Thereafter, gateway cloning was performed to apply mutations to the dimer of the first vector and the monomer of the second vector. In this case, the primers in Table 4 below were used. As a result, the mutation of Q94S was applied to the dimer of the first vector, and the mutation of R202W was applied to the monomer of the second vector.
TABLE-US-00005 TABLE 4 SEQ ID Direction Sequence (5′.fwdarw.3′) NO Dimer Forward tacacgtacttagtcgctgaagctcttcTagcCTGGTGGCCCA 30 (Q94S) GAATG Dimer Reverse taggtacgaactcgattgacggctcttcAgctGGCAAACATGC 31 (Q94S) CTCC Monomer Forward tacacgtacttagtcgctgaagctcttcTtggCTGCTGCACCTG 32 (R202W) TCTG Monomer Reverse gtacgaactcgattgacggctcttcAccaGCCTTGGAAGCC 33 (R202W) AAAGGC
[0138] Whether each gene was inserted or not and sequence verification was confirmed through gene sequencing (requested by Cosmogenetech).
[0139] 1-3. Transfection and Production of RACE Using First Vector, Second Vector, and Third Vector
[0140] For transfection and expression of RACE, Freestyle293F cells prepared in Experimental Example 1 were used. The Freestyle293F cell line was prepared at a concentration of 1×10.sup.6/ml, 24 hours before transfection. The cells were transfected using Fectopro (Polyplus, 116-010) reagent and the first, second, and third vectors prepared above. More specifically, 1 μg of DNA (the first vector, the second vector, and the third vector were mixed in a volume ratio of 1:1:2) and 1 μl of Fectopro reagent were added per 1 ml of the cell line. After additionally suspension culture of the transiently transfected cells for 5 days (37° C., 8% CO.sub.2, 120 RPM), the supernatant containing the secreted protein was separated by centrifugation at 1500 g for 30 minutes. The separated supernatant was refrigerated for up to 3 days for subsequent purification.
Example 2. Purification and Purity Analysis of RACE
[0141] RACE was purified from the supernatant obtained in Examples 1-3 using AKTA go (Cytiva) and affinity chromatography. Affinity chromatography was performed using a CH1-xL column (Thermo). The washing solution (PBS, pH 7.4) and the elution solution (100 mM sodium acetate pH 4.0) used for chromatography were prepared immediately before use, filtered, and used after measuring the pH. Among the fractions obtained by eluting, the fraction containing the protein was collected together, and it was dialyzed through an Amicon® Ultra (30 kda, 15 ml) filter using a PBS solution and stored.
[0142] For purity analysis of purified RACE, size exclusion chromatography (PL1580-3250, Agilent) was performed using high-performance liquid chromatography (HPLC, Agilent 1260). The approximate protein size prediction through size exclusion chromatography was determined by testing using a standard protein (5190-2242, Agilent) having known size. A buffer solution of 150 mM sodium phosphate pH 7.0 was used for purity analysis.
[0143] As a result, as shown in
[0144] In addition, when knob-into-hole (Q94S/R202W) was applied in rituximab-41BBL (RACE-01C) according to the present invention, as shown in
Example 3. Structural Analysis of RACE
[0145] The structure of the 4-1BBL trimer domain was analyzed using Pymol software (https://pymol.org/2/) based on the structure of the human 4-1BBL protein complex (PDB code: 6A3V, 2X29).
[0146] As a result, as shown in
Example 4. Confirmation of Effect of Mismatch on Trimer Formation
[0147] In the 4-1BB ligand bound to RACE according to the present invention, the effect of the knob-into-hole structure application on the protein hinge was confirmed by disulfide bond analysis through LC (Vanquish, Thermo) and MS (Q Exactive Plus, Thermo). For protein fragment formation, analysis samples and standard samples at a concentration of 1 mg/ml, for example, endoproteinase Lys-C(Sigma, USA), and chymotrypsin (Promega), Glu-C(Promega, Sequencing Grade) were used.
[0148] The analysis sample was prepared as follows. For the second vector (antibody heavy chain-monomer) and third vector (antibody light chain) of Examples 1-2, rituximab was used as the antibody, and the native type 4-1BBL as the monomer to prepare the recombinant vector. After the prepared recombinant vector was simultaneously transfected into Freestyle293F cells in the same manner as in Example 1-3 above, the supernatant of the cells overexpressing the protein was obtained. The analysis sample was a protein made from RACE heavy chain monomer and a light chain having a native 4-1BBL sequence and had a structure of a RACE trimer having a total of three antibody-binding fragments (Fab) and a hinge region. At this time, the pattern of abnormal disulfide bonds in the protein hinge was observed to confirm the effect of dimerization of the hinge through the knob-into-hole structure on structural stability and homogeneity.
[0149] In addition, to confirm the characteristics of the protein multimerized by disulfide bonds, electrophoresis (Mini-protein tetra, Bio-Rad) was performed using SDS-PAGE (Sodium dodecyl sulphate polyacrylamide gel). At this time, the size of each protein was compared under reducing and non-reducing conditions. After the electrophoresis was completed, the gel was stained with Coomassie-blue reagent, and the results were analyzed using LAS-500 (Cytiva).
[0150] As shown in
Example 5. Fusion Protein (RACE) Prepared by Linking Antibody Domain and Cytokine Trimer and Characteristic Analysis Thereof
[0151] 5-1. Size Analysis
[0152] Various types of antigen-binding fragments can be bound to the fusion protein (RACE) platform prepared in Example 1 depending on the purpose, and a structural schematic diagram of RACE bound to an antibody domain is shown in
[0153] In addition, the domain structure of RACE is shown in
[0154] 5-2. Thermal Shift Assay (TSA)
[0155] Measurement of stability and melting temperature (Tm) of RACE was performed with reference to standard test methods using SYPRO™ Orange (S6650, Thermo) reagent.
[0156] The thermodynamic stabilities of rituximab-41BBL (RACE-01C) and its parent antibody, rituximab, were compared, and the thermodynamic stabilities of trastuzumab-41BBL (RACE-02C) and its parent antibody, trastuzumab, were compared, and the results are shown in
[0157] 5-3. Binding Affinity Measurement
[0158] The binding of cetuximab-41BBL (RACE-02B) to antigen (EGFR) according to the present invention was confirmed using Biacore (Cytiva) using surface plasmon resonance (SPR). First, for the measurement of binding force, antigen EGFR (10001-H08H, Sino) or 4-1BB (10041-H08H, Sino) was immobilized on the surface of the sensor chip CM5 chip (29149604, Cytiva) through amine coupling. Afterward, a predetermined concentration of cetuximab-41BBL (RACE-02B) was added thereto. HEPES-buffered saline (HBS) buffer was used to confirm binding for 180 seconds and dissociation for 300 seconds.
[0159] As a result, as shown in
[0160] In addition, as shown in
[0161] 5-4. Confirmation of Simultaneous Binding Ability of RACE
[0162] In addition, the simultaneous binding ability of cetuximab-41BBL (RACE-02B) target according to the present invention was confirmed. As shown in the schematic diagram on the left of
[0163] As a result, it was confirmed that cetuximab-41BBL (RACE-02B) according to the present invention can bind to both targets at the same time, indicating that binding of each protein-expressed cell can be successfully induced.
[0164] 5-5. 4-1BB Reporter Assay
[0165] The degree of 4-1BB signaling by rituximab-41BBL (RACE-01C) according to the present invention was evaluated using the 4-1BB bioassay (J2332, Promega). The evaluation was performed according to the manufacturer's instructions, and in order to confirm the signal dependence on the target antigen, the CD20-expressing Raji B cell line of Experimental Example 1 was used. The relative value of the signal was measured with a GloMax® Discover Microplate Reader (GM30000, promega) using a GloMax® (Promega).
[0166] As a result, as shown in
Example 6. Confirmation of RACE Signaling Mediated Process in Solid Cancer Cells
[0167] The signaling mediated process of the fusion protein according to the present invention in solid cancer cells was confirmed. For this purpose, as described in Experimental Example 1, the MDA-MB-231 cell line (breast cancer cell line) known to express very slightly Her2, and the PC-9 cell line (lung adenocarcinoma cell line), the HT-29 cell line (colon cancer cell line), and the SW480 cell line (colorectal cancer cell line) known to overexpress EGFR were treated with trastuzumab-41BBL (RACE-02C), cetuximab-41BBL (RACE-02B) or rituximab-41BBL (RACE-01C) according to the present invention in the same manner as in Example 5-5, and the degree of each 4-1BB signaling was evaluated.
[0168] The degree of on-target signaling and off-target signaling for the MDA-MB-231 cell line is shown in
[0169] As a result, it was possible to confirm signaling in proportion to the concentration upon treatment with cetuximab-41BBL (RACE-02B) for three types of cells overexpressing EGFR, but no signaling could be confirmed upon treatment with rituximab-41BBL (RACE-01C)-target-off for the CD20 protein, which is not expressed at all in each cell line. These results confirmed that there is no off-target toxicity, which has traditionally been a problem with 4-1BBL-targeted therapeutics.
[0170] In addition, it was confirmed that the fusion protein cetuximab-41BBL (RACE-02B) according to the present invention is specific to the target antigen and induces 4-1BB signaling to a much superior degree than Utomilumab, a 4-1BB aggregation antibody (
Example 7. Confirmation of Efficacy in Cancer-Induced Animal Models
[0171] The anticancer efficacy of cetuximab-41BBL (RACE-02B) was confirmed in a cancer-induced animal model. First, it was prepared to express human EGFR on the surface of mouse colorectal cancer cells (CT26) that grow spontaneously in Balb-c mice, and the hEGFR-CT26 cells (5×10.sup.5/100 μL) were subcutaneously transplanted into humanized mice (Balb-c) expressing the extracellular domain of human 4-1BB (commissioned for Gempharmatech). Antibodies from the following group were administered via a caudal vein in Q3D (once every 3 days), a total of 6 times, starting from when the transplanted tumor size reached 100 mm.sup.3 on average: control (5 mg/kg, human IgG (purchased from Sigma (14506)) and cetuximab-41BBL (RACE-02B) (0.5 mg/kg and 2 mg/kg). The size of the tumor in each experimental group (TV=0.5 a×b.sup.2) was measured twice a week with a caliper. In the above, a is the long axis of the tumor, and b is the short axis of the tumor.
[0172] As a result, as shown in
[0173] Overall, the present invention relates to a cytokine trimer domain in which a dimer in which a first monomer and a second monomer are linked by a linker and a third monomer are coupled by a knob-into-hole and a novel type of fusion protein (RACE) in which an antibody and a cytokine trimer domain are connected, which is produced by replacing a constant region (Fc) of an antibody with the cytokine trimer domain. Thus, it was confirmed that the cytokine trimer domain bound with the knob-into-hole according to the present invention showed much stronger binding ability than the aggregation antibody to the 4-1BB receptor, and the fusion protein containing the same showed the excellent binding ability to both targets, thereby confirming that each target (protein) can successfully induce the binding of the expressed cells.