Compositions, methods, and therapeutic uses related to fusogenic protein minion
11339209 · 2022-05-24
Assignee
Inventors
- Stephane Corbel (San Diego, CA, US)
- Srihari Cidambi Sampath (San Diego, CA, US)
- Srinath Cidambi Sampath (San Diego, CA, US)
- Christian Schmedt (San Diego, CA, US)
- Qiao Zhang (San Diego, CA, US)
Cpc classification
C07K2319/20
CHEMISTRY; METALLURGY
C12N5/0658
CHEMISTRY; METALLURGY
A61K2039/892
HUMAN NECESSITIES
C07K2319/60
CHEMISTRY; METALLURGY
A61K39/001102
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C12N15/02
CHEMISTRY; METALLURGY
A61K9/127
HUMAN NECESSITIES
C12N2740/10043
CHEMISTRY; METALLURGY
C07K2319/61
CHEMISTRY; METALLURGY
C07K2319/40
CHEMISTRY; METALLURGY
A61P21/00
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61P35/00
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K9/127
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N15/02
CHEMISTRY; METALLURGY
A61P21/00
HUMAN NECESSITIES
C12N15/113
CHEMISTRY; METALLURGY
Abstract
The invention provides novel compositions, methods, and therapeutic uses related to fusogenic protein MINION (microprotein inducer of fusion).
Claims
1. An expression vector comprising a nucleic acid encoding a polypeptide comprising an amino acid sequence selected from any of SEQ ID NO: 1, 3, 9, 11, 13, and 15, further comprising a second nucleic acid encoding a Myomaker polypeptide.
2. The vector of claim 1, wherein the nucleic acid comprises SEQ ID NO: 2 or SEQ ID NO: 4.
3. The vector of claim 1, wherein the second nucleic acid encodes a Myomaker polypeptide comprising an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, and 30.
4. The vector of claim 1, wherein the vector is selected from a plasmid, a cosmid, an RNA, and a viral vector.
5. The vector of claim 4, wherein the viral vector is based on any of the following viruses: adenovirus, adeno-associated virus, Herpes Simplex Virus (HSV), parvovirus, retrovirus, lentivirus, vaccinia virus, Sinbis virus, influenza virus, reovirus, Newcastle disease virus (NDV), measles virus, vesicular stomatitis virus (VSV), poliovirus, poxvirus, Seneca Valley virus, coxsackievirus, enterovirus, myxoma virus, or maraba virus.
6. A liposome comprising a polypeptide comprising an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, and 15, further comprising a Myomaker polypeptide.
7. The liposome of claim 6, wherein the Myomaker polypeptide comprises an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, and 30.
8. The liposome of claim 6, further comprising a therapeutic agent, wherein the therapeutic agent is encapsulated in the liposome.
9. The liposome of claim 8, wherein the therapeutic agent is selected from a nucleic acid, a protein, a low molecular weight compound, and a peptide nucleic acid.
10. A method of delivering a therapeutic agent to a cell, the method comprising contacting the liposome of claim 8 with the cell, wherein the liposome fuses with the cell and thereby delivers the therapeutic agent to the cell.
11. The method of claim 10, wherein the cell is a human cell.
12. The method of claim 10, wherein the cell is a tumor cell.
13. The method of claim 10, wherein the method is performed in vitro.
14. The method of claim 10, wherein the method is performed in vivo.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
DETAILED DESCRIPTION
(31) The present invention is based, at least in part, on the findings that microprotein MINION is required for fusion of muscle progenitor cells and skeletal muscle development, and that heterologous co-expression of MINION and Myomaker is sufficient to induce rapid and homogeneous cellular fusion even in non-muscle cells. The human ortholog of mouse MINION has not been reported before. As described herein, the present inventors identified the amino acid and cDNA sequences of human ortholog of MINION and found human MINION protein also has fusogenic activity, suggesting an evolutionarily conserved role for MINION protein in cell fusion. Accordingly, provided herein are compositions, methods, and therapeutic uses related to fusogenic protein MINION.
Definitions
(32) The terms “human MINION protein” and “human MINION microprotein” are used interchangeably herein (also known as microprotein inducer of fusion, Gm7325, ESGP, embryonic stem cell and germ cell specific protein, or EG653016) and refer to a protein having the amino acid sequence of SEQ ID NO: 1 (isoform 1) or SEQ ID NO: 3 (isoform 2). A “human MINION polypeptide” refers to a naturally occurring human MINION microprotein (e.g., the protein of SEQ ID NO: 1 or SEQ ID NO: 3) or a variant thereof. The protein and cDNA sequences of human MINION isoform 1 or isoform 2 are provided in Table 1 below.
(33) TABLE-US-00001 TABLE 1 MINION amino acid and nucleotide sequences SPECIES ISOFORM SEQ ID NO SEQUENCE Homo sapiens MINION 1 MPTPLLPLLLRLLLSRLLLPAARLARQYLLPLLRRLARRLGSQ isoform 1 DMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK amino acid Homo sapiens MINION 2 gagactgattctgagcagcagactgcccggcactgactcactg isoform 1 gccctgccATGCCCACGCCACTGCTCCCGCTGCTGCTTCGATT cDNA GCTGCTGTCCCGCCTGCTGCTGCCTGCTGCCCGCCTGGCCCGC CAATACCTCCTGCCCCTGCTGCGCCGATTGGCCCGCCGCCTGG GCTCCCAGGACATGCGAGAGGCTTTGCTGGGCTGTCTGCTGTT CATTCTCAGCCAGCGACACTCGCCAGACGCTGGGGAGGCCTCA AGAGTGGACCGCCTGGAGAGGAGGGAGAGGTTAGGCCCCCAAA AGTGAggccacaagtcctggcagcagctgtatccacaaaatgc tacttaggagtaggataaGActggcaccagcactgaccgaagc ctgcccagtggacagaagatatagtgagggagtgcatgagagg gatctgccacagacatgcctctccactcccaacagaaatgtct actggaagaatgcatgcatctagcacaaaactgattattgccc ctctgtcctccagcagacctcccaaagaccactcctaatcacc tctggcctcaggcgggaggggaactaacacccacccacccctg ccctccctgcaaatgggaacatcaaggacccagtgcttaactg agggacaagtgacaatttagcagagaggcaagatttgaatcca gactgtatccagactcaggacctaccttaaaataatatctgag agcCtatggaggcagacctgcctgcaaagcccagcactcagca agtgctcaataaatatttgatttgaattattc (ORF in uppercase) Homo sapiens MINION 3 MPTPLLPLLLRLLLSCLLLPAARLARQYLLPLLRRLARRLGSQ isoform 2 DMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK amino acid Homo sapiens MINION 4 gagactgattctgagcagcagactgcccggcactgactcactg isoform 2 gccctgccATGCCCACGCCACTGCTCCCGCTGCTGCTTCGATT cDNA GCTGCTGTCCTGCCTGCTGCTGCCTGCTGCCCGCCTGGCCCGC CAATACCTCCTGCCCCTGCTGCGCCGATTGGCCCGCCGCCTGG GCTCCCAGGACATGCGAGAGGCTTTGCTGGGCTGTCTGCTGTT CATTCTCAGCCAGCGACACTCGCCAGACGCTGGGGAGGCCTCA AGAGTGGACCGCCTGGAGAGGAGGGAGAGGTTAGGCCCCCAAA AGTGAggccacaagtcctggcagcagctgtatccacaaaatgc tacttaggagtaggataatcctggcaccagcactgaccgaagc ctgcccagtggacagaagatatagtgagggagtgcatgagagg gatctgccacagacatgcctctccactcccaacagaaatgtct actggaagaatgccagcatctagcacaaaactgattattgccc ctctgtcctccagcagacctcccaaagaccactcctaatcacc tctggcctcaggcgggaggggaactaacacccacccacccctg ccctccctgcaaatgggaacatcaaggacccagtgcttaactg agggacaagtgacaatttagcagagaggcaagatttgaatcca gactgtatccagactcaggacctaccttaaaataatatctgag agcttatggaggcagacctgcctgcaaagcccagcactcagca agtgctcaataaatatttgatttgaattattc (GenBank Accession No. NM_001315494.1; ORF in uppercase) Mus musculus MINION 5 MPVPLLPMVLRSLLSRLLLPVARLARQHLLPLLRRLARRLSSQ isoform 1 DMREALLSCLLFVLSQQQPPDSGEASRVDHSQRKERLGPQK amino acid (GenBank Accession No. NP_001170939.1) Mus musculus MINION 6 gaaattgattctgagcagactgactggtgagagctgccactgg isoform 1 ccggttagaactggtgagcaggagggcaagaagttcaggcttc cDNA aggtgcaggtcctgccATGCCCGTTCCATTGCTCCCGATGGTG CTTCGATCGCTGCTGTCCCGCCTGCTGCTGCCTGTTGCCCGCC TGGCCCGGCAGCACCTCCTGCCCTTGCTGCGCCGGCTGGCCCG CCGACTGAGCTCCCAAGACATGAGAGAGGCTCTGCTGAGCTGT CTGCTCTTTGTCCTCAGCCAGCAACAGCCACCGGATTCTGGAG AGGCCTCCAGAGTGGACCACTCCCAGAGGAAGGAGAGATTGGG CCCCCAGAAGTGAggccacgggtcctggaaacagcaacgccca tcaaagtacttaggagccggttagtccaggcgtcggtccgcac gcacgggcatggacggcagactgcccagtgggcgaagacagtc cgggctgagtgcaagagggctctgacctgaacagacccactcc cctagctcctagcaggctacagattgtgagattgaccatcctc tctgcagctccctctgccttatctctggcctccagggtggacc tgcaaatgcgggtatcaaggtcagttaagagatgatgatcact tagactcaagacaatttagctaagaggtggtatttaaatccaa actgtcccgtctaccttaaaattataagccatgatcccgttaa agaatgagtactacaaagatggtacgcagcaggtagtcaataa acgaggacagtgtgagttattgg (GenBank Accession No. NM_001177468.1; ORF in uppercase) Mus musculus MINION 7 MPEESCTVKLIQLKTGEYRGAGPAMPVPLLPMVLRSLLSRLLL isoform 2 PVARLARQHLLPLLRRLARRLSSQDMREALLSCLLFVLSQQQP amino acid PDSGEASRVDHSQRKERLGPQK (GenBank Accession No. NP_001170941.1) Mus musculus MINION 8 agtccccaccaccaccagccctgggctccatcccatctgtgat isoform 2 aacagtgagtgaactccttaaccagattcATGCCAGAAGAAAG cDNA CTGCACTGTAAAACTAATCCAGTTGAAAACTGGGGAGTACAGA GGTGCAGGTCCTGCCATGCCCGTTCCATTGCTCCCGATGGTGC TTCGATCGCTGCTGTCCCGCCTGCTGCTGCCTGTTGCCCGCCT GGCCCGGCAGCACCTCCTGCCCTTGCTGCGCCGGCTGGCCCGC CGACTGAGCTCCCAAGACATGAGAGAGGCTCTGCTGAGCTGTC TGCTCTTTGTCCTCAGCCAGCAACAGCCACCGGATTCTGGAGA GGCCTCCAGAGTGGACCACTCCCAGAGGAAGGAGAGATTGGGC CCCCAGAAGTGAggccacgggtcctggaaacagcaacgcccat caaagtacttaggagccggttagtccaggcgtcggtccgcacg cacgggcatggacggcagactgcccagtgggcgaagacagtcc gggctgagtgcaagagggctctgacctgaacagacccactccc ctagctcctagcaggctacagattgtgagattgaccatcctct ctgcagctccctctgccttatctctggcctccagggtggacct gcaaatgcgggtatcaaggtcagttaagagatgatgatcactt agactcaagacaatttagctaagaggtggtatttaaatccaaa ctgtcccgtctaccttaaaattataagccatgatcccgttaaa gaatgagtactacaaagatggtacgcagcaggtagtcaataaa cgaggacagtgtgttgttattgg (GenBank Accession No. NM_001177470.1; ORF in uppercase) Rattus MINION 9 MPVPLLPLMLRSLLSRLLLPVARLARQHLLPLLRRLARRLSSQ norvegicus cDNA DVREALLSCLLFVLSQQQPPDSGETSRVDHSQRKERLGPRK Rattus MINION 10 ggtcctggtcctgccATGCCCGTTCCACTGCTCCCGTTGATGC norvegicus cDNA TTCGATCGCTGCTATCACGCCTGCTGCTGCCTGTTGCCCGCCT GGCCCGTCAGCACCTCCTGCCCTTGCTGCGCCGTCTGGCCCGC CGACTGAGCTCCCAAGACGTGAGAGAGGCTTTGCTGAGCTGTC TGCTGTTTGTCCTCAGCCAACAACAGCCACCGGATTCTGGAGA GACCTCTAGAGTGGACCACTCCCAGAGGAAGGAGAGATTGGGT CCCCGGAAGTGA (ORF in uppercase) Felis catus MINION 11 MPAPLLPLLLRTLMSRLLLPATRLARRHLLPLLRRLARRLGSQ cDNA DVREALLGCLLFILSQSRPPDAEEVSRVAGQERRERLAPPK Felis catus MINION 12 ATGCCCGCTCCACTGCTCCCACTGCTGCTTCGAACCCTGATGT cDNA CCCGCTTGCTGCTGCCTGCCACCCGCCTGGCCCGCCGGCACCT CCTGCCCCTCCTGCGCCGACTGGCCCGCCGCCTGGGCTCGCAG GATGTTCGAGAAGCTTTGCTGGGCTGTCTGTTGTTCATCCTCA GCCAGAGCCGCCCGCCCGACGCTGAGGAGGTCTCCAGAGTGGC TGGCCAGGAGAGGAGGGAGAGGCTAGCTCCCCCAAAATGA (ORF in uppercase) Sus scrofa MINION 13 MPAPLLPLLLRTLLARLLLPAARLARRHLLPLLRRLARRLGSQ amino acid DMREALLGCLVFLLSQRHPPDDAAAAGEASRVARLERRERIVS QK Sus scrofa MINION 14 ATGCCCGCTCCGCTGCTCCCGCTGCTGCTGCGAACGCTGCTGG cDNA CCCGCCTGCTGCTGCCCGCTGCCCGCCTGGCCCGTCGGCACCT CCTGCCTCTGCTGCGCCGGCTGGCCCGCCGCCTGGGCTCCCAG GATATGCGAGAGGCTTTACTGGGCTGTCTGGTGTTCCTCCTCA GCCAGAGACACCCGCCAGATGATGCCGCTGCTGCCGGGGAGGC CTCCAGAGTGGCCCGCCTGGAGAGGAGGGAGAGGATAGTTTCT CAAAAA (ORF in uppercase) Macaca MINION 15 MPAPLFPLLLRLLLSRLLLPVARLARQYLLPLLRRLARRLGSQ mulatta amino acid DMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK
(34) A “mouse MINION polypeptide” refers to a naturally occurring mouse MINION protein or a variant thereof. Two naturally occurring mouse MINION protein isoforms (SEQ ID NO: 5 and SEQ ID NO: 7) have been reported. The amino acid and nucleotide sequences of mouse MINION isoforms are shown in Table 1. Table 1 also provides MINION sequences of other species, e.g., rat (R. norvegicus), monkey (M. mulatta), cat (F. catus), and pig (S. scrofa).
(35) The term “a MINION polypeptide” is used to refer collectively to all naturally occurring isoforms of a MINION protein of any species, or a variant thereof. For example, a “MINION polypeptide” can be any MINION polypeptide listed in Table 1 or a variant thereof.
(36) Myomaker (also known as Tmem8c or Tmem226) is a transmembrane protein specifically expressed in muscle cells. A “human Myomaker polypeptide” refers to a naturally occurring human Myomaker protein (e.g., the protein of SEQ ID NO: 16) or a variant thereof. Human Myomaker protein and mRNA sequences are provided in Table 2.
(37) TABLE-US-00002 TABLE 2 Myomaker amino acid and nucleotide sequences SPECIES ISOFORM SEQ ID NO SEQUENCE Homo sapiens Myomaker 16 MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPG amino acid LSVLCFMRHDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRI YHDRWGYGVYSGPIGTAILIIAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGA LALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAKLDCSTL CCACV (GenBank Accession No. NP_001073952.1) Homo sapiens Myomaker 17 gccctgccca aagggagctg gccttcccac ttcgtgctcc tgtgctgggg cDNA acctgggaca ccagcaccct ccccacccca gccagtgctt tcctcctggc ccatggggac gctggtggcc aagctgctcc tgcccaccct cagcagcctg gccttcctcc ccactgtcag catcgcggcc aagaggcggt tccacatgga ggccatggtc tacctcttca ccctgttctt cgtggcgctc caccatgcct gcaatggacc cggcttgtct gtgctgtgct tcatgcgtca cgacatcctg gagtatttca gtgtctacgg gacagccctg agcatgtggg tctcgctgat ggcactggcc gacttcgacg aacccaagag gtcaacattt gtgatgttcg gcgtcctgac cattgctgtg cggatctacc atgaccgatg gggctacggg gtgtactcgg gccccatcgg cacagccatc ctcatcatcg cggcaaagtg gctacagaag atgaaggaga agaagggcct gtacccagac aagagcgtct acacccagca gataggcccc ggcctctgct tcggggcgct ggccctgatg ctacgcttct tctttgagga ctgggactac acttatgtcc acagcttcta ccactgtgcc ctggctatgt cctttgttct gctgctgccc aaggtcaaca agaaggctgg atccccgggg accccggcca agctggactg ctccaccctg tgctgtgctt gtgtctgatg ctgcgcccag cccggctctg agcccctgcc ctccccagct cacacttg (GenBank Accession No. NM_001080483.2) Mus musculus Myomaker 18 MGTVVAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVAFSHACDGPG isoform 1 LSVLCFMRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTIAVRT amino acid FHDRWGYGVYSGPIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQIGPGLCFGA LALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAGNAGAPAKLTFSTL CCTCV (GenBank Accession No. NP_079652.1) Mus musculus Myomaker 19 gagcacttaa gccctccttg tgggtgctgc cacagctgcg gtcagggctg isoform 1 ctggagaagc aaagaagtgg gctctttttc ttcctgccct ggagaccagg cDNA ggggccttta ccaccttctc cccagtcagt gccttcctcc tggtccatgg ggacagttgt agccaaactg ctcctgccta ccctcagcag cctggccttc ctcccgacag tgagcatcgc taccaagagg cgtttctaca tggaggccat ggtctacctc ttcaccatgt tctttgtggc gttctcccat gcctgtgatg ggcctggttt gtctgtgctg tgcttcatgc gccgtgacat tctggagtac ttcagcatct atggaacagc cctgagcatg tgggtctccc tgatggcact ggccgacttt gatgaacccc agagatcgac cttcacaatg cttggcgtcc ttaccatcgc tgtgcggact tttcatgacc gctggggtta cggggtatac tccggtccca taggcacggc caccctcatc attgctgtaa agtggctgaa gaagatgaaa gagaagaagg gcctgtaccc cgacaagagc atctacaccc agcagatagg ccccggcctg tgctttgggg ccctggccct gatgcttcga ttcttctttg aggaatggga ttacacctac gtccacagct tctaccactg tgccctggcc atgtcctttg tcctgctgct gcccaaggtc aacaagaagg ctgggaacgc aggggccccc gccaagctga ccttctccac cctctgctgc acttgtgtct gactataccc ccccacacac acacacacac caggcccctg ccttcctgcc tggcagtcct gctgtctctc ccaaggtact tcctatactt tgttatgcgg cctgtacatg agaaatggtc ttctctacac cccaagagac cagcaggcct gctgcattct gctgagtgct gcttagggac ccactggttc tgtgttcacc agttgcttca ctctgttcag gaaaaaaaag aactttatcc cccaaggcct cacaaccata ggtgtgcctg gcagagaacc ctagaccagt aaatacccag cagcatgcag ggttatctat ttcccaggtc ctgcctgtca gaatcgtctg ctttccctag gaaactggga ttgccctttt aacccctgcc caggctctga aagctctcca cttaggaagc tggagccagc gaaccttgca tacccctgcc tgagtcccat cccttctgca ggttttcgat caagccattc acagtaaact cttgatcagc cactagtcat tagcttcgcc taacatacat tctagttcct ggaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa a (GenBank Accession No. NM_025376.3) Mus musculus Myomaker 20 MGKGFSHACDGPGLSVLCFMRRDILEYFSIYGTALSMWVSLMALADFDEPQRST isoform 2 FTMLGVLTIAVRTFHDRWGYGVYSGPIGTATLIIAVKWLKKMKEKKGLYPDKSI amino acid YTQQIGPGLCFGALALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAG NAGAPAKLTFSTLCCTCV (GenBank Accession No. NP_001153074.1) Mus musculus Myomaker 21 atcagcactt gcttgggggg aatctaaggg cttcctcttt tatggagaga isoform 2 caggggtcca ggataaaagg ctcctatgca aagactggca taggaatgtg cDNA tacactttca gtcagtcatg ggcaaaggtt tctcccatgc ctgtgatggg cctggtttgt ctgtgctgtg cttcatgcgc cgtgacattc tggagtactt cagcatctat ggaacagccc tgagcatgtg ggtctccctg atggcactgg ccgactttga tgaaccccag agatcgacct tcacaatgct tggcgtcctt accatcgctg tgcggacttt tcatgaccgc tggggttacg gggtatactc cggtcccata ggcacggcca ccctcatcat tgctgtaaag tggctgaaga agatgaaaga gaagaagggc ctgtaccccg acaagagcat ctacacccag cagataggcc ccggcctgtg ctttggggcc ctggccctga tgcttcgatt cttctttgag gaatgggatt acacctacgt ccacagcttc taccactgtg ccctggccat gtcctttgtc ctgctgctgc ccaaggtcaa caagaaggct gggaacgcag gggcccccgc caagctgacc ttctccaccc tctgctgcac ttgtgtctga ctataccccc ccacacacac acacacacca ggcccctgcc ttcctgcctg gcagtcctgc tgtctctccc aaggtacttc ctatactttg ttatgcggcc tgtacatgag aaatggtctt ctctacaccc caagagacca gcaggcctgc tgcattctgc tgagtgctgc ttagggaccc actggttctg tgttcaccag ttgcttcact ctgttcagga aaaaaaagaa ctttatcccc caaggcctca caaccatagg tgtgcctggc agagaaccct agaccagtaa atacccagca gcatgcaggg ttatctattt cccaggtcct gcctgtcaga atcgtctgct ttccctagga aactgggatt gcccttttaa cccctgccca ggctctgaaa gctctccact taggaagctg gagccagcga accttgcata cccctgcctg agtcccatcc cttctgcagg ttttcgatca agccattcac agtaaactct tgatcagcca ctagtcatta gcttcgccta acatacattc tagttcctgg aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa (GenBank Accession No. NM_001159602.1) Rattus Myomaker 22 MGLHLRSQLLPLRPGHVLRPAAAQGQQEGWERRGPRQADLLHSLLHLCLTVAPL norvegicus amino acid LQAPAFLSGSPAVSPGILPTLSQWNVHEEWPPLHPERPAGLLQSAKCCLGTHEF CVHQLLHSIQEKKERELYPPRLHNHRCALQSPRPVSIGPKSQPSSVHNSSIRVI YFPGPACQDCLPFLGNWDCPFYPCPGPESSQFRELDPVSPVPVWTQAWCPCLSP IPSAVFRSSHSQ (GenBank Accession No. NP_001127989.1) Rattus Myomaker 23 gcatcagctg ttggaccttc tccatgtgtc actgggcaca tgctgcctca norvegicus cDNA gagcacttaa gccctcctcg tgggcgctgc cacagctgcg gcaagggttg ctgaagaaga gaagtgggct ctatttttcc ctgccctgga gaccaaggag gccttcacta ccttctcccc tgccagtgcc ttcttcctgg cccatgggga cagttgtagc caaactgctc ctgcctaccc tcagcagcct ggccttcctc cccacagtga gcattgctac caagcggcgt ttttacatgg aggccatgat ctatctcttc accatgttct ttgtggcgtt ctcccatgcc tgcgacgggc ctggcttgtc cgtgctatgc ttcatgcgcc gtgatattct ggagtacttc agcatctatg ggacagccct gagcatgtgg gtctccctga tggcactggc cgactttgat gaaccccaga gatcaacctt cacgatgttt ggtgtcctta ccattgccgt gcggacttac catgaccact ggggctacgg ggtgtactct ggtcccatag gcaccgccac cctcatcatt gcagtaaagt ggctgaagaa gatgaaagag aagaagggtc tgtaccctga caagagcatc tacacccagc agataggtcc cggcctctgc tttggggccc tggccctgat gcttcgcttc ttctttgagg aatgggatta cacctacgtt cacagcttct accactgcgc cctggccatg tccttcgtcc tgctgctgcc caaggtcaac aagaaggctg ggaacgcagg ggaccccgcc aagctgacct tctccactct ctgctgcact tgtgtctgac agtagccccc ctgctccagg cccctgcctt cctgtctggc agccctgctg tctctcccgg gatacttcct acactttccc agtggaatgt ccatgaggaa tggcctcctc tgcaccccga gagaccagca gggctgctgc agtcggcgaa gtgctgctta gggacccacg aattctgtgt tcaccagttg cttcactcta ttcaggaaaa aaaagagaga gaactttatc ccccaaggct gcataaccat aggtgtgcct tgcagagccc taggccagtc agtattggcc ccaagtcaca acccagcagt gtacacaaca gcagcatacg ggttatctat ttcccaggcc ctgcctgcca ggattgtctg cctttcctag gaaactggga ttgccctttc tacccctgcc caggccctga aagctcccag tttcgggagc tggacccagt gagcccagtt ccagtctgga cccaggcttg gtgcccctgc ctgagtccca tcccttcagc agtttttcgg tcgagccact cacagtaaac tcttgatcag tcactagt (GenBank Accession No. NM_001134517.1) Felis catus Myomaker 24 MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTMFFVAFHHACNGPG isoform 1 LSVLCFMRHDVLEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRI amino acid YHDRWGYGVYSGPIGVAVLVIATKWLQLMKEKKGLYPDKSVYTQQIGPGLCFGA LALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSAGPPAKLNCPAL CCACV (GenBank Accession No. XP_006939684.1) Felis catus Myomaker 25 tcggagcccc caccgaacgg agcaggcctc gtcccttccg tgttctctgc isoform 1 cctggggacc cgggcggccc gcaccctccc ctcctcccca accggcgccc cDNA tcctccctgg cccatgggga cgctcgtggc aaagctgctc ctccccaccc tcagcagcct ggctttcctc cccacggtca gcatcgctgc caagcgccgc ttccacatgg aggccatggt ctacctgttc accatgttct tcgtggcgtt ccaccacgcc tgcaacgggc ccggcctgtc agtcctctgc ttcatgcgcc acgacgtcct ggagtacttc agcgtctacg ggacagcgct gagcatgtgg gtctcactga tggcgctggc cgacttcgac gaacccaaga ggtcgacctt tgtgatgttt ggcgtcctga ccatcgcggt ccggatctac cacgaccgct ggggctatgg cgtgtactcg ggccccattg gcgtggctgt ccttgtcatc gccaccaagt ggctgcagct catgaaggag aagaagggtc tgtaccccga caagagcgtc tacacccagc agataggccc cggcctctgt ttcggggcgc tggccctcat gttacgattc ttctttgagg attgggatta cacctacgtg cacagtttct accactgcgc gctggccatg tcctttgtcc tcctgctgcc caaggtcaac aagaaggccg gaagcgcggg gccccccgcc aagctgaact gccccgccct ctgctgtgct tgcgtctgac cgcgcgccgc gcccgccccc tgccccctgc cagcccctgc cctgccgcat ctcccgcctg cggagagacc cccatggccc ccccccccgg ctctgagcac ccaggagaaa tgtctcccct cagagggatt tggggagcat cctgccaagg gctgctggga gcccacttac taggtttcta cggagcacaa accaccgtgc tggaaggaaa aggacttcct gccccgctcc tgctccccca cagtcatggc cagtctgcgt ccgcaggacc ccacagccaa catgggtccc cccaccccgt ccccctttcc tcctcaccca gccacaaagg gactctgccc atgcccccct cacaacaccc gtctcctcct ggaccctggt tgtcaccgct tctgtcctgt gccctcgggc tctgagcaga cccgtgtagg aagccaaggc cagtggggac cggctctgtc caggcctgct ggccgtccct ccagccgggt ccctgaatca agccctgtca gttacggcag cccacaggaa gctcctcagc ccttgacctt cccgtgtgcc agaggccgta tgatcatcgc ttcatctaat tcgtgaaaca agtctgcatt aaaggatgat cactcccttc tacagacaga agcccgaggc gcagggtcca tggggtgccc gaggcctcga gcaggcgagt gcagacccgg gccaggcccg ccgccaccaa gcccgccccc tcgctgtgca gccgcccacg ggctgggcgc gagcacctgt gttggccctt cgagcggctc caccctgggc taacggccag cgtgggaagg gggtctgggc ccagggacac ccgcgcggag gccagcgggc ccggagccgg gcgcacgggg caggcttgcg gcagcgctga gggagggcgg ccggctcccg cctacagccc gtctgtgctg ggccccgcga gggtgggggc cggcctccca gacatcacct cacaaacctg agcctcccca gcagccccag cccaccccag cttcccgaac gatgtgggca catctgtcag gcaggaagtt acctacacct gtctggggcc cgttttgtgt ttccagacgg tgcaccccca cccccaccgc acggggcggc cccttatttg tcctgaagtc acctcttgct cccctcaggg ggccgggaga gagctgggga caaggctggc ccctcggcga ggcacccccg gtctgtcggc ctccctgact gtccagaggt cccacgcgtg gggcccggac gcccacagtc tcactctggc tcagcccctt cctgagccta cagactggat gacagagcag cctctgggca gctcgcacgg gctcggagtc ctggccgggc cccggggagc aggcctcagc ctcgctctgc ttcccagttg aggaagctga gcccacagct tcggggtcgt cctcccagac ggacatgtcc ccgcatcccc cgcccggcgc agggacgggc agaagccgct tccgttggct tctggtccgg ttgaggggtg tgcacacaca ggtgcccgct cacaccgtga agagataggg ccccctggaa acagcatcgt cctgtccggc ctgtctccca gctccgcgag gggagacacc gggcaggaag gaaagcgaag gctgtggggg ccacgcgggg ggcccgcggg catcactctg gaagcaggcc tctgccagtc gcctccctcc ccgtcacctc cctcccatcc cctcccccgt gcccccccca cacacacacc cgacgagcac atcccagctc ccagctccgc ggcagcagat ggaaagttgg aggccgcggg atgctcctga gcagggagga ggtgaggggc cggccaagag cgttaaggac catactaaca ggctactcac tgcggccacg ctgatttatg aggccgtctg ggagcccagc caagtctgta agtcatggac aattaggagg ctcgctccag ccctcagccc cgtccgcctc tggggctcta ggcccaccgc gcccctcctc agcagggtca gcaccgtgga gaccccacgg tgcagatagg gacacggagg gccgggaggc cggcggccgg ccccggtgac ttggacactg ggtgctgagc ggtggctgtg cccagggtct gactcctaac cctagcggca tcttcctctg cttccaaggc ccactttgac atcttggggg ctccagccaa gggccggtgg ggggagtgcc cgggaggggg acagaaagag aagaggacac ttggaacctc cagccctaca cctagagact aacaaggaag aaaagaagtc tcatggcctt cagaccaaac acctctgagt cccagtgtcc tcgagcccgg ggccttcgtg ccctacaatc cagcagtcat ggcatccggt gccaggaggg acctccgagg ccccccccag acccccctgg ggctctggac gggactcacc tccagccaga tctgatgagg gaagcctggg tcccgactcc agcgtgcgcc tggaagccga gcccgagatg atggcagccc cagagcagcc tgtgcagtag aacttgcttt aatgatggag gcgaggcggg ggcgcccggg gggct (GenBank Accession No. XM_006939622.2) Felis catus Myomaker 26 MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTMFFVAFHHACNGPG isoform 2 LSVLCFMRHDVLEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRI amino acid YHDRWGYGVYSGPIGVAVLVIATKWDWDYTYVHSFYHCALAMSFVLLLPKVNKK AGSAGPPAKLNCPALCCACV (GenBank Accession No. XP_011287016.1) Felis catus Myomaker 27 tcggagcccc caccgaacgg agcaggcctc gtcccttccg tgttctctgc isoform 2 cctggggacc cgggcggccc gcaccctccc ctcctcccca accggcgccc cDNA tcctccctgg cccatgggga cgctcgtggc aaagctgctc ctccccaccc tcagcagcct ggctttcctc cccacggtca gcatcgctgc caagcgccgc ttccacatgg aggccatggt ctacctgttc accatgttct tcgtggcgtt ccaccacgcc tgcaacgggc ccggcctgtc agtcctctgc ttcatgcgcc acgacgtcct ggagtacttc agcgtctacg ggacagcgct gagcatgtgg gtctcactga tggcgctggc cgacttcgac gaacccaaga ggtcgacctt tgtgatgttt ggcgtcctga ccatcgcggt ccggatctac cacgaccgct ggggctatgg cgtgtactcg ggccccattg gcgtggctgt ccttgtcatc gccaccaagt gggattggga ttacacctac gtgcacagtt tctaccactg cgcgctggcc atgtcctttg tcctcctgct gcccaaggtc aacaagaagg ccggaagcgc ggggcccccc gccaagctga actgccccgc cctctgctgt gcttgcgtct gaccgcgcgc cgcgcccgcc ccctgccccc tgccagcccc tgccctgccg catctcccgc ctgcggagag acccccatgg cccccccccc cggctctgag cacccaggag aaatgtctcc cctcagaggg atttggggag catcctgcca agggctgctg ggagcccact tactaggttt ctacggagca caaaccaccg tgctggaagg aaaaggactt cctgccccgc tcctgctccc ccacagtcat ggccagtctg cgtccgcagg accccacagc caacatgggt ccccccaccc cgtccccctt tcctcctcac ccagccacaa agggactctg cccatgcccc cctcacaaca cccgtctcct cctggaccct ggttgtcacc gcttctgtcc tgtgccctcg ggctctgagc agacccgtgt aggaagccaa ggccagtggg gaccggctct gtccaggcct gctggccgtc cctccagccg ggtccctgaa tcaagccctg tcagttacgg cagcccacag gaagctcctc agcccttgac cttcccgtgt gccagaggcc gtatgatcat cgcttcatct aattcgtgaa acaagtctgc attaaaggat gatcactccc ttctacagac agaagcccga ggcgcagggt ccatggggtg cccgaggcct cgagcaggcg agtgcagacc cgggccaggc ccgccgccac caagcccgcc ccctcgctgt gcagccgccc acgggctggg cgcgagcacc tgtgttggcc cttcgagcgg ctccaccctg ggctaacggc cagcgtggga agggggtctg ggcccaggga cacccgcgcg gaggccagcg ggcccggagc cgggcgcacg gggcaggctt gcggcagcgc tgagggaggg cggccggctc ccgcctacag cccgtctgtg ctgggccccg cgagggtggg ggccggcctc ccagacatca cctcacaaac ctgagcctcc ccagcagccc cagcccaccc cagcttcccg aacgatgtgg gcacatctgt caggcaggaa gttacctaca cctgtctggg gcccgttttg tgtttccaga cggtgcaccc ccacccccac cgcacggggc ggccccttat ttgtcctgaa gtcacctctt gctcccctca gggggccggg agagagctgg ggacaaggct ggcccctcgg cgaggcaccc ccggtctgtc ggcctccctg actgtccaga ggtcccacgc gtggggcccg gacgcccaca gtctcactct ggctcagccc cttcctgagc ctacagactg gatgacagag cagcctctgg gcagctcgca cgggctcgga gtcctggccg ggccccgggg agcaggcctc agcctcgctc tgcttcccag ttgaggaagc tgagcccaca gcttcggggt cgtcctccca gacggacatg tccccgcatc ccccgcccgg cgcagggacg ggcagaagcc gcttccgttg gcttctggtc cggttgaggg gtgtgcacac acaggtgccc gctcacaccg tgaagagata gggccccctg gaaacagcat cgtcctgtcc ggcctgtctc ccagctccgc gaggggagac accgggcagg aaggaaagcg aaggctgtgg gggccacgcg gggggcccgc gggcatcact ctggaagcag gcctctgcca gtcgcctccc tccccgtcac ctccctccca tcccctcccc cgtgcccccc ccacacacac acccgacgag cacatcccag ctcccagctc cgcggcagca gatggaaagt tggaggccgc gggatgctcc tgagcaggga ggaggtgagg ggccggccaa gagcgttaag gaccatacta acaggctact cactgcggcc acgctgattt atgaggccgt ctgggagccc agccaagtct gtaagtcatg gacaattagg aggctcgctc cagccctcag ccccgtccgc ctctggggct ctaggcccac cgcgcccctc ctcagcaggg tcagcaccgt ggagacccca cggtgcagat agggacacgg agggccggga ggccggcggc cggccccggt gacttggaca ctgggtgctg agcggtggct gtgcccaggg tctgactcct aaccctagcg gcatcttcct ctgcttccaa ggcccacttt gacatcttgg gggctccagc caagggccgg tggggggagt gcccgggagg gggacagaaa gagaagagga cacttggaac ctccagccct acacctagag actaacaagg aagaaaagaa gtctcatggc cttcagacca aacacctctg agtcccagtg tcctcgagcc cggggccttc gtgccctaca atccagcagt catggcatcc ggtgccagga gggacctccg aggccccccc cagacccccc tggggctctg gacgggactc acctccagcc agatctgatg agggaagcct gggtcccgac tccagcgtgc gcctggaagc cgagcccgag atgatggcag ccccagagca gcctgtgcag tagaacttgc tttaatgatg gaggcgaggc gggggcgccc ggggggct (GenBank Accession No. XM_011288714.1) Sus scrofa Myomaker 28 MGTVMAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTTFFVAFYHACHGPG amino acid LAMICFLRLDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRI YHDRWGYGVYSGPIGTAALIIAAKWLQQMKDQRRLYPDKSVYTQQIGPGLCFGA LALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKANKKAGSAGPPAKLDCSTL CCACI (GenBank Accession No. XP_003353750.1) Sus scrofa Myomaker 29 gatgagacaa gacaagaaaa aagaaaagga agagctcctc ccaccgtacg cDNA ttttaaatcc gtgcctttta tcgtgggcgg catcattcga tcacgatgaa aaacacaacg ggagaaatgc tgttctttta ctgacaacaa tcaagggatg aactcatgaa gccagcatga ttccgtcagt gcctgtaggg agagagggtc gcctgcgcag ctcacacgcc cggatcgtct cttggccaga ggatgatggg gggggggagc atcctgccag gctgctccct cgagacctgt ttagcaagag aaggaatgtc tccagggcca aggaaggccg agagccctag catccgcctt gccttgggga cactgataga ggtggtcctg gcttgtgtcc ttcaggttca aagctatgtg accgcagaga aaagacagtg agtttcgtgt gttcaggcac caaggaagcc tgcttggagc aggagcaggt gagcaagaag ggcatgggcg ctggtaggtt ggcttcttct ggtgaccgga acgggctcag ccttggcctc tctctcgccc ccacccccgg gccctgtgca cacgtgactc cagcagcagg gtctgctttc ctctcgtgtt ctgggctcct gagcgccctg gagaggggcg aggatggaga gtggctgaac atcgggggtg cggatgggga ctccgctcca tcgaagctgt ggcctccaaa aacaaggggg gactccttga atcaactgct ctgatccctc caaaacaaag gagagagaga gggtgaggca agggccgacc agcgggatca gctgttggct ctcctccccg ggcggtggac atgtgcgcgc ccctccccgc ctcgcagggt atttaaaccg cagctgccat cggagccccc gctggcagga gcgacccttc tccctgcctc ttccctgccc tggggacccg ggaggcccgc accctccctt cctccccggc ccatggggac cgtcatggcc aaactgctgc tacccacgct gagcagcctg gccttcctcc ccacggtcag catcgctgcc aagcggcggt tccacatgga ggccatggtc tatctcttca ccacgttctt cgtggcgttc taccacgcct gccacgggcc gggcctggct atgatctgct ttctgcgcct tgacatcctg gagtatttca gcgtctacgg aaccgccctg agcatgtggg tctcgctgat ggcgctggct gacttcgacg agcccaagag gtcgactttc gtgatgtttg gcgtcctgac catcgccgtg cggatctacc acgaccgctg gggctacggc gtgtactcgg gccccatcgg cacggccgcc ctcatcatcg cggccaagtg gctgcagcag atgaaggacc aacggcgcct gtatccagac aagagcgtgt acacacagca gataggcccc ggcctctgct tcggggcgct ggccctcatg ctgcgctttt tcttcgagga gtgggattat acctacgtcc acagcttcta ccactgcgcc ctggccatgt ccttcgtcct gctgctgccc aaggccaaca agaaggctgg aagcgcaggg ccacccgcca agctggactg ctccaccctc tgctgtgctt gtatctgacc gcgtggccca aagctcccag cccccccccc gccctgcctg gtccttccgg actgcagaaa cgccccttct cagagcctgc gggctctctg gggtctgggg agcatcccgc caagtgcttt ttgagaaccc acttcttctg tgtcccccgg gtgccaagga gggtgctgga aagaaacaaa catcctgatg gacaggtgtg tctgcagaag cccggagcca gacactgccc cccctccacg tcccctcccc gcttccccgg acagccccat cccagccacc aaggggccct gcctgccacc ctggtcccac acgctcccca caccctctgt ttcctgctct tgacccatgc cctcaggttc ggcgagccag ggccagcagg gccacttggt ccctgcccca ggcctggctg ccccttggct gtccccccag ccaggtcgct aaatcaaacc atttccactc ac (GenBank Accession No. XM_003353702.3) Macaca Myomaker 30 MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPG mulatta amino acid LSVLCFMRHDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRI YHDRWGYGVYSGPIGTAILIIAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGA LALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGAPGAPAKLDCSTL CCACV (GenBank Accession No. XP_014971917.1) Macaca Myomaker 31 tccgtctcaa aaaaagaaaa gagaaaatca gagacaagtg ctggtcacgt mulatta cDNA ggcgcgtcag ctgtcggccc tccccatgtg ttgcttgaca tgtgcatgta catccccgcc tccgtccagg gcatttaaac cctctcgtgg gcgctccccg cagctgccat cagagccctg ctcaaaggga gctggccttc ccccttcgtg ctcctgtgct ggggacccag ggcgccagca cccaccccgc cccagccagt gcttccctcc aggcctatgg ggacgctggt ggccaagcta ctcctgccca ccctcagcag cctggccttc ctccccactg tcagcatcgc ggccaagagg cggttccaca tggaggccat ggtctacctc ttcaccctgt tcttcgtggc gctccaccat gcctgcaacg gacccggctt gtctgtgctg tgcttcatgc gacacgacat cctggaatac ttcagcgtct acggaacagc cctgagcatg tgggtctcgc tgatggcact ggccgacttc gatgagccca agaggtcaac atttgtgatg ttcggcgtcc tgaccattgc tgtgaggatc taccacgacc gctggggcta cggggtgtac tcaggcccca tcggcacagc catcctcatc attgcggcaa agtggctgca gaagatgaag gagaagaagg gcctgtaccc agacaagagc gtctacaccc agcagatagg ccccggcctc tgcttcgggg cgctggccct gatgctacgc ttcttcttcg aggactggga ctacacctat gtccacagct tctaccactg tgccctggcc atgtcctttg ttctgctgct gcccaaggtc aacaagaagg ctggagcccc gggggccccg gccaagctgg actgctccac cctgtgctgt gcttgtgtct gatgctgcgc ccagcccggc tctgagcccc tgccctcccc agctcacgct tggccagagt cccagacagt ttctcctcct gcagctcctg ctgtccttcc ctgccccaga gcatgcagga gaaacatctc ttgcataccc taagaggccc ccgggggtct gtgaagggcc catcacactg cactaaatgc ttcttaagaa cccgcttatt ccgttgtgac ggggtgcaca gcagcaggac caagctggaa agataagaat gttctcctcc caggccttgt cacgacccat tggcgtgtct ggtggagccc taggtctggc gtctgcccac cccactgctg gccagcggcc caggagtccc agccgtgtgc cagccatgac gggggggctc ccatgtcttc agttttctcc tgggaactgc tatcaccatc tctgtcctgt gtcctcaggc tccgagcaac cccatttagg aagctgaggc cagcggggcc agctggatcc ctggcccagg ccagtctggc cccacccctt ccgctgggtc cctgaatcaa gccgttttca taattataac caataagaag tgcctcaatg tatcaacctc a (GenBank Accession No. XM_015116431.1)
(38) A “mouse Myomaker polypeptide” refers to a naturally occurring mouse Myomaker protein (e.g., the protein of SEQ ID NO: 18 or 20) or a variant thereof. The amino acid and cDNA sequences of mouse Myomaker isoforms can be found in Table 2. Table 2 also includes Myomaker sequences of other species, e.g., rat (R. norvegicus), monkey (M. mulatta), cat (F. catus), and pig (S. scrofa).
(39) The term “a Myomaker polypeptide” is used to refer collectively to all naturally occurring isoforms of a Myomaker protein of any species, or a variant thereof. For example, a “Myomaker polypeptide” can be any Myomaker polypeptide listed in Table 2 or a variant thereof.
(40) As used in the specification and claims, the singular form “a”, “an” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “a cell” includes a plurality of cells, including mixtures thereof.
(41) All numerical designations, e.g., pH, temperature, time, concentration, and molecular weight, including ranges, are approximations which are varied (+) or (−) by increments of 0.1. It is to be understood, although not always explicitly stated that all numerical designations are preceded by the term “about.” It also is to be understood, although not always explicitly stated, that the reagents described herein are merely examples and that equivalents of such are known in the art.
(42) The term “cDNA” refers to complementary DNA, e.g., mRNA molecules present in a cell or organism made into cDNA with an enzyme such as reverse transcriptase. A “cDNA library” is a collection of all of the mRNA molecules present in a cell or organism, all turned into cDNA molecules with the enzyme reverse transcriptase, then inserted into “vectors” (other DNA molecules that can continue to replicate after addition of foreign DNA). Example vectors for libraries include bacteriophage (also known as “phage”), viruses that infect bacteria, for example, lambda phage. The library can then be probed for the specific cDNA (and thus mRNA) of interest.
(43) The term “combination” refers to either a fixed combination in one dosage unit form, or a combined administration where a compound of the present invention and a combination partner (e.g. another drug as explained below, also referred to as “therapeutic agent” or “co-agent”) may be administered independently at the same time or separately within time intervals, especially where these time intervals allow that the combination partners show a cooperative, e.g. synergistic effect. The single components may be packaged in a kit or separately. One or both of the components (e.g., powders or liquids) may be reconstituted or diluted to a desired dose prior to administration. The terms “co-administration” or “combined administration” or the like as utilized herein are meant to encompass administration of the selected combination partner to a single subject in need thereof (e.g. a patient), and are intended to include treatment regimens in which the agents are not necessarily administered by the same route of administration or at the same time. The term “pharmaceutical combination” as used herein means a product that results from the mixing or combining of more than one active ingredient and includes both fixed and non-fixed combinations of the active ingredients. The term “fixed combination” means that the active ingredients, e.g. a compound of the present invention and a combination partner, are both administered to a patient simultaneously in the form of a single entity or dosage. The term “non-fixed combination” means that the active ingredients, e.g. a compound of the present invention and a combination partner, are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient. The latter also applies to cocktail therapy, e.g. the administration of three or more active ingredients.
(44) An “effective amount” refers to an amount sufficient to effect beneficial or desired results. For example, a therapeutic amount is one that achieves the desired therapeutic effect. This amount can be the same or different from a prophylactically effective amount, which is an amount necessary to prevent onset of disease or disease symptoms. An effective amount can be administered in one or more administrations, applications or dosages. A “therapeutically effective amount” of a therapeutic compound (i.e., an effective dosage) depends on the therapeutic compounds selected. The compositions can be administered from one or more times per day to one or more times per week; including once every other day. The skilled artisan will appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but are not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of the therapeutic compounds described herein can include a single treatment or a series of treatments.
(45) The term “variant” refers to a polypeptide that has a substantially identical amino acid sequence to a reference polypeptide, or is encoded by a substantially identical nucleotide sequence, and is capable of having one or more activities of the reference polypeptide. For example, a variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to a reference polypeptide, while retain one or more activities of the reference polypeptide.
(46) A “gene” refers to a polynucleotide containing at least one open reading frame (ORF) that is capable of encoding a particular polypeptide or protein after being transcribed and translated. A polynucleotide sequence can be used to identify larger fragments or full-length coding sequences of the gene with which they are associated. Methods of isolating larger fragment sequences are known to those of skill in the art.
(47) The term “isolated” refers to altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
(48) The term “nucleic acid” or “polynucleotide” refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
(49) The terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. A polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof. A “microprotein” or “micropeptide” refers to a protein or polypeptide that is less than 100 amino acids long.
(50) The term “homologous” or “identity” refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules. When a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position. The homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous. Percentage of “sequence identity” can be determined by comparing two optimally aligned sequences over a comparison window, where the fragment of the amino acid sequence in the comparison window may comprise additions or deletions (e.g., gaps or overhangs) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage can be calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity. The output is the percent identity of the subject sequence with respect to the query sequence.
(51) The term “subject” refers to an animal, human or non-human, to whom treatment according to the methods of the present invention is provided. Veterinary and non-veterinary applications are contemplated. The term includes, but is not limited to, mammals, e.g., humans, other primates, pigs, rodents such as mice and rats, rabbits, guinea pigs, hamsters, cows, horses, cats, dogs, sheep and goats. Typical subjects include humans, farm animals, and domestic pets such as cats and dogs.
(52) The term “treat” or “treatment” refers to both therapeutic treatment and prophylactic or preventive measures, wherein the object is to prevent or slow down an undesired physiological change or disorder. For purpose of this invention, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment.
(53) Statistical significance can be determined by any art known method. Exemplary statistical tests include: the Students T-test, Mann Whitney U non-parametric test, and Wilcoxon non-parametric statistical test. Some statistically significant relationships have a P value of less than 0.05 or 0.02. Particular binding proteins may show a difference, e.g., in specificity or binding that are statistically significant (e.g., P value<0.05 or 0.02). The terms “induce”, “inhibit”, “potentiate”, “elevate”, “increase”, “decrease” or the like, e.g., which denote distinguishable qualitative or quantitative differences between two states, may refer to a difference, e.g., a statistically significant difference, between the two states.
(54) MINION Polypeptides and Fragments or Variants Thereof
(55) Mouse MINION (ESGP) protein was encoded by a single open reading frame (ORF) (Chen Y et al., Acta Biochimica et Biophysica Sinica 2005, 37(12): 789-796). The 84 amino acid protein described in Chen et al., has an amino acid sequence of SEQ ID NO: 5 (isoform 1). A longer isoform of mouse MINION (isoform 2) was also described, which has the amino acid sequence of SEQ ID NO: 7, and a distinct N-terminus compared to isoform 1. The function of mouse MINION isoforms was unknown.
(56) The present inventors found that mouse MINION is a skeletal muscle-specific microprotein highly expressed during muscle development and regeneration (see Example 2), and is required for fusion of muscle progenitors and skeletal muscle development (see Examples 3 and 4). Moreover, forced heterologous expression of MINION, along with another protein Myomaker, is found to be sufficient to induce cell fusion even in non-muscle cells (e.g., fibroblasts) (see Example 5). This is surprising since it was reported that Myomaker alone cannot promote fibroblast-fibroblast fusion although it was capable of promoting fusion of fibroblasts to myoblasts (Millay et al., Nature. 2013; 499(7458):301-5).
(57) The human ortholog of mouse MINION has not been reported before. As described herein, the present inventors found human ortholog of MINION has an amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 3, and a cDNA sequence of SEQ ID NO: 2 or SEQ ID NO: 4. The present inventors found that human MINION protein also has fusogenic activity, suggesting an evolutionarily conserved role for the MINION protein in cell fusion. MINION amino acid and nucleotide sequences of other species, e.g., rat (R. norvegicus), monkey (M. mulatta), cat (F. catus), and pig (S. scrofa) are also provided in Table 1.
(58) A MINION polypeptide can be a variant of a naturally occurring MINION protein (e.g., any MINION protein listed in Table 1). For example, a human MINION polypeptide can be a variant of a naturally occurring human MINION protein (e.g., the protein of SEQ ID NO:1 or SEQ ID NO: 3, or another naturally occurring isoform thereof). A mouse MINION polypeptide can be a variant of a naturally occurring mouse MINION protein (e.g., a protein of SEQ ID NO: 5 or SEQ ID NO: 7, or another naturally occurring isoform thereof).
(59) A MINION variant can differ from a naturally occurring MINION protein by, for example, a modification (e.g., substitution, deletion, or insertion) of one or more amino acid residues in the naturally occurring MINION protein, but retains the biological activities of MINION, e.g., fusogenic activity. The MINION variant can have one or more conservative or nonconservative amino acid substitution. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
(60) In some embodiments, the MINION variant includes one or more mutations (e.g., substitutions (e.g., conservative substitutions or substitutions), insertions, or deletions) of non-essential amino acids relative to a naturally occurring MINION protein. A “non-essential” amino acid residue is a residue that can be altered from the wild-type sequence of MINION protein without abolishing or more preferably, without substantially altering a biological activity, such as the fusogenic activity, whereas changing an “essential” amino acid residue results in a substantial loss of biological activity.
(61) A MINION variant may have at least one, two, three, or four, and no more than 10, 9, 8, 7, 6, or 5 mutations (e.g., substitutions (e.g., conservative substitutions or substitutions of non-essential amino acids), insertions, or deletions) relative to a naturally occurring MINION protein. Whether or not a particular substitution will be tolerated, i.e., will not adversely affect biological properties, such as fusogenic activity, can be predicted, e.g., by evaluating whether the mutation is conservative or by an activity assay.
(62) In some embodiments, a MINION variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to a naturally occurring MINION protein. For example, a human MINION variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to SEQ ID NO: 1 or SEQ ID NO: 3. A mouse MINION variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to SEQ ID NO: 5 or SEQ ID NO: 7.
(63) Calculations of “homology” or “sequence identity” between two sequences (the terms are used interchangeably herein) can be performed as follows. The sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). The optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences.
(64) In addition, substantial identity exists when the nucleic acid segments hybridize under selective hybridization conditions (e.g., highly stringent hybridization conditions), to the complement of the strand. The nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
(65) In some embodiments, the MINION variant can comprise at least one non-naturally encoded amino acid. A “non-naturally encoded amino acid” refers to an amino acid that is not one of the common amino acids or pyrolysine or selenocysteine. Other terms that may be used synonymously with the term “non-naturally encoded amino acid” are “non-natural amino acid,” “unnatural amino acid,” “non-naturally-occurring amino acid,” and variously hyphenated and non-hyphenated versions thereof. The term “non-naturally encoded amino acid” also includes, but is not limited to, amino acids that occur by modification (e.g. post-translational modifications) of a naturally encoded amino acid (including but not limited to, the 20 common amino acids or pyrrolysine and selenocysteine) but are not themselves naturally incorporated into a growing polypeptide chain by the translation complex. Examples of such non-naturally-occurring amino acids include, but are not limited to, N-acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and O-phosphotyrosine.
(66) A non-naturally encoded amino acid is typically any structure having any substituent side chain other than one used in the twenty natural amino acids. Because the non-naturally encoded amino acids typically differ from the natural amino acids only in the structure of the side chain, the non-naturally encoded amino acids form amide bonds with other amino acids, including but not limited to, natural or non-naturally encoded, in the same manner in which they are formed in naturally occurring polypeptides. However, the non-naturally encoded amino acids have side chain groups that distinguish them from the natural amino acids. For example, R optionally comprises an alkyl-, aryl-, acyl-, keto-, azido-, hydroxyl-, hydrazine, cyano-, halo-, hydrazide, alkenyl, alkynl, ether, thiol, seleno-, sulfonyl-, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, ester, thioacid, hydroxylamine, amino group, or the like or any combination thereof. Other non-naturally occurring amino acids of interest that may be suitable for use in the present invention include, but are not limited to, amino acids comprising a photoactivatable cross-linker, spin-labeled amino acids, fluorescent amino acids, metal binding amino acids, metal-containing amino acids, radioactive amino acids, amino acids with novel functional groups, amino acids that covalently or noncovalently interact with other molecules, photocaged and/or photoisomerizable amino acids, amino acids comprising biotin or a biotin analogue, glycosylated amino acids such as a sugar substituted serine, other carbohydrate modified amino acids, keto-containing amino acids, amino acids comprising polyethylene glycol or polyether, heavy atom substituted amino acids, chemically cleavable and/or photocleavable amino acids, amino acids with an elongated side chains as compared to natural amino acids, including but not limited to, polyethers or long chain hydrocarbons, including but not limited to, greater than about 5 or greater than about 10 carbons, carbon-linked sugar-containing amino acids, redox-active amino acids, amino thioacid containing amino acids, and amino acids comprising one or more toxic moiety.
(67) Exemplary non-naturally encoded amino acids that may be suitable for use in the present invention and that are useful for reactions with water soluble polymers include, but are not limited to, those with carbonyl, aminooxy, hydrazine, hydrazide, semicarbazide, azide and alkyne reactive groups. In some embodiments, non-naturally encoded amino acids comprise a saccharide moiety. Examples of such amino acids include N-acetyl-L-glucosaminyl-L-serine, N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L-threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L-serine. Examples of such amino acids also include examples where the naturally-occurring N- or O-linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature—including but not limited to, an alkene, an oxime, a thioether, an amide and the like. Examples of such amino acids also include saccharides that are not commonly found in naturally-occurring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
(68) Methods of making and introducing a non-naturally-occurring amino acid into a protein are known. See, e.g., U.S. Pat. Nos. 7,083,970, and 7,524,647. The general principles for the production of orthogonal translation systems that are suitable for making proteins that comprise one or more desired unnatural amino acid are known in the art, as are the general methods for producing orthogonal translation systems. For example, see International Publication Numbers WO2002/086075; WO2002/085923; WO2004/094593; WO2005/007870; WO2005/007624; WO2006/110182; and WO2007/103490, each of these applications is incorporated herein by reference in its entirety. For discussion of orthogonal translation systems that incorporate unnatural amino acids, and methods for their production and use, see also, Wang and Schultz, (2005) “Expanding the Genetic Code.” Angewandte Chemie Int Ed 44: 34-66; Xie and Schultz, (2005) “An Expanding Genetic Code.” Methods 36: 227-238; Xie and Schultz, (2005) “Adding Amino Acids to the Genetic Repertoire.” Curr Opinion in Chemical Biology 9: 548-554; and Wang, et al., (2006) “Expanding the Genetic Code.” Annu Rev Biophys Biomol Struct 35: 225-249; Deiters, et al, (2005) “In vivo incorporation of an alkyne into proteins in Escherichia coli.” Bioorganic & Medicinal Chemistry Letters 15:1521-1524; Chin, et al., (2002) “Addition of p-Azido-L-phenylalanine to the Genetic Code of Escherichia coli.” J Am Chem Soc 124: 9026-9027; and International Publication No. WO2006/034332, filed on Sep. 20, 2005, the contents of each of which are incorporated by reference in their entirety. Additional details are found in U.S. Pat. Nos. 7,045,337; 7,083,970; 7,238,510; 7,129,333; 7,262,040; 7,183,082; 7,199,222; and 7,217,809.
(69) Another type of modification that can optionally be introduced into a MINION polypeptide (e.g., within the polypeptide chain or at either the N- or C-terminal), e.g., to extend in vivo half-life, is PEGylation or incorporation of long-chain polyethylene glycol polymers (PEG). Introduction of PEG or long chain polymers of PEG increases the effective molecular weight of the present polypeptides, for example, to prevent rapid filtration into the urine. In some embodiments, a Lysine residue in the MINION sequence is conjugated to PEG directly or through a linker. Such linker can be, for example, a Glu residue or an acyl residue containing a thiol functional group for linkage to the appropriately modified PEG chain. An alternative method for introducing a PEG chain is to first introduce a Cys residue at the C-terminus or at solvent exposed residues such as replacements for Arg or Lys residues. This Cys residue is then site-specifically attached to a PEG chain containing, for example, a maleimide function. Methods for incorporating PEG or long chain polymers of PEG are well known in the art (described, for example, in Veronese, F. M., et al., Drug Disc. Today 10: 1451-8 (2005); Greenwald, R. B., et al., Adv. Drug Deliv. Rev. 55: 217-50 (2003); Roberts, M. J., et al., Adv. Drug Deliv. Rev., 54: 459-76 (2002)), the contents of which is incorporated herein by reference. Other methods of polymer conjugations known in the art can also be used in the present invention, e.g., WO2008/098930; Lewis, et al., Bioconjug Chem., 19: 2144-55 (2008); Deiters, A, et al. (2004). Bio-org. Med. Chem. Lett. 14, 5743-5. In some embodiments, a phosphorylcholine-containing polymer conjugate with the MINION polypeptide can be used. In some embodiments, p-azidophenylalanine can be incorporated into the MINION polypeptides and then reacted with a PEG polymer having an acetylene moiety in the presence of a reducing agent and copper ions to facilitate an organic reaction known as “Huisgen [3+2]cycloaddition.” A person of skill would readily recognize that other biocompatible polymer conjugates can be utilized.
(70) In some embodiments, a variant of the MINION polypeptide can comprise MINION, fused to a heterologous peptide such as a tag or a fusion domain. Fusions may be constructed such that the heterologous peptide (e.g., a tag or a fusion domain) is fused at the amino terminus or at the carboxy terminus of MINION polypeptide. Examples of tags or fusion domains include, but are not limited to, a HA-tag (YPYDVPDYA, SEQ ID NO: 32), a Myc-tag (EQKLISEEDL, SEQ ID NO: 33), a FLAG-tag (DYKDDDDK, SEQ ID NO: 34), a His-tag (HHHHHH, SEQ ID NO: 35), an E-tag (GAPVPYPDPLEPR, SEQ ID NO: 36), a V5-tag (GKPIPNPLLGLDST, SEQ ID NO: 37), a VSV tag (YTDIEMNRLGK, SEQ ID NO: 38), a polyglutamate tag (EEEEEE, SEQ ID NO: 39), an AviTag (GLNDIFEAQKIEWHE, SEQ ID NO: 40), a SBP tag (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP, SEQ ID NO: 41), a Strep-tag (WSHPQFEK, SEQ ID NO: 42), an Xpress tag (DLYDDDDK, SEQ ID NO: 43), an S-tag (KETAAAKFERQHMDS, SEQ ID NO: 44), a Softag 1 (SLAELLNAGLGGS, SEQ ID NO: 45), a Softag 3 (TQDPSRVG, SEQ ID NO: 46), a Calmodulin-tag (KRRWKKNFIAVSAANRFKKISSSGAL, SEQ ID NO: 47), a TC tag (CCPGCC, SEQ ID NO: 48), an Isopeptag (TDKDMTITFTNKKDAE, SEQ ID NO: 49), a SpyTag (AHIVMVDAYKPTK, SEQ ID NO: 50), a SnoopTag (KLGDIEFIKVNK, SEQ ID NO: 51), a Glutathione-S-Transferase (GST)-tag, a fluorescent protein-tag (e.g., a GFP tag), a Maltose binding protein (MBP)-tag, a Halo-tag, or a thioredoxin-tag.
(71) A fusion domain or a tag may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography. For the purpose of affinity purification, relevant matrices for affinity chromatography, such as glutathione-, amylase-, and nickel- or cobalt-conjugated resins are used. Many of such matrices are available in “kit” form, such as the Pharmacia GST purification system and the QLAexpress™ system (Qiagen) useful with a His6 tag. As another example, a fusion domain may be selected so as to facilitate detection of the MINION proteins. Examples of such detection domains include the various fluorescent proteins (e.g., GFP), as well as “epitope tags,” which are usually short peptide sequences for which a specific antibody is available. Well known epitope tags for which specific monoclonal antibodies are readily available include a HA-tag, a Myc-tag, a FLAG-tag. Other known tags include an E-tag, a V5-tag, a VSV tag, a polyglutamate tag, an AviTag, a SBP tag, a Strep-tag, an Xpress tag, an S-tag, a Softag 1, a Softag 3, a Calmodulin-tag, a TC tag, an Isopeptag, a SpyTag, a SnoopTag, as described above.
(72) In some cases, the tags or fusion domains can have a protease cleavage site, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the MINION polypeptide from the fusion protein. In certain embodiments, an MINION polypeptide can be fused with a domain that stabilizes the protein in vivo (e.g., a “stabilizer” domain). By “stabilizing” is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc domain of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin (HSA) can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, as desired).
(73) Further provided herein are fragments of a MINION polypeptide which retain the biological function of a native MINION polypeptide, such as fusogenic activity, interaction with Myomaker, etc. For example, some embodiments of the present disclosure provide fragments of a MINION polypeptide that contain an “AxLyCxL” domain, which has been shown to be required for the fusogenic activity of MINION (Shi et al., Requirement of the fusogenic micropeptide myomixer for muscle formation in zebrafish. PNAS 114, 11950 (2017), the content of which is hereby incorporated by reference in its entirety). In some embodiments, the fragments of a MINION polypeptide comprise amino acids 48-54 of SEQ ID NO: 1. In some embodiments, the fragments of a MINION polypeptide comprise amino acids 48-54 of SEQ ID NO: 3. In some embodiments, the fragments of a MINION polypeptide comprise amino acids 48-54 of SEQ ID NO: 5. In some embodiments, the fragments of a MINION polypeptide comprise amino acids 72-78 of SEQ ID NO: 7. Some embodiments of the present disclosure provide fragments of a MINION polypeptide that contain the N-terminal hydrophobic region (amino acids 5-25 of human MINION), and positively charged Arg residues within the first α-helix following the N-terminal hydrophobic region the disruption of which resulted in a loss of fusogenic activity and perturbed interaction with Myomaker (Bi P, Ramirez-Martinez A, Li H, Cannavino J, McAnally J R, Shelton J M, Sanchez-Ortiz E, Bassel-Duby R, Olson E N: Control of muscle formation by the fusogenic micropeptide myomixer. Science 356, 323 (2017), the content of which is hereby incorporated by reference in its entirety). In some embodiments, the fragments of a MINION polypeptide comprise amino acids 5-46 of SEQ ID NO: 1. In some embodiments, the fragments of a MINION polypeptide comprise amino acids 5-46 of SEQ ID NO: 3. In some embodiments, the fragments of a MINION polypeptide comprise amino acids 5-46 of SEQ ID NO: 5. In some embodiments, the fragments of a MINION polypeptide comprise amino acids 29-70 of SEQ ID NO: 7. The fragment of a MINION polypeptide can have a variety of lengths. For example, the fragment of a MINION polypeptide can have a length that is, is about, is at least, is more than, 7 amino acids, 8 amino acids, 9 amino acids, 10 amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, 20 amino acids, 25 amino acids, 30 amino acids, 35 amino acids, 40 amino acids, 45 amino acids, 50 amino acids, or a range that is between any two of the above values.
(74) In some embodiments, a MINION peptide, variant thereof or fragment thereof may comprise one or more post-translational modifications, e.g., lipidation, glycosylation, phosphorylation, etc. Examples are as follows. Phosphorylation sites in Mus musculus MINION as predicted using GPS (gps.biocuckoo.org) include: serine 12, serine 15, serine 41, serine 42, serine 51, serine 58, serine 65, serine 69, and serine 74. Palmitoylation is predicted in Mus musculus MINION using GPS-Lipid (gps.biocuckoo.org) on cysteine 52. O-glycosylation of Mus musculus MINION is predicted using NetOGlyc 4.0 (www.cbs.dtu.dk) on serine 69 and serine 74.
(75) Myomaker Polypeptide and Variants
(76) Myomaker (also known as Tmem8c or Tmem226) is a membrane protein expressed specifically in skeletal muscle during embryogenesis and adult muscle regeneration (Millay et al., Nature. 2013 Jul. 18; 499(7458):301-5). Myomaker has been reported to be both necessary and sufficient to promote myoblast fusion in vivo and in vitro (Millay et al., 2013). Millay et al. also reported that Myomaker can promote fusion of fibroblasts to myoblasts but cannot promote fibroblast-fibroblast fusion. Methods of fusing a non-muscle cell to a muscle cell by expressing exogenous Myomaker protein in the non-muscle cell have been described in WO2014/210448.
(77) A Myomaker polypeptide can be a variant of a naturally occurring Myomaker protein (e.g., any Myomaker protein listed in Table 2). For example, a human Myomaker polypeptide can be a variant of a naturally occurring human Myomaker protein (e.g., a protein of SEQ ID NO: 16, or a naturally occurring isoform thereof). A mouse Myomaker polypeptide can be a variant of a naturally occurring mouse Myomaker protein (e.g., a protein of SEQ ID NO: 18 or SEQ ID NO: 20, or another naturally occurring isoform thereof). Table 2 provides Myomaker amino acid and nucleotide sequences of human, mouse, rat, monkey, cat, and pig.
(78) A Myomaker variant can differ from a naturally occurring Myomaker protein by, for example, a modification (e.g., substitution, deletion, or insertion) of one or more amino acid residues in the naturally occurring Myomaker protein, but retains the biological activities of Myomaker, e.g., fusogenic activity. The Myomaker variant can have one or more conservative or nonconservative amino acid substitution. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
(79) In some embodiments, the Myomaker variant includes one or more mutations (e.g., substitutions (e.g., conservative substitutions or substitutions), insertions, or deletions) of non-essential amino acids relative to a naturally occurring Myomaker protein. A “non-essential” amino acid residue is a residue that can be altered from the wild-type sequence of Myomaker protein without abolishing or more preferably, without substantially altering a biological activity, such as fusogenic activity, whereas changing an “essential” amino acid residue results in a substantial loss of biological activity.
(80) A Myomaker variant may have at least one, two, three, or four, and no more than 10, 9, 8, 7, 6, or 5 mutations (e.g., substitutions (e.g., conservative substitutions or substitutions of non-essential amino acids), insertions, or deletions) relative to a naturally occurring Myomaker protein. Whether or not a particular substitution will be tolerated, i.e., will not adversely affect biological properties, such as fusogenic activity, can be predicted, e.g., by evaluating whether the mutation is conservative or by an activity assay.
(81) In some embodiments, a Myomaker variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to a naturally occurring Myomaker protein. For example, a human Myomaker variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to SEQ ID NO: 16. A mouse Myomaker variant can have about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher sequence identity to SEQ ID NO: 18 or SEQ ID NO: 20.
(82) Calculations of “homology” or “sequence identity” between two sequences (the terms are used interchangeably herein) can be performed as follows. The sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). The optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences.
(83) In addition, substantial identity exists when the nucleic acid segments hybridize under selective hybridization conditions (e.g., highly stringent hybridization conditions), to the complement of the strand. The nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
(84) In some embodiments, the Myomaker variant can comprise at least one non-naturally encoded amino acid. In some embodiments, the Myomaker variant can be a PEGylated Myomaker with extended in vivo half-life. In some embodiments, a variant of the Myomaker polypeptide can comprise Myomaker, fused to a tag or a fusion domain. Exemplary non-naturally encoded amino acids, PEGylation methods, and fusion partners described above for MINION variants are also applicable to Myomaker variants.
(85) Nucleic Acids Encoding MINION Polypeptide, Expression Vectors, and Cells
(86) The invention also provides nucleic acids encoding a MINION polypeptide (e.g., a human MINION polypeptide), expression vectors for expression of a MINION polypeptide (e.g., a human MINION polypeptide), and cells containing such expression vectors. In other aspects, the invention provides a polynucleotide encoding a MINION polypeptide (e.g., a human MINION polypeptide), and expression vectors and host cells comprising such a polynucleotide.
(87) Provided herein are expression vectors that can be employed to express a MINION polypeptide (e.g., a human MINION polypeptide). The term “expression vector” refers to a carrier nucleic acid molecule into which a desired coding sequence can be inserted for introduction into a cell where it can be expressed. Expression vector can be a plasmid, a cosmid, an RNA, a viral vector, or artificial chromosomes (see, e.g., Harrington et al., Nat Genet 15:345, 1997). For example, nonviral vectors useful for expression of a polypeptide in mammalian (e.g., human) cells include pThioHis A, B & C, pcDNA3. 1/His, pEBVHis A, B & C (Invitrogen, San Diego, Calif.), MPSV vectors, and numerous other vectors known in the art for expressing other proteins. Useful viral vectors include, but are not limited to, vectors based on any of the following viruses: adenovirus, adeno-associated virus, Herpes Simplex Virus (HSV), parvovirus, retrovirus, lentivirus, vaccinia virus, Sinbis virus, influenza virus, reovirus, Newcastle disease virus (NDV), measles virus, vesicular stomatitis virus (VSV), poliovirus, poxvirus, Seneca Valley virus, coxsackievirus, enterovirus, myxoma virus, or maraba virus. In some embodiments, the expression vector can be capable of autonomous replication or it can integrate into a host DNA.
(88) In some embodiments, the expression vector can be a recombinant DNA molecule containing a MINION polypeptide-coding sequence (e.g., a human MINION polypeptide-coding sequence). The recombinant expression vector typically includes one or more regulatory sequences operatively linked to the nucleic acid sequence to be expressed. The term “regulatory sequence” includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Regulatory sequences include those which direct constitutive expression of a nucleotide sequence, as well as tissue-specific regulatory and/or inducible sequences. Expression vectors can also include elements designed to optimize messenger RNA stability and translatability in host cells, and/or drug selection markers for establishing permanent, stable cell clones expressing a human MINION polypeptide. The design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, and the like. General methods for generating such recombinant expression vectors can be found in Sambrook and Russell eds. (2001) Molecular Cloning: A Laboratory Manual, 3rd edition; the series Ausubel et al. eds. (2007 with updated through 2010) Current Protocols in Molecular Biology, among others known in the art.
(89) A “promoter” is a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors. The phrases “operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and/or expression of that sequence. A promoter may or may not be used in conjunction with an “enhancer,” which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
(90) A promoter may be one naturally-associated with a gene or sequence, as may be obtained by isolating the 5′ non-coding sequences located upstream of the coding segment and/or exon. Such a promoter can be referred to as “endogenous.” Similarly, an enhancer may be one naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages will be gained by positioning the coding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment. A recombinant or heterologous enhancer refers also to an enhancer not normally associated with a nucleic acid sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from any other prokaryotic, viral, or eukaryotic cell, and promoters or enhancers not “naturally-occurring,” i.e., containing different elements of different transcriptional regulatory regions, and/or mutations that alter expression. In addition to producing nucleic acid sequences of promoters and enhancers synthetically, sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including PCR™, in connection with the compositions disclosed herein (see U.S. Pat. Nos. 4,683,202, 5,928,906, each incorporated herein by reference). Furthermore, it is contemplated the control sequences that direct transcription and/or expression of sequences within non-nuclear organelles such as mitochondria, chloroplasts, and the like, can be employed as well.
(91) The promoters employed can be constitutive, inducible, tissue-specific, and/or useful under the appropriate conditions to direct high level expression of the introduced DNA segment, such as is advantageous in the large-scale production of recombinant proteins and/or peptides. In some embodiments, a constitutive promoter is employed to provide constant expression of a MINION polypeptide (e.g., a human MINION polypeptide). In some embodiments, an inducible promoter is employed to prevent expression of a MINION polypeptide (e.g., a human MINION polypeptide) except under inducing conditions. Inducible promoters include, e.g., arabinose, lacZ, a metallothionein promoter, a glucocorticoid promoters or a heat shock promoter. In addition, other regulatory elements may also be incorporated to improve expression of a nucleic acid encoding a MINION polypeptide (e.g., a human MINION polypeptide), e.g., enhancers, ribosomal binding site, transcription termination sequences, and the like. In some embodiments, a tissue-specific promoter is employed to provide expression of a MINION polypeptide (e.g., a human MINION polypeptide) only in specific tissues. The identity of tissue-specific promoters or elements, as well as assays to characterize their activities, is well known to those of skill in the art. Examples of such regions include the human LIMK2 gene (Nomoto et al. 1999, Gene, 236(2):259-271), the somatostatin receptor 2 gene (Kraus et al., 1998, FEES Lett., 428(3): 165-170), murine epididymal retinoic acid-binding gene (Lareyre et al., 1999, J. Biol. Chem., 274(12):8282-8290), human CD4 (Zhao-Emonet et al., 1998, Biochirn. Biophys. Acta, 1442(2-3): 109-119), mouse alpha2 (XI) collagen (Tsumaki, et al., 1998, J. Biol. Chem., 273(36):22861-22864), D1A dopamine receptor gene (Lee, et al., 1997, J. Auton. Nerv. Syst., 74(2-3):86-90), insulin-like growth factor II (Wu et al., 1997, Biochem. Biophys. Res. Commun., 233(1):221-226), human platelet endothelial cell adhesion molecule-1 (Almendro et al., 1996, J. Immunol., 157(12):5411-5421), muscle creatine kinase (MCK) promoter (Wang et al., Gene Ther. 2008 November; 15(22):1489-99).
(92) A specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals. It is well known that the initiation codon must be “in-frame” with the reading frame of the desired coding sequence to ensure translation of the entire insert. The exogenous translational control signals and initiation codons can be either natural or synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements.
(93) Expression can employ any appropriate host cells known in the art, for example, mammalian host cells, bacterial host cells, yeast host cells, insect host cells, etc. Both prokaryotic and eukaryotic expression systems are widely available. In some embodiments, the expression system is a mammalian cell expression, such as a CHO cell expression system. In some embodiments, a nucleic acid may be codon-optimized to facilitate expression in a desired host cell. It will be important to employ a promoter and/or enhancer that effectively directs the expression of the DNA segment in the cell type, organelle, and organism chosen for expression. Those of skill in the art of molecular biology generally know the use of promoters, enhancers, and cell type combinations for protein expression, for example, see Sambrook et al. (2001), incorporated herein by reference.
(94) Most transcribed eukaryotic RNA molecules will undergo RNA splicing to remove introns from the primary transcripts. Vectors containing genomic eukaryotic sequences may require donor and/or acceptor splicing sites to ensure proper processing of the transcript for protein expression (see Chandler et al., 1997, Proc. Natl. Acad. Sci. USA, 94(8):3596-601).
(95) The vectors or constructs of the present disclosure will generally comprise at least one termination signal. A “termination signal” or “terminator” is comprised of the DNA sequences involved in specific termination of an RNA transcript by an RNA polymerase. Thus, in certain embodiments a termination signal that ends the production of an RNA transcript is contemplated. A terminator may be necessary in vivo to achieve desirable message levels. In eukaryotic systems, the terminator region may also comprise specific DNA sequences that permit site-specific cleavage of the new transcript so as to expose a polyadenylation site. This signals a specialized endogenous polymerase to add a stretch of about 200 A residues (poly A) to the 3′ end of the transcript. RNA molecules modified with this polyA tail appear to more stable and are translated more efficiently. Thus, in other embodiments involving eukaryotes, it is preferred that that terminator comprises a signal for the cleavage of the RNA, and it is more preferred that the terminator signal promotes polyadenylation of the message. The terminator and/or polyadenylation site elements can serve to enhance message levels and/or to minimize read through from the cassette into other sequences. Terminators contemplated for use in the disclosure include any known terminator of transcription described herein or known to one of ordinary skill in the art, including but not limited to, for example, the termination sequences of genes, such as for example the bovine growth hormone terminator or viral termination sequences, such as for example the SV40 terminator. In certain embodiments, the termination signal may be a lack of transcribable or translatable sequence, such as due to a sequence truncation.
(96) In expression, particularly eukaryotic expression, one will typically include a polyadenylation signal to effect proper polyadenylation of the transcript. The nature of the polyadenylation signal is not believed to be crucial to the successful practice of the disclosure, and/or any such sequence may be employed. Preferred embodiments include the SV40 polyadenylation signal and/or the bovine growth hormone polyadenylation signal, convenient and/or known to function well in various target cells. Polyadenylation may increase the stability of the transcript or may facilitate cytoplasmic transport.
(97) To propagate a vector in a host cell, it may contain one or more origins of replication sites (often termed “ori”), which is a specific nucleic acid sequence at which replication is initiated. Alternatively an autonomously replicating sequence (ARS) can be employed if the host cell is yeast.
(98) In certain embodiments of the disclosure, cells containing a nucleic acid construct of the present disclosure may be identified in vitro or in vivo by including a marker in the expression vector. Such markers would confer an identifiable change to the cell permitting easy identification of cells containing the expression vector. Generally, a selectable marker is one that confers a property that allows for selection. A positive selectable marker is one in which the presence of the marker allows for its selection, while a negative selectable marker is one in which its presence prevents its selection. An example of a positive selectable marker is a drug resistance marker.
(99) Usually the inclusion of a drug selection marker aids in the cloning and identification of transformants, for example, genes that confer resistance to neomycin, puromycin, hygromycin, DHFR, GPT, zeocin and histidinol are useful selectable markers. In addition to markers conferring a phenotype that allows for the discrimination of transformants based on the implementation of conditions, other types of markers including screenable markers such as GFP, whose basis is colorimetric analysis, are also contemplated. Alternatively, screenable enzymes such as herpes simplex virus thymidine kinase (tk) or chloramphenicol acetyltransferase (CAT) may be utilized. One of skill in the art would also know how to employ immunologic markers, possibly in conjunction with FACS analysis. The marker used is not believed to be important, so long as it is capable of being expressed simultaneously with the nucleic acid encoding a gene product. Further examples of selectable and screenable markers are well known to one of skill in the art.
(100) In some embodiments, provided herein are expression vectors comprising a nucleic acid encoding a MINION polypeptide or a variant thereof. In some embodiments, provided herein are expression vectors comprising a nucleic acid encoding a MINION polypeptide of Table 1 or a variant thereof. In some embodiments, provided herein are expression vectors comprising a nucleic acid encoding a MINION polypeptide comprising an amino acid sequence selected from any of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, provided herein are expression vectors comprising a nucleic acid encoding a MINION polypeptide consisting of an amino acid sequence selected from any of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, provided herein are expression vectors comprising a nucleic acid selected from any of SEQ ID NOs: 2, 4, 6, 8, 10, 12, or 14.
(101) In some embodiments, provided herein are expression vectors comprising a nucleic acid encoding a polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 3 or a variant thereof. In some embodiments, the expression vector comprises a nucleic acid encoding a polypeptide comprising SEQ ID NO: 1 with 1-4 mutations. In some embodiments, the expression vector comprises a nucleic acid encoding a polypeptide consisting of SEQ ID NO: 1. In some embodiments, the expression vector comprises a nucleic acid encoding a polypeptide comprising SEQ ID NO: 3 with 1-4 mutations. In some embodiments, the expression vector comprises a nucleic acid encoding a polypeptide consisting of SEQ ID NO: 1. In some embodiments, the expression vector comprises a nucleic acid encoding a polypeptide consisting of SEQ ID NO: 3. In some embodiments, the expression vector comprises a nucleic acid comprising SEQ ID NO: 2. In some embodiments, the expression vector comprises a nucleic acid comprising SEQ ID NO: 4. In some embodiments, the expression vector comprises a nucleic acid consisting of SEQ ID NO: 2. In some embodiments, the expression vector comprises a nucleic acid consisting of SEQ ID NO: 4.
(102) In some embodiments, the expression vector comprises a promoter, e.g., a constitutive promoter, an inducible promoter, or a tissue-specific promoter. In some embodiments, the expression vector comprises a polyadenylation signal. In some embodiments, the expression vector comprises a selectable marker.
(103) In some embodiments, the expression vector comprises a nucleic acid encoding a polypeptide comprising SEQ ID NO: 1 or SEQ ID NO: 3, fused to a tag. The tag can be selected from a HA-tag (YPYDVPDYA, SEQ ID NO: 32), a Myc-tag (EQKLISEEDL, SEQ ID NO: 33), a FLAG-tag (DYKDDDDK, SEQ ID NO: 34), a His-tag (HHHHHH, SEQ ID NO: 35), an E-tag (GAPVPYPDPLEPR, SEQ ID NO: 36), a V5-tag (GKPIPNPLLGLDST, SEQ ID NO: 37), a VSV tag (YTDIEMNRLGK, SEQ ID NO: 38), a polyglutamate tag (EEEEEE, SEQ ID NO: 39), an AviTag (GLNDIFEAQKIEWHE, SEQ ID NO: 40), a SBP tag (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP, SEQ ID NO: 41), a Strep-tag (WSHPQFEK, SEQ ID NO: 42), an Xpress tag (DLYDDDDK, SEQ ID NO: 43), an S-tag (KETAAAKFERQHMDS, SEQ ID NO: 44), a Softag 1 (SLAELLNAGLGGS, SEQ ID NO: 45), a Softag 3 (TQDPSRVG, SEQ ID NO: 46), a Calmodulin-tag (KRRWKKNFIAVSAANRFKKISSSGAL, SEQ ID NO: 47), a TC tag (CCPGCC, SEQ ID NO: 48), an Isopeptag (TDKDMTITFTNKKDAE, SEQ ID NO: 49), a SpyTag (AHIVMVDAYKPTK, SEQ ID NO: 50), a SnoopTag (KLGDIEFIKVNK, SEQ ID NO: 51), a Glutathione-S-Transferase (GST)-tag, a fluorescent protein-tag (e.g., a GFP tag), a Maltose binding protein (MBP)-tag, a Halo-tag, or a thioredoxin-tag.
(104) In some embodiments, the expression vectors further comprise a second nucleic acid encoding a Myomaker polypeptide or a variant thereof. Thus, provided herein are expression vectors for expressing both a MINION polypeptide and a Myomaker polypeptide. In some embodiments, the expression vector comprises a second nucleic acid encoding a Myomaker polypeptide of Table 2 or a variant thereof. In some embodiments, the expression vector comprises a second nucleic acid encoding a polypeptide comprising an amino acid sequence selected from any of SEQ ID NOs: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the expression vector comprises a second nucleic acid encoding a polypeptide consisting of an amino acid sequence selected from any of SEQ ID NOs: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the expression vector comprises a second nucleic acid selected from any of SEQ ID NOs: 17, 19, 21, 23, 25, 27, 29, or 31, or a variant thereof.
(105) In some embodiments, the expression vector comprises a second nucleic acid encoding a polypeptide comprising SEQ ID NO: 16. In some embodiments, the expression vector comprises a second nucleic acid encoding a polypeptide consisting of SEQ ID NO: 16. In some embodiments, the expression vector comprises a second nucleic acid comprising SEQ ID NO: 17. In some embodiments, the expression vector comprises a second nucleic acid consisting of SEQ ID NO: 17. In some embodiments, the expression vectors further comprise a second promoter upstream of the second nucleic acid. The second promoter can be a constitutive promoter, an inducible promoter, or a tissue-specific promoter.
(106) In some embodiments, the expression vectors for expressing both a MINION polypeptide and a Myomaker polypeptide comprise an internal ribosome entry site (IRES) upstream of the Myomaker-coding sequence. IRES elements are able to bypass the ribosome scanning model of 5′-methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988, Nature, 334:320-325). IRES elements from two members of the picornavirus family (polio and encephalomyocarditis) have been described (Pelletier and Sonenberg, 1988), as well an IRES from a mammalian message (Macejak and Sarnow, 1991, Nature, 353:90-94, 1991). IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. By virtue of the IRES element, each open reading frame is accessible to ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (see U.S. Pat. Nos. 5,925,565 and 5,935,819, herein incorporated by reference).
(107) In some embodiments, the expression vectors for expressing both a MINION polypeptide and a Myomaker polypeptide comprise a 2A sequence upstream of the Myomaker-coding sequence. The 2A oligopeptide sequence was first characterized from the positive-stranded RNA picornavirus Foot-and-Mouth Disease Virus (FMDV); and FMDV 2A or F2A was shown to mediate a co-translational ‘cleavage’ between the upstream (capsid proteins) and downstream (RNA replication proteins) domains of the FMDV polyprotein (Ryan M D, EMBO J 1994; 134: 928-933; Ryan M D, J Gen Virol 1991; 72: 2727-2732; Donnelly MLL, J Gen Virol 1997; 78:13-21; Donnelly MLL, J Gen Virol 2001; 82:1013-1025). Active 2A sequences were characterized in the genomes of viruses from other genera of the picornaviruses, plus ‘2A-like’ sequences found within the genomes of a range of different RNA viruses and non-LTR retrotransposons (Donnelly MLL, J Gen Virol 2001; 82:1027-1041; Heras S R, Cell Mol Life Sci 2006; 63:1449-1460; Luke G A, J Gen Virol 2008; 89:1036-1042; Odon V, Mol Biol Evol 2013; 30:1955-1965; Luke G A, Mob Gen Elements 2014; 3:e27525). These 2A or “2A-like” oligopeptide sequences were shown to mediate a translational ‘recoding’ event referred-to as ‘ribosome skipping’, ‘stop carry-on’ or ‘stop-go’ translation (Atkins J F, RNA 2007; 13:1-8).
(108) As used herein, a “2A sequence” refers to any nucleic acid sequence encoding a 2A or “2A-like” oligopeptide serving as a linker between two proteins, allowing autonomous intraribosomal self-processing of polyproteins (See e.g., de Felipe. Genetic Vaccines and Ther. 2:13 (2004); deFelipe et al. Traffic 5:616-626 (2004)). These oligopeptides allow co-expression of multiple proteins from a single vector. Many 2A elements are known in the art. For example, viral 2A sequences have been described in U.S. Pat. Nos. 9,175,311, 8,865,881, 7,939,059, 7,947,493, all of which are incorporated by reference herein. For example, a viral 2A sequence can be a picornaviral, a tetraviral 2A sequence, or a combination thereof. A picornaviral 2A sequence can be selected from any one of the Enteroviral 2A sequences, Rhinoviral 2A sequences, Cardioviral 2A sequences, Aphthoviral 2A sequences, Hepatoviral 2A sequences, Erboviral 2A sequences, Kobuviral 2A sequences, Teschoviral 2A sequences, and the Parechoviral 2A sequences. A tetraviral 2A sequences can be selected from any of the Betatetraviral 2A sequences or Omegatetraviral 2A sequences. Examples of 2A sequences that can be used in the methods and system disclosed herein, without limitation, include 2A sequences from the foot-and-mouth disease virus (F2A), equine rhinitis A virus (E2A), Thosea asigna virus (T2A), and porcine teschovirus-1 (P2A). In some embodiments, a 2A sequence encodes a viral 2A oligopeptide selected from T2A (EGRGSLLTCGDVEENPGP (SEQ ID NO: 52) or GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 53)), P2A (ATNFSLLKQAGDVEENPGP (SEQ ID NO: 54) or GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 55)), E2A (QCTNYALLKLAGDVESNPGP (SEQ ID NO: 56) or GSGQCTNYALLKLAGDVESNPGP (SEQ ID NO: 57)), or F2A (VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 58) or GSGVKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 59)).
(109) Non-viral 2A sequence has been described in U.S. Pat. No. 8,945,876, which is incorporated by reference herein. For example, a non-viral 2A sequence can be a sea urchin (Strongylocentrotus purpuratus) 2A sequence (DGFCILYLLLILLMRSGDVETNPGP) (SEQ ID NO: 60); a sponge (Amphimedon queenslandica) 2A sequence (LLCFMLLLLLSGDVELNPGP (SEQ ID NO: 61) or HHFMFLLLLLAGDIELNPGP (SEQ ID NO: 62)); an acorn worm (Saccoglossus kowalevskii) 2A sequence (WFLVLLSFILSGDIEVNPGP (SEQ ID NO: 63)); or an amphioxus (Branchiostoma floridae) 2A sequence (KNCAMYMLLLSGDVETNPGP (SEQ ID NO: 64) or MVISQLMLKLAGDVEENPGP (SEQ ID NO: 65)). In some embodiments, the 2A sequence is a naturally occurring or synthetic sequence that includes the 2A consensus sequence D-X-E-X-NPGP (SEQ ID NO: 66), in which X is any amino acid residue.
(110) In some embodiments, the expression vector comprises a 2A sequence encoding a 2A oligopeptide selected from any one of SEQ ID NOs: 52-66.
(111) In some embodiments, a nucleic acid encoding a human MINION polypeptide may also include a sequence encoding a secretion signal sequence so that the polypeptide is secreted from the host cell. Such a sequence can be provided by the vector, or as part of the MINION nucleic acid that is present in the vector.
(112) Generation of an expression vector can utilize a vector that includes a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector. See Carbonelli et al., 1999, Levenson et al., 1998, and Cocea, 1997, incorporated herein by reference. “Restriction enzyme digestion” refers to catalytic cleavage of a nucleic acid molecule with an enzyme that functions only at specific locations in a nucleic acid molecule. Many of these restriction enzymes are commercially available. Use of such enzymes is widely understood by those of skill in the art. Frequently, a vector is linearized or fragmented using a restriction enzyme that cuts within the MCS to enable exogenous sequences to be ligated to the vector. “Ligation” refers to the process of forming phosphodiester bonds between two nucleic acid fragments, which may or may not be contiguous with each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology.
(113) Methods for introducing expression vectors containing the polynucleotide sequences of interest vary depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment or electroporation may be used for other cellular hosts (see generally Sambrook et al., supra). Other methods include, e.g., electroporation, calcium phosphate treatment, liposome-mediated transformation, injection and microinjection, ballistic methods, virosomes, immunoliposomes, polycation: nucleic acid conjugates, naked DNA, artificial virions, fusion to the herpes virus structural protein VP22, agent-enhanced uptake of DNA, and ex vivo transduction. For long-term, high-yield production of recombinant proteins, stable expression will often be desired. For example, cell lines which stably express polypeptides of the invention can be prepared using expression vectors of the invention which contain viral origins of replication or endogenous expression elements and a selectable marker gene.
(114) Also provided herein are cells that include any of the expression vectors described herein. In some embodiments, such cells comprising an expression vector for expressing a MINION polypeptide (e.g., a human MINION polypeptide). In some embodiments, such cells comprising an expression vector for expressing both a MINION polypeptide (e.g., a human MINION polypeptide) and a Myomaker polypeptide (e.g., a human Myomaker polypeptide). In some embodiments, such cells comprising an expression vector for expressing a MINION polypeptide (e.g., a human MINION polypeptide) and a second expression vector for expressing a Myomaker polypeptide (e.g., a human Myomaker polypeptide). Such cells can be a host cell or a therapeutic cell.
(115) In some embodiments, the disclosure features a host cell that includes a nucleic acid molecule described herein. A host cell can be used to produce or express a human MINION polypeptide described herein. The terms “host cell” and “recombinant host cell” are used interchangeably herein, which refer to not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein. A host cell can be any prokaryotic or eukaryotic cell. For example, a protein can be expressed in bacterial cells (such as E. coli), insect cells, yeast cells, or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells e.g., COS-7 cells, CV-1 origin SV40 cells; Gluzman (1981) Cell 23:175-182). Other suitable host cells are known to those skilled in the art.
(116) A host cell can be used to produce or express a human MINION polypeptide described herein. Accordingly, the disclosure also features methods for producing a human MINION polypeptide using a host cell. In one embodiment, the method includes culturing the host cell (into which a recombinant expression vector encoding a protein has been introduced) in a suitable medium, such that a human MINION polypeptide is produced. In another embodiment, the method further includes isolating a human MINION polypeptide from the medium or the host cell.
(117) In some embodiments, the disclosure features a therapeutic cell that includes a nucleic acid molecule described herein. As used herein, the term “therapeutic cell” refers to a cell that has been genetically engineered to express a polypeptide, e.g., a MINION polypeptide, e.g., a human MINION polypeptide, that is capable of fusing to a dysfunctional cell or tumor cell. Such a therapeutic cell can be a human cell, e.g., a human muscle cell such as a myoblast, a cardiac muscle cell, a skeletal muscle cell, or a smooth muscle cell; or a human non-muscle cell such as a fibroblast, a bone marrow cell, a blood cell, a hepatocyte, a stem cell, an epithelial cell, an endothelial cell, a dendritic cell, or a tumor cell. In some embodiments, the therapeutic cells comprise an expression vector expressing a MINION polypeptide, variant or fragment thereof disclosed herein. In some embodiments, the therapeutic cells comprise an expression vector expressing a Myomaker polypeptide, variant or fragment thereof disclosed herein. In some embodiments, such a therapeutic cell expresses a detectable marker, e.g., a fluorescent molecule (e.g., fluorescein, Texas red, rhodamine, green fluorescent protein, and the like), an enzyme (e.g., horse radish peroxidase, alkaline phosphatase), a luminescent molecule (e.g., luciferase), a radioactive molecule (e.g., .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), or calorimetric labels such as colloidal gold or colored beads. Cells expressing a detectable marker can be traced or visualized by appropriate detection methods such as microscopy, autoradiography, and/or other imaging methods known in the art.
(118) In some embodiments, the therapeutic cells may be able to restore the function of the dysfunctional cell by fusing to the dysfunctional cell. As used herein, a “dysfunctional cell” refers to a cell that has partially or completely lost its normal function, for example, due to a genetic abnormality, e.g., a genetic mutation. Non-limiting examples of dysfunctional cells include: a muscle cell having a mutation in the dystrophin gene resulting in cell death which is the underlying cause for Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD); a muscle cell having a mutation in the Dysferlin gene resulting in Miyoshi myopathy (MM), Limb-girdle muscular dystrophy type 2B (LGMD2B), and Distal Myopathy (DM), a cell having a mutation in the gene encoding fumaryl acetoacetate hydrolase (Fah), which leads to Hereditary Tyrosinemia type I, etc.
(119) In some embodiments, the therapeutic cells may restore the function of the dysfunctional cell by introducing a gene of interest, e.g., a correct version of the gene that is mutated in the dysfunctional cell, to the dysfunctional cell, and thereby correct the genetic abnormality in the dysfunctional cell. For example, the therapeutic cells may contain a correct version of the dystrophin gene, a correct version of the gene encoding Fah, etc. The therapeutic cells may be autologous or allogeneic. In embodiments where the therapeutic cells are autologous, the genetic abnormality of the therapeutic cells may be corrected by a variety of gene editing systems known in the art. As used herein, the term “gene editing system” refers to a system comprising one or more DNA-binding domains or components and one or more DNA-modifying domains or components, or isolated nucleic acids, e.g., one or more vectors, encoding said DNA-binding and DNA-modifying domains or components. Gene editing systems are used for modifying the nucleic acid of a target gene and/or for modulating the expression of a target gene. In known gene editing systems, for example, the one or more DNA-binding domains or components are associated with the one or more DNA-modifying domains or components, such that the one or more DNA-binding domains target the one or more DNA-modifying domains or components to a specific nucleic acid site.
(120) Gene editing systems are known in the art, and include but are not limited to, zinc finger nucleases, transcription activator-like effector nucleases (TALENs); clustered regularly interspaced short palindromic repeats (CRISPR)/Cas systems, and meganuclease systems. Without wishing to be bound by theory, it is believed that the known gene editing systems may exhibit unwanted DNA-modifying activity which is detrimental to their utility in therapeutic applications. These concerns are particularly apparent in the use of gene editing systems for in vivo modification of genes or gene expression, e.g., where cells are engineered to constitutively express components of a gene editing system, such as through lentiviral or adenoviral vector transfection.
(121) “CRISPR” as used herein refers to a set of clustered regularly interspaced short palindromic repeats, or a system comprising such a set of repeats. “Cas,” as used herein, refers to a CRISPR-associated protein. The diverse CRISPR-Cas systems can be divided into two classes according to the configuration of their effector modules: class 1 CRISPR systems utilize several Cas proteins and the crRNA to form an effector complex, whereas class 2 CRISPR systems employ a large single-component Cas protein in conjunction with crRNAs to mediate interference. One example of class 2 CRISPR-Cas system employs Cpf1 (CRISPR from Prevotella and Francisella 1). See, e.g., Zetsche et al., Cell 163:759-771 (2015), the content of which is herein incorporated by reference in its entirety. The term “Cpf1” as used herein includes all orthologs, and variants that can be used in a CRISPR system.
(122) It is contemplated that the therapeutic cells may be the same or different cell type from the dysfunctional cell or tumor cell. For example, in embodiments where the dysfunctional cell is a muscle cell, the therapeutic cell may be a muscle cell such as a myoblast, a cardiac muscle cell, a skeletal muscle cell, or a smooth muscle cell; or a non-muscle cell such as a fibroblast, a bone marrow cell, a blood cell, a hepatocyte, a stem cell, an epithelial cell, an endothelial cell, a dendritic cell, etc.
(123) Antibodies that Bind MINION
(124) Provided herein are antibodies or antigen-binding fragments thereof that specifically bind to a MINION protein, e.g., a MINION protein of Table 1. In some embodiments, provided herein are antibodies or antigen-binding fragments thereof that specifically bind to a MINION protein comprising an amino acid sequence selected from any of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15. In some embodiments, provided herein are antibodies or antigen-binding fragments thereof that specifically bind to a MINION protein consisting of an amino acid sequence selected from any of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15.
(125) In some embodiments, provided herein are antibodies or antigen-binding fragments thereof that specifically bind to a human MINION protein, e.g., a protein comprising SEQ ID NO: 1 or 3, or a variant thereof. In some embodiments, provided herein are antibodies or antigen-binding fragments thereof that specifically bind to a human MINION protein of SEQ ID NO: 1. In some embodiments, provided herein are antibodies or antigen-binding fragments thereof that specifically bind to a human MINION protein of SEQ ID NO: 3.
(126) An antibody that specifically binds a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) can be a monoclonal or polyclonal antibody. In some embodiments, an antibody that specifically binds a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) is a monoclonal antibody. In some embodiments, an antibody that specifically binds a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) is a human or humanized antibody.
(127) In some embodiments, an antibody of the invention has a full length antibody heavy chain sequence and a full length antibody light chain sequence. A naturally occurring antibody usually comprises at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component of the classical complement system.
(128) An antibody can be a monoclonal antibody, human antibody, humanized antibody, camelised antibody, or chimeric antibody. The antibodies can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass.
(129) Both the light and heavy chains are divided into regions of structural and functional homology. The terms “constant” and “variable” are used functionally. In this regard, it will be appreciated that the variable domains of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity. Conversely, the constant domains of the light chain (CL) and the heavy chain (CH1, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like. By convention, the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino-terminus of the antibody. The N-terminus is a variable region and at the C-terminus is a constant region; the CH3 and CL domains actually comprise the carboxy-terminus of the heavy and light chain, respectively. In particular, the term “antibody” specifically includes an IgG-scFv format.
(130) The term “antigen binding fragment” refers to portions of a binding molecule (e.g., an antibody or antigen-binding fragment or derivative thereof), that specifically interacts with (e.g., by binding, steric hindrance, stabilizing/destabilizing, spatial distribution) a binding site on a target epitope, e.g., a MINION epitope. Examples of antibody fragments include, but are not limited to, an scFv, a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
(131) The term “epitope” means a protein determinant capable of specific binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
(132) Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., (1988) Science 242:423-426; and Huston et al., (1988) Proc. Natl. Acad. Sci. 85:5879-5883).
(133) Such single chain antibodies are also intended to be encompassed within the terms “fragment”, “epitope-binding fragment” or “antibody fragment.” These fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
(134) Antibody fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., (1995) Protein Eng. 8:1057-1062; and U.S. Pat. No. 5,641,870), and also include Fab fragments, F(ab′) fragments, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
(135) Antigen binding fragments also include single domain antibodies, maxibodies, unibodies, minibodies, triabodies, tetrabodies, v-NAR and bis-scFv, as is known in the art (see, e.g., Hollinger and Hudson, (2005) Nature Biotechnology 23: 1126-1136), bispecific single chain diabodies, or single chain diabodies designed to bind two distinct epitopes. Antigen binding fragments also include antibody-like molecules or antibody mimetics, which include, but not limited to minibodies, maxybodies, Fn3 based protein scaffolds, Ankrin repeats (also known as DARpins), VASP polypeptides, Avian pancreatic polypeptide (aPP), Tetranectin, Affililin, Knottins, SH3 domains, PDZ domains, Tendamistat, Neocarzinostatin, Protein A domains, Lipocalins, Transferrin, and Kunitz domains that specifically bind epitopes, which are within the scope of the invention. Antibody fragments can be grafted into scaffolds based on polypeptides such as Fibronectin type III (Fn3) (see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies).
(136) An isolated antibody can be a monovalent antibody, bivalent antibody, multivalent antibody, bivalent antibody, biparatopic antibody, bispecific antibody, monoclonal antibody, human antibody, recombinant human antibody, or any other type of antibody or epitope-binding fragment or derivative thereof.
(137) The phrase “isolated antibody,” as used herein, refers to antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) is substantially free of antibodies that specifically bind antigens other than a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3). An isolated antibody that specifically binds a target molecule may, however, have cross-reactivity to the same antigens from other species, e.g., an isolated antibody that specifically binds a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) may bind MINION molecules from other species. Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals.
(138) The term “monovalent antibody” as used herein, refers to an antibody that binds to a single epitope on a target molecule.
(139) The term “bivalent antibody” as used herein, refers to an antibody that binds to two epitopes on at least two identical target molecules. The bivalent antibody may also crosslink the target molecules to one another. A “bivalent antibody” also refers to an antibody that binds to two different epitopes on at least two identical target molecules.
(140) The term “multivalent antibody” refers to a single binding molecule with more than one valency, where “valency” is described as the number of antigen-binding moieties present per molecule of an antibody construct. As such, the single binding molecule can bind to more than one binding site on a target molecule. Examples of multivalent antibodies include, but are not limited to bivalent antibodies, trivalent antibodies, tetravalent antibodies, pentavalent antibodies, and the like, as well as bispecific antibodies and biparatopic antibodies. For example, for a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3), the multivalent antibody has a binding moiety for two domains of the MINION protein (e.g., human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3), respectively.
(141) The term “multivalent antibody” also refers to a single binding molecule that has more than one antigen-binding moiety for two separate target molecules. For example, an antibody that binds to a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) and a second target molecule that is not MINION. In one embodiment, a multivalent antibody is a tetravalent antibody that has four epitope binding domains. A tetravalent molecule may be bispecific and bivalent for each binding site on that target molecule.
(142) The term “biparatopic antibody” as used herein, refers to an antibody that binds to two different epitopes on a single target molecule. The term also includes an antibody, which binds to two domains of at least two target molecules, e.g., a tetravalent biparatopic antibody.
(143) The term “bispecific antibody” as used herein, refers to an antibody that binds to two or more different epitopes on at least two different targets (e.g., MINION and a target that is not MINION).
(144) The phrases “monoclonal antibody” or “monoclonal antibody composition” as used herein refers to polypeptides, including antibodies, bispecific antibodies, etc., that have substantially identical amino acid sequence or are derived from the same genetic source. This term also includes preparations of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
(145) The phrase “human antibody,” as used herein, includes antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region is also derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik, et al. (2000. J Mol Biol 296, 57-86). The structures and locations of immunoglobulin variable domains, e.g., CDRs, may be defined using well known numbering schemes, e.g., the Kabat numbering scheme, the Chothia numbering scheme, or a combination of Kabat and Chothia (see, e.g., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services (1991), eds. Kabat et al.; Al Lazikani et al., (1997) J. Mol. Bio. 273:927 948); Kabat et al., (1991) Sequences of Proteins of Immunological Interest, 5th edit., NIH Publication no. 91-3242 U.S. Department of Health and Human Services; Chothia et al., (1987) J. Mol. Biol. 196:901-917; Chothia et al., (1989) Nature 342:877-883; and Al-Lazikani et al., (1997) J. Mal. Biol. 273:927-948.
(146) The human antibodies of the invention may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing). However, the term “human antibody” as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
(147) The phrase “recombinant human antibody” as used herein, includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, antibodies isolated from a recombinant, combinatorial human antibody library, and antibodies prepared, expressed, created or isolated by any other means that involve splicing of all or a portion of a human immunoglobulin gene, sequences to other DNA sequences. Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
(148) The term “Fc region” as used herein refers to a polypeptide comprising the CH3, CH2 and at least a portion of the hinge region of a constant domain of an antibody. Optionally, an Fc region may include a CH4 domain, present in some antibody classes. An Fc region, may comprise the entire hinge region of a constant domain of an antibody. In one embodiment, the invention comprises an Fc region and a CH1 region of an antibody. In one embodiment, the invention comprises an Fc region CH3 region of an antibody. In another embodiment, the invention comprises an Fc region, a CH1 region and a Ckappa/lambda region from the constant domain of an antibody. In one embodiment, a binding molecule of the invention comprises a constant region, e.g., a heavy chain constant region. In one embodiment, such a constant region is modified compared to a wild-type constant region. That is, the polypeptides of the invention disclosed herein may comprise alterations or modifications to one or more of the three heavy chain constant domains (CH1, CH2 or CH3) and/or to the light chain constant region domain (CL). Example modifications include additions, deletions or substitutions of one or more amino acids in one or more domains. Such changes may be included to optimize effector function, half-life, etc.
(149) The term “binding site” as used herein comprises an area on a target molecule to which an antibody or antigen binding fragment selectively binds.
(150) The term “epitope” as used herein refers to any determinant capable of binding with high affinity to an immunoglobulin. An epitope is a region of an antigen that is bound by an antibody that specifically targets that antigen, and when the antigen is a protein, includes specific amino acids that directly contact the antibody. Most often, epitopes reside on proteins, but in some instances, may reside on other kinds of molecules, such as nucleic acids. Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three dimensional structural characteristics, and/or specific charge characteristics.
(151) Generally, antibodies specific for a particular target antigen will bind to an epitope on the target antigen in a complex mixture of proteins and/or macromolecules.
(152) As used herein, the term “affinity” refers to the strength of interaction between antibody and antigen at single antigenic sites. Within each antigenic site, the variable region of the antibody “arm” interacts through weak non-covalent forces with the antigen at numerous sites; the more interactions, the stronger the affinity. As used herein, the term “high affinity” for an IgG antibody or fragment thereof (e.g., a Fab fragment) refers to an antibody having a knock down of 10.sup.−8 M or less, 10.sup.−9 M or less, or 10.sup.−10 M, or 10.sup.−11 M or less, or 10.sup.−12 M or less, or 10.sup.−13 M or less for a target antigen. However, high affinity binding can vary for other antibody isotypes. For example, high affinity binding for an IgM isotype refers to an antibody having a knock down of 10.sup.−7 M or less, or 10.sup.−8 M or less.
(153) As used herein, the term “avidity” refers to an informative measure of the overall stability or strength of the antibody-antigen complex. It is controlled by three major factors: antibody epitope affinity; the valence of both the antigen and antibody; and the structural arrangement of the interacting parts. Ultimately these factors define the specificity of the antibody, that is, the likelihood that the particular antibody is binding to a precise antigen epitope.
(154) Regions of a given polypeptide that include an epitope can be identified using any number of epitope mapping techniques, well known in the art. See, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66 (Glenn E. Morris, Ed., 1996) Humana Press, Totowa, N.J. For example, linear epitopes may be determined by e.g., concurrently synthesizing large numbers of peptides on solid supports, the peptides corresponding to portions of the protein molecule, and reacting the peptides with antibodies while the peptides are still attached to the supports. Such techniques are known in the art and described in, e.g., U.S. Pat. No. 4,708,871; Geysen et al., (1984) Proc. Natl. Acad. Sci. USA 8:3998-4002; Geysen et al., (1985) Proc. Natl. Acad. Sci. USA 82:78-182; Geysen et al., (1986) Mol. Immunol. 23:709-715. Similarly, conformational epitopes are readily identified by determining spatial conformation of amino acids such as by, e.g., x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, supra. Antigenic regions of proteins can also be identified using standard antigenicity and hydropathy plots, such as those calculated using, e.g., the Omiga version 1.0 software program available from the Oxford Molecular Group. This computer program employs the Hopp/Woods method, Hopp et al., (1981) Proc. Natl. Acad. Sci USA 78:3824-3828; for determining antigenicity profiles, and the Kyte-Doolittle technique, Kyte et al., (1982) J. Mol. Biol. 157:105-132; for hydropathy plots.
(155) Generation of Monoclonal Antibodies
(156) Monoclonal antibodies (mAbs) can be produced by a variety of techniques, including conventional monoclonal antibody methodology, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, 1975 Nature 256: 495. Many techniques for producing monoclonal antibody can be employed e.g., viral or oncogenic transformation of B lymphocytes.
(157) An animal system for preparing hybridomas is the murine system. Hybridoma production in the mouse is a well-established procedure. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners (e.g., murine myeloma cells) and fusion procedures are also known.
(158) In some embodiments, the antibodies of the invention are humanized monoclonal antibodies. Chimeric or humanized antibodies and antigen-binding fragments thereof of the present invention can be prepared based on the sequence of a murine monoclonal antibody prepared as described above. DNA encoding the heavy and light chain immunoglobulins can be obtained from the murine hybridoma of interest and engineered to contain non-murine (e.g., human) immunoglobulin sequences using standard molecular biology techniques. For example, to create a chimeric antibody, the murine variable regions can be linked to human constant regions using methods known in the art (see e.g., U.S. Pat. No. 4,816,567 to Cabilly et al.). To create a humanized antibody, the murine CDR regions can be inserted into a human framework using methods known in the art. See e.g., U.S. Pat. No. 5,225,539 to Winter, and U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al.
(159) In some embodiments, the antibodies of the invention are human monoclonal antibodies. Such human monoclonal antibodies directed against a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3) can be generated using transgenic or transchromosomic mice carrying parts of the human immune system rather than the mouse system. These transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as “human Ig mice.”
(160) The HuMAb Mouse® (Medarex, Inc.) contains human immunoglobulin gene miniloci that encode un-rearranged human heavy (mu and gamma) and kappa light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous mu and kappa chain loci (see e.g., Lonberg, et al., 1994 Nature 368 (6474): 856-859). Accordingly, the mice exhibit reduced expression of mouse IgM or K, and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG-kappa monoclonal (Lonberg, N. et al., 1994 supra; reviewed in Lonberg, N., 1994 Handbook of Experimental Pharmacology 113:49-101; Lonberg, N. and Huszar, D., 1995 Intern. Rev. Immunol. 13: 65-93, and Harding, F. and Lonberg, N., 1995 Ann. N.Y. Acad. Sci. 764:536-546). The preparation and use of HuMAb mice, and the genomic modifications carried by such mice, is further described in Taylor, L. et al., 1992 Nucleic Acids Research 20:6287-6295; Chen, J. et al., 1993 International Immunology 5: 647-656; Tuaillon et al., 1993 Proc. Natl. Acad. Sci. USA 94:3720-3724; Choi et al., 1993 Nature Genetics 4:117-123; Chen, J. et al., 1993 EMBO J. 12: 821-830; Tuaillon et al., 1994 J. Immunol. 152:2912-2920; Taylor, L. et al., 1994 International Immunology 579-591; and Fishwild, D. et al., 1996 Nature Biotechnology 14: 845-851, the contents of all of which are hereby specifically incorporated by reference in their entirety. See further, U.S. Pat. Nos. 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,789,650; 5,877,397; 5,661,016; 5,814,318; 5,874,299; and 5,770,429; all to Lonberg and Kay; U.S. Pat. No. 5,545,807 to Surani et al.; PCT Publication Nos. WO 92103918, WO 93/12227, WO 94/25585, WO 97113852, WO 98/24884 and WO 99/45962, all to Lonberg and Kay; and PCT Publication No. WO 01/14424 to Korman et al.
(161) In some embodiments, human antibodies can be raised using a mouse that carries human immunoglobulin sequences on transgenes and transchomosomes such as a mouse that carries a human heavy chain transgene and a human light chain trans chromosome. Such mice, referred to herein as “KM mice,” are described in detail in PCT Publication WO 02/43478 to Ishida et al.
(162) Still further, alternative transgenic animal systems expressing human immunoglobulin genes are available in the art and can be used to raise MINION-binding antibodies and antigen-binding fragments thereof. For example, an alternative transgenic system referred to as the Xenomouse (Abgenix, Inc.) can be used. Such mice are described in, e.g., U.S. Pat. Nos. 5,939,598; 6,075,181; 6,114,598; 6,150,584 and 6,162,963 to Kucherlapati et al.
(163) Moreover, alternative transchromosomic animal systems expressing human immunoglobulin genes are available in the art and can be used to raise MINION-binding antibodies of the invention. For example, mice carrying both a human heavy chain transchromosome and a human light chain transchromosome, referred to as “TC mice” can be used; such mice are described in Tomizuka et al., 2000 Proc. Natl. Acad. Sci. USA 97:722-727. Furthermore, cows carrying human heavy and light chain transchromosomes have been described in the art (Kuroiwa et al., 2002 Nature Biotechnology 20:889-894) and can be used to raise MINION-binding antibodies of the invention.
(164) Human monoclonal antibodies can also be prepared using phage display methods for screening libraries of human immunoglobulin genes. Such phage display methods for isolating human antibodies are established in the art or described in the examples below. See for example: U.S. Pat. Nos. 5,223,409; 5,403,484; and 5,571,698 to Ladner et al; U.S. Pat. Nos. 5,427,908 and 5,580,717 to Dower et al; U.S. Pat. Nos. 5,969,108 and 6,172,197 to McCafferty et al; and U.S. Pat. Nos. 5,885,793; 6,521,404; 6,544,731; 6,555,313; 6,582,915 and 6,593,081 to Griffiths et al.
(165) Human monoclonal antibodies of the invention can also be prepared using SCID mice into which human immune cells have been reconstituted such that a human antibody response can be generated upon immunization. Such mice are described in, for example, U.S. Pat. Nos. 5,476,996 and 5,698,767 to Wilson et al.
(166) Framework or Fc Engineering
(167) Engineered antibodies and antigen-binding fragments thereof of the invention include those in which modifications have been made to framework residues within VH and/or VL, e.g. to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived. To return the framework region sequences to their germline configuration, the somatic mutations can be “backmutated” to the germline sequence by, for example, site-directed mutagenesis. Such “backmutated” antibodies are also intended to be encompassed by the invention.
(168) Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell-epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
(169) In addition or alternative to modifications made within the framework or CDR regions, antibodies of the invention may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity. Furthermore, an antibody of the invention may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody. Each of these embodiments is described in further detail below. The numbering of residues in the Fc region is that of the EU index of Kabat.
(170) In one embodiment, the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al. The number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
(171) In another embodiment, the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745 by Ward et al.
(172) In another embodiment, the antibody is modified to increase its biological half-life. Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Pat. No. 6,277,375 to Ward. Alternatively, to increase the biological half life, the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al.
(173) In one embodiment, the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector functions of the antibody. For example, one or more amino acids can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260, both by Winter et al.
(174) In another embodiment, one or more amino acids selected from amino acid residues can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551 by Idusogie et al.
(175) In another embodiment, one or more amino acid residues are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351 by Bodmer et al.
(176) In some embodiments, the MINION-binding molecule contains a human IgG1 constant region. In some embodiments, the human IgG1 constant region includes an Fc region.
(177) In some embodiments, the Fc region of the MINION-binding molecule includes one or more mutations mediating reduced or no antibody-dependent cellular cytotoxicity (ADCC) or complement-dependent cytotoxicity (CDC). In some embodiments, amino acid residues L234 and L235 of the IgG1 constant region are substituted to A234 and A235. In some embodiments, amino acid residue N267 of the IgG1 constant region is substituted to A267. In some embodiments, amino acid residues D265 and P329 of the IgG1 constant region are substituted to A265 and A329. In certain embodiments, the Fc region optionally comprises a mutation or combination of mutations conferring reduced effector function selected from any of D265A, P329A, P329G, N297A, D265A/P329A, D265A/N297A, L234/L235A, P329A/L234A/L235A, and P329G/L234A/L235A. In some embodiments, the Fc region comprises a mutation or combination of mutations conferring reduced effector function selected from any of D265A, P329A, P329G, N297A, D265A/P329A, D265A/N297A, L234/L235A, P329A/L234A/L235A, and P329G/L234A/L235A (all positions by EU numbering).
(178) In yet another embodiment, the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fc-gamma receptor by modifying one or more amino acids. This approach is described further in PCT Publication WO 00/42072 by Presta. Moreover, the binding sites on human IgG1 for Fc-gamma RI, Fc-gamma RII, Fc-gamma RIII and FcRn have been mapped and variants with improved binding have been described (see Shields, R. L. et al., 2001 J. Biol. Chen. 276:6591-6604). For example, the Fc region can comprise a mutation or combination of mutations conferring increased effector function selected from any of S239D, I332E, A330L, S298A, E333A, E333S, K334A, K236A, K236W, F243L, P247I, D280H, K290S, R292P, S298D, S298V, Y300L, V305I, A339D, A339Q, A339T, P396L (all positions by EU numbering).
(179) In still another embodiment, the glycosylation of an antibody is modified. For example, an aglycosylated antibody can be made (i.e., the antibody lacks glycosylation). Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen. Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may increase the affinity of the antibody for antigen. Such an approach is described in further detail in U.S. Pat. Nos. 5,714,350 and 6,350,861 by Co et al.
(180) Additionally or alternatively, an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation. For example, EP 1,176,195 by Hang et al. describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation. PCT Publication WO 03/035835 by Presta describes a variant CHO cell line, LecI3 cells, with reduced ability to attach fucose to Asn (297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields, R. L. et al., 2002 J. Biol. Chem. 277:26733-26740). PCT Publication WO 99/54342 by Umana et al. describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., beta (1,4)-N acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana et al., 1999 Nat. Biotech. 17:176-180).
(181) In some embodiments, the MINION-binding molecule is an antibody. In some embodiments, the antibody has an IgG1 isotype with one or more mutations (e.g., relative to a wild-type Fc region of the same isotype). In some embodiments, the one or more mutations are selected from N297A, N297Q (Bolt S et al. (1993) Eur J Immunol 23:403-411), D265A, L234A, L235A (McEarchern et al., (2007) Blood, 109:1185-1192), C226S, C229S (McEarchern et al., (2007) Blood, 109:1185-1192), P238S (Davis et al., (2007) J Rheumatol, 34:2204-2210), E233P, L234V (McEarchern et al., (2007) Blood, 109:1185-1192), P238A, A327Q, A327G, P329A (Shields R L. et al., (2001) J Bioi Chem. 276(9):6591-604), K322A, L234F, L235E (Hezareh, et al., (2001) J Viral 75, 12161-12168; Oganesyan et al., (2008). Acta Crystallographica 64, 700-704), P331S (Oganesyan et al., (2008) Acta Crystallographica 64, 700-704), T394D (Wilkinson et al. (2013) MAbs 5(3): 406-417), A330L, M252Y, S254T, and/or T256E, where the amino acid position is according to the EU or Kabat numbering convention. In certain embodiments, the Fc region further includes an amino acid deletion at a position corresponding to glycine 236 according to the EU or Kabat numbering convention.
(182) In some embodiments, the antibody has an IgG1 isotype with a heavy chain constant region that contains a C220S mutation according to the EU or Kabat numbering convention.
(183) In some embodiments, the Fc region further contains one or more additional mutations selected from A330L, L234F; L235E, and/or P331S according to EU or Kabat numbering convention.
(184) In certain embodiments, the antibody has an IgG2 isotype. In some embodiments, the antibody contains a human IgG2 constant region. In some embodiments, the human IgG2 constant region includes an Fc region. In some embodiments, the Fc region contains one or more modifications. For example, in some embodiments, the Fc region contains one or more mutations (e.g., relative to a wild-type Fc region of the same isotype). In some embodiments, the one or more mutations are selected from V234A, G237A, H268E, V309L, N297A, N297Q, A330S, P331S, C232S, C233S, M252Y, S254T, and/or T256E, where the amino acid position is according to the EU or Kabat numbering convention.
(185) In certain embodiments, the antibody has an IgG4 isotype. In some embodiments, the antibody contains a human IgG4 constant region. In some embodiments, the human IgG4 constant region includes an Fc region. In some embodiments, the Fc region contains one or more modifications. For example, in some embodiments, the Fc region contains one or more mutations (e.g., relative to a wild-type Fc region of the same isotype). In some embodiments, the one or more mutations are selected from E233P, F234V, L235A, G237A, E318A (Hutchins et al. (1995) Proc Nat/ Acad Sci USA, 92:11980-11984), S228P, L236E, S241P, L248E (Reddy et al., (2000) J Immuno/, 164:1925-1933; Angal et al., (1993) Mol Immunol. 30(1):105-8; U.S. Pat. No. 8,614,299 B2), T394D, M252Y, S254T, T256E, N297A, and/or N297Q, where the amino acid position is according to the EU or Kabat numbering convention.
(186) In some embodiments, the Fc region further contains one or more additional mutations selected from a M252Y, S254T, and/or T256E, where the amino acid position is according to the EU or Kabat numbering convention.
(187) In some embodiments, one or more of the IgG1 variants described herein may be combined with an A330L mutation (Lazar et al., (2006) Proc Natl Acad Sci USA, 103:4005-4010), or one or more of L234F, L235E, and/or P331S mutations (Sazinsky et al., (2008) Proc Natl Acad Sci USA, 105:20167-20172), where the amino acid position is according to the EU or Kabat numbering convention, to eliminate complement activation. In some embodiments, the IgG variants described herein may be combined with one or more mutations to enhance the antibody half-liFc in human serum (e.g. M252Y, S254T, T256E mutations according to the EU or Kabat numbering convention) (Dall'Acqua et al., (2006) J Biol Chern, 281:23514-23524; and Strohl e al., (2009) Current Opinion in Biotechnology, 20:685-691).
(188) In some embodiments, an IgG4 variant of the present disclosure may be combined with an S228P mutation according to the EU or Kabat numbering convention (Angal et al., (1993) Mol Immunol, 30:105-108) and/or with one or more mutations described in Peters et al., (2012) J Biol Chern. 13; 287(29):24525-33) to enhance antibody stabilization.
(189) In some embodiments, the antibody has an Fc region selected from an IgG2 Fc region, an IgG4 Fc region, or an IgG2/IgG4 hybrid Fc region.
(190) Methods of Engineering Altered Antibodies
(191) As discussed above, the MINION-binding antibodies having VH and VL sequences or full length heavy and light chain sequences shown herein can be used to create new MINION-binding antibodies by modifying full length heavy chain and/or light chain sequences, VH and/or VL sequences, or the constant region (s) attached thereto. Thus, in another aspect of the invention, the structural features of MINION-binding antibody of the invention are used to create structurally related MINION-binding antibodies that retain at least one functional property of the antibodies and antigen-binding fragments thereof of the invention, such as binding to MINION.
(192) For example, one or more CDR regions of the antibodies and antigen-binding fragments thereof of the present invention, or mutations thereof, can be combined recombinantly with known framework regions and/or other CDRs to create additional, recombinantly-engineered, MINION-binding antibodies and antigen-binding fragments thereof of the invention, as discussed above. Other types of modifications include those described in the previous section. The starting material for the engineering method is one or more of the VH and/or VL sequences provided herein, or one or more CDR regions thereof. To create the engineered antibody, it is not necessary to actually prepare (i.e., express as a protein) an antibody having one or more of the VH and/or VL sequences provided herein, or one or more CDR regions thereof. Rather, the information contained in the sequence (s) is used as the starting material to create a “second generation” sequence (s) derived from the original sequence (s) and then the “second generation” sequence (s) is prepared and expressed as a protein.
(193) The altered antibody sequence can also be prepared by screening antibody libraries having fixed CDR3 sequences or minimal essential binding determinants as described in US20050255552 and diversity on CDR1 and CDR2 sequences. The screening can be performed according to any screening technology appropriate for screening antibodies from antibody libraries, such as phage display technology.
(194) Standard molecular biology techniques can be used to prepare and express the altered antibody sequence. The antibody encoded by the altered antibody sequence(s) is one that retains one, some or all of the functional properties of the MINION-binding antibodies described herein, which functional properties include, but are not limited to, specifically binding to MINION protein.
(195) The functional properties of the altered antibodies can be assessed using standard assays available in the art and/or described herein, such as those set forth in the Examples (e.g., ELISAs).
(196) In some embodiments, the methods of engineering antibodies and antigen-binding fragments thereof of the invention, mutations can be introduced randomly or selectively along all or part of a MINION-binding antibody coding sequence and the resulting modified MINION-binding antibodies can be screened for binding activity and/or other functional properties as described herein. Mutational methods have been described in the art. For example, PCT Publication WO 02/092780 by Short describes methods for creating and screening antibody mutations using saturation mutagenesis, synthetic ligation assembly, or a combination thereof. Alternatively, PCT Publication WO 03/074679 by Lazar et al. describes methods of using computational screening methods to optimize physiochemical properties of antibodies.
(197) Characterization of the Antibodies of the Invention
(198) The antibodies and antigen-binding fragments thereof of the invention can be characterized by various functional assays. For example, they can be characterized by their ability to bind a MINION protein (e.g., a human MINION protein, e.g., the protein of SEQ ID NO: 1 or 3).
(199) The ability of an antibody to bind to MINION can be detected by labelling the antibody of interest directly, or the antibody may be unlabeled and binding detected indirectly using various sandwich assay formats known in the art.
(200) In some embodiments, the MINION-binding antibodies and antigen-binding fragments thereof of the invention block or compete with binding of a reference MINION-binding antibody to MINION protein. These can be fully human or humanized antibodies that bind specifically to MINION described above. They can also be other human, mouse, chimeric or humanized antibodies which bind to the same epitope on MINION as the reference antibody. The capacity to block or compete with the reference antibody binding indicates that MINION-binding antibody under test binds to the same or similar epitope as that defined by the reference antibody, or to an epitope which is sufficiently proximal to the epitope bound by the reference MINION-binding antibody. Such antibodies are especially likely to share the advantageous properties identified for the reference antibody. The capacity to block or compete with the reference antibody may be determined by, e.g., a competition binding assay. With a competition binding assay, the antibody under test is examined for ability to inhibit specific binding of the reference antibody to a common antigen, such as MINION protein. A test antibody competes with the reference antibody for specific binding to the antigen if an excess of the test antibody substantially inhibits binding of the reference antibody. Substantial inhibition means that the test antibody reduces specific binding of the reference antibody usually by at least 10%, 25%, 50%, 75%, or 90%.
(201) There are a number of known competition binding assays that can be used to assess competition of an antibody with a reference antibody for binding to a particular protein, in this case, MINION. These include, e.g., solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see Stahli et al., Methods in Enzymology 9:242-253, 1983); solid phase direct biotin-avidin EIA (see Kirkland et al., J. Immunol. 137:3614-3619, 1986); solid phase direct labeled assay, solid phase direct labeled sandwich assay (see Harlow & Lane, supra); solid phase direct label RIA using I-125 label (see Morel et al., Molec. Immunol. 25:7-15, 1988); solid phase direct biotin-avidin EIA (Cheung et al., Virology 176:546-552, 1990); and direct labeled RIA (Moldenhauer et al., Scand. J. Immunol. 32:77-82, 1990). Typically, such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test MINION-binding antibody and a labelled reference antibody. Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antibody. Usually the test antibody is present in excess. Antibodies identified by competition assay (competing antibodies) include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
(202) To determine if the selected MINION-binding monoclonal antibodies bind to unique epitopes, each antibody can be biotinylated using commercially available reagents (e.g., reagents from Pierce, Rockford, Ill.). Competition studies using unlabeled monoclonal antibodies and biotinylated monoclonal antibodies can be performed using MINION protein coated-ELISA plates. Biotinylated MAb binding can be detected with a strep-avidin-alkaline phosphatase probe. To determine the isotype of a purified MINION-binding antibody, isotype ELISAs can be performed. For example, wells of microtiter plates can be coated with 1 □g/ml of anti-human IgG overnight at 4 degrees C. After blocking with 1% BSA, the plates are reacted with 1 □g/ml or less of the monoclonal MINION-binding antibody or purified isotype controls, at ambient temperature for one to two hours. The wells can then be reacted with either human IgG1 or human IgM-specific alkaline phosphatase-conjugated probes. Plates are then developed and analyzed so that the isotype of the purified antibody can be determined.
(203) To demonstrate binding of monoclonal MINION-binding antibodies to live cells expressing MINION protein, flow cytometry can be used. Briefly, cell lines expressing MINION (grown under standard growth conditions) can be mixed with various concentrations of MINION-binding antibody in PBS containing 0.1% BSA and 10% fetal calf serum, and incubated at 37 degrees ° C. for 1 hour. After washing, the cells are reacted with Fluorescein-labeled anti-human IgG antibody under the same conditions as the primary antibody staining. The samples can be analyzed by FACScan instrument using light and side scatter properties to gate on single cells. An alternative assay using fluorescence microscopy may be used (in addition to or instead of) the flow cytometry assay. Cells can be stained exactly as described above and examined by fluorescence microscopy. This method allows visualization of individual cells, but may have diminished sensitivity depending on the density of the antigen.
(204) MINION-binding antibodies and antigen-binding fragments thereof of the invention can be further tested for reactivity with MINION protein or antigenic fragment by Western blotting. Briefly, purified MINION protein or fusion proteins, or cell extracts from cells expressing MINION can be prepared and subjected to sodium dodecyl sulfate polyacrylamide gel electrophoresis. After electrophoresis, the separated antigens are transferred to nitrocellulose membranes, blocked with 10% fetal calf serum, and probed with the monoclonal antibodies to be tested. Human IgG binding can be detected using anti-human IgG alkaline phosphatase and developed with BCIP/NBT substrate tablets (Sigma Chem. Co., St. Louis, Mo.).
(205) Liposomes Comprising MINION Polypeptide and Methods of Delivering Therapeutic Agents
(206) Provided herein are also liposomes comprising a MINION polypeptide described herein, e.g., a MINION polypeptide of Table 1. Liposomes are closed lipid carriers characterized by lipid bilayers encapsulating an aqueous core. Liposomes can be used as carriers for a therapeutic agent. In some embodiments, the MINION polypeptide expresses on the surface of the liposomes. The fusogenic activity of the MINION polypeptide can induce fusion of the liposome lipids with a cell membrane, thereby delivering the liposomal content directly into the cytoplasm, bypassing the degradative endocytic entry pathway. Liposomes comprising a MINION polypeptide can fuse to a broad range of cell types, making them compatible with many therapeutic agents such as a nucleic acid (e.g., e.g., an antisense oligonucleotide, plasmid, siRNA, shRNA, aptamer), a protein or polypeptide (e.g., an antibody, antigen, enzyme, or therapeutic polypeptide), a peptide nucleic acid (PNA), or a low molecular weight compound.
(207) In some embodiments, the liposomes described herein include a MINION polypeptide comprising an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the liposomes described herein include a MINION polypeptide consisting of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the liposomes described herein include a polypeptide consisting of SEQ ID NO: 1. In some embodiments, the liposomes described herein include a polypeptide consisting of SEQ ID NO: 3. In some embodiments, the liposomes described herein include a polypeptide consisting of SEQ ID NO: 5. In some embodiments, the liposomes described herein include a polypeptide consisting of SEQ ID NO: 7.
(208) In some embodiments, the liposomes described herein also include a Myomaker polypeptide, e.g., a Myomaker polypeptide of Table 2. In some embodiments, the liposomes described herein include a Myomaker polypeptide comprising an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the liposomes described herein include a Myomaker polypeptide consisting of an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the liposomes described herein include a Myomaker polypeptide consisting of SEQ ID NO: 16. In some embodiments, the liposomes described herein include a Myomaker polypeptide consisting of SEQ ID NO: 18. In some embodiments, the liposomes described herein include a Myomaker polypeptide consisting of SEQ ID NO: 20.
(209) In some embodiments, liposomes described herein include a MINION polypeptide and a therapeutic agent encapsulated in the liposome. The therapeutic agent can be a nucleic acid (e.g., an antisense oligonucleotide, plasmid, siRNA, shRNA, aptamer), a protein or polypeptide (e.g., an antibody, antigen, enzyme, or therapeutic polypeptide), a peptide nucleic acid (PNA), or a low molecular weight compound. Such liposomes are fusogenic and can be used to deliver the therapeutic agent into a target cell, e.g., a human cell, e.g., a dysfunctional cell or a tumor cell, through the fusion of the liposome lipids into the cell membrane.
(210) Methods of making liposomes comprising a fusogenic protein have been described in US patent application publications, e.g., US 20140314831, US 20140134232, US 20090280163, US 20090142267, each of which is incorporated by reference herein. For example, a MINION polypeptide can be inserted into the liposomal membrane by the detergent depletion method derived from the concepts outlined in publications such as Rigaud et al., 1995, Biochim Biophys Acta 1231(3):223-46; Rigaud and Levy, 2003, Methods Enzymol., 372:65-86; and Top et al., 2005, EMBO J, 24(17):2980-8, the contents of which are incorporated herein by reference. Briefly, the purified MINION polypeptide can be reconstituted into the liposomes by mixing the detergent-suspended MINION polypeptide with liposomes pre-saturated with detergent, followed by removal of the detergent. To assist in the process of inserting the MINION polypeptide into the liposome membrane, n-octyl β-D-glucopyranoside (OG) can be used in the detergent. Based on the size and type of liposomes used, an optimal concentration of OG should be determined by incrementally adding OG to a solution of liposomal lipids across a 0-2.0% final volume concentration spectrum. Absorbance can be detected at λ.sub.600 nm and a plot derived of absorbance versus OG %. The optimal concentration is just below the critical OG concentration which causes dissolution of the liposomes.
(211) In some embodiments, a MINION polypeptide can be associated with the liposome through an electrostatic or hydrophobic interaction. For example, electrostatic interactions between the positively charged amino acids (Glu or Asp) of the MINION polypeptide and the negatively charged phospholipid membrane of the liposome can result in an association between them.
(212) Neutral or anionic liposomes, and cationic lipids are known to facilitate delivery of substance(s) to a host cell. These compounds are readily available to one skilled in the art; for example, see Liposomes: A Practical Approach, RCP New Ed, IRL press (1990). The liposomal lipids can include cationic lipids, synthetic lipids, glycolipids, phospholipids, cholesterol or derivatives thereof, and equivalent molecules known to those of skill in the art. Anionic and neutral liposomes are well-known in the art (see, e. g., Liposomes: A Practical Approach, RPC New Ed, IRL press (1990), for a detailed description of methods for making liposomes) and are useful for delivering a large range of therapeutic agents. Phospholipids can comprise preferably phosphatidylcholine, sphingomyelin, phosphatidylethanolamine, phosphatidylserine, phosphatidylglycerol, phosphatidic acid, cardiolipin and phosphatidylinositol with varying fatty acyl compositions.
(213) Cationic lipids are also known in the art and are commonly used for drug or gene delivery. Such lipids include Lipofectin™ also known as DOTMA (N-[1-(2,3-dioleyloxy) propyls-N,N,N-trimethylammonium chloride), DOTAP (1,2-bis(oleyloxy)-3-(trimethylammonio) propane), DDAB (dimethyldioctadecylammonium bromide), DOGS (dioctadecylamidologlycyl spermine) and cholesterol derivatives such as DC-Chol (3 beta-(N—(N′,N′-dimethyl aminomethane)-carbamoyl) cholesterol). A description of these cationic lipids can be found in EP 187,702, WO 90/11092, U.S. Pat. No. 5,283,185, WO 91/15501, WO 95/26356, and U.S. Pat. No. 5,527,928. Cationic lipids for delivery of polynucleotides are preferably used in association with a neutral lipid such as DOPE (dioleyl phosphatidylethanolamine), as described in WO 90/11092 as an example. Formulations containing cationic liposomes may optionally contain other transfection-facilitating compounds. A number of them are described in WO 93/18759, WO 93/19768, WO 94/25608, and WO 95/02397. They include spermine derivatives useful for facilitating the transport of DNA through the nuclear membrane (see, for example, WO 93/18759) and membrane-permeabilizing compounds such as GALA, Gramicidine S, and cationic bile salts (see, for example, WO 93/19768).
(214) Unilamellar liposomes can be prepared from multilamellar lipid vesicles. For example, a mixture of DOPC:COPE:cholesterol:DC-cholesterol in a molar ratio of 60:30:4:6 can be used to prepare a multilamellar lipid vesicle suspension. However, lipid vesicles containing PE-PEG2000 and/or DOTAP may be required in certain circumstances. The multilamellar lipid vesicles can be prepared by a number of different methods, which will be known to a person skilled in the art, such as the thin film method described by Fenske and Cullis, 2005, Methods Enzymol. 391:7-40.
(215) Unilamellar liposomes can be extruded from the multilamellar lipid vesicle suspension by manual extrusion through a polycarbonate membrane of defined pore size, using gas-tight, glass syringes, such as the LiposoFast-Basic (Avestin Inc., Ottawa, ON, Canada). In this procedure, the sample is passed through the membrane by pushing the sample back and forth between two syringes. In order to achieve a specific diameter of liposome, the multilamellar lipid vesicle suspension is passed through a filter having a specific diameter of pore size.
(216) Examples of liposomes or liposome compositions include those described in U.S. Pat. Nos. 4,789,633; 4,902,512; 4,925,661; 4,983,397; 5,013,556; 5,292,524; 5,534,241; 5,593,622; 5,648,478; 5,676,971; 5,756,069; 5,834,012; 5,846,458; 5,891,468; 5,945,122; 6,046,225; 6,057,299; 6,056,973; 6,077,834; 6,126,966; 6,153,596; 6,197,333; 6,228,391; 6,316,024; 6,387,397; 6,417,326; 6,476,068; 6,586,559; 6,627,218; 6,723,338; 6,897,196; 6,936,272; 7,384,923; US Pat. App. Publication. Nos. 2001/0033860; 2001/0038851; 2002/0136707; 2002/0034537; 2003/0224037; 2003/0113262; 2003/0072794; 2003/0082228; 2003/0212031; 2003/0203865; 2003/0175205; 2003/0162748; 2003/0130190; 2003/0059461; 2003/0215490; 2003/0166601; 2004/0022842; 2004/0142025; 2004/0071768; 2004/0234588; 2004/0213833; 2004/0029210; 2005/0271588; 2005/0136064; and International Patent Applications WO 99/30686; WO 02/41870; WO 00/74646; WO 96/13250; WO 98/33481; Aliminana et al., Prep. Biochem. Biotech. (2004) 34(1): 77-96; Papahadjopolulos D, Allen T M, Gbizon A, et al. “Sterically stabilized liposomes: Improvements in pharmacokinetics and antitumor therapeutic efficacy” Proc Natl Acad Sci U.S.A. (1991) 88: 11460-11464; Allen T M, Martin F J. “Advantages of liposomal delivery systems for anthracyclines” Semin Oncol (2004) 31: 5-15 (suppl 13); Weissig et al. Pharm. Res. (1998) 15: 1552-1556.
(217) In an effort to prolong the circulatory half-life of liposomes and avoid uptake by the reticuloendothelial system, researchers developed liposomes that were modified by the incorporation of polyethylene glycol or other hydrophilic polymers (e.g., a PEG liposome where one or more of the constituent lipids was modified by attachment of PEG). PEG-modified liposomes were also often referred to as “shielded” liposomes. Doxil™ (doxorubicin HCl liposome injection) is a liposome-enclosed doxorubicin, with adjunct polyethylene glycol (PEG) utilized to avoid the reticuloendothelial system (RES) and prolong drug circulation time. See Vail D M, Amantea M A, Colbern G T, et al., “Pegylated Liposomal Doxorubicin: Proof of Principle Using Preclinical Animal Models and Pharmacokinetic Studies.” Semin Oncol. (2004) 31 (Suppl 13): 16-35. However, adverse effects were also caused by prolonged blood retention (e.g., hand-foot syndrome, an adverse effect of Doxil® on the peripheral system, etc.) became recognized as a problem.
(218) In addition to PEG-modified liposomes, researchers developed a variety of other derivatized lipids. These derivatized lipids could also be incorporated into liposomes. See, for example: International Patent Application WO 93/01828; Park Y S, Maruyama K, Huang L. “Some negatively charged phospholipids derivatives prolong the liposome circulation in vivo.” Biochimica et Biophysica Acta (1992) 1108: 257-260; Ahl et al., Biochimica Biophys. Acta (1997) 1329: 370-382.
(219) In addition to modification of liposomes with PEG and other hydrophilic polymers, researchers also developed liposomes that aimed to specifically target particular cell types by incorporating targeting factors (also referred to as targeting ligands) for particular cell types. Examples of targeting factors/ligands include asialoglycoprotein, folate, transferrin, antibodies, etc. In some cases one or more of the constituent lipids could be modified by the attachment of a targeting factor.
(220) Examples of lipid compositions including targeting factors include U.S. Pat. Nos. 5,049,390; 5,780,052; 5,786,214; 6,316,024; 6,056,973; 6,245,427; 6,524,613; 6,749,863; 6,177,059; 6,530,944; 7,829,113; 8,758,810; U.S. Pat. App. Publication. Nos. 2004/0022842; 2003/0224037; 2003/143742; 2003/0228285; 2002/0198164; 2003/0220284; 2003/0165934; 2003/0027779; International Patent Application Nos. WO 95/33841; WO 95/19434; WO 2001037807; WO 96/33698; WO 2001/49266; WO 9940789; WO 9925320; WO 9104014; WO 92/07959; EP 1369132; JP 2001002592; Iinuma H, Maruyama K, et al., “Intracellular targeting therapy of cisplatin-encapsulated transferring-polyethylene glycol liposome on peritoneal dissemination of gastric cancer” Int J Cancer (2002) 99 130-137; Ishida O, Maruyama K, Tanahashi H, Iwatsuru M, Sasaki K, et al., “Liposomes bearing polyethylene glycol-coupled transferrin with intracellular targeting property to the solid tumors in vivo.” Pharmaceutical Research (2001) 18: 1042-1048; Holmberg et al., Biochem. Biophys. Res. Comm. (1989) 165(3):1272-1278; Nam et al., J. Biochem. Mol. Biol. (1998) 31(1): 95-100; Nag et al., J. Drug Target. (1999) 6(6): 427-438.
(221) Also provided herein are methods of delivering a therapeutic agent to a cell (e.g., a human cell, e.g., a dysfunctional cell or a tumor cell) by contacting a liposome comprising a MINION polypeptide described herein with the cell, wherein the liposome fuses with the cell and thereby delivers the therapeutic agent to the cell. The method can be performed in vitro or in vivo.
(222) Methods of Fusing Cells and Therapeutic Uses
(223) Provided herein are methods of fusing a first cell to a second cell using a MINION polypeptide, e.g., a MINION polypeptide of Table 1. In some embodiments, such methods can include the steps of (a) providing a first cell expressing a MINION polypeptide and a Myomaker polypeptide; and (b) contacting the first cell with a second cell expressing Myomaker, wherein the first cell fuses with the second cell. The step (b) of the method can be performed in vitro or in vivo.
(224) In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(225) In some embodiments, the Myomaker polypeptide comprises an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide consists of an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide comprises SEQ ID NO: 16 or a variant thereof. In some embodiments, the Myomaker polypeptide consists of SEQ ID NO: 16 or a variant thereof.
(226) In some embodiments, methods of fusing a first cell to a second cell can include the steps of (a) providing a first cell expressing a MINION polypeptide and a receptor that mediates homotypic interaction; and (b) contacting the first cell with a second cell expressing the same receptor expressed by the first cell, wherein the first cell fuses with the second cell. The receptor that mediates homotypic interaction includes but not limited to, e.g., a cadherin (e.g., N-Cadherin, P-Cadherin, E-Cadherin, or M-Cadherin), a selectin, a claudin, an occludin, a junctional adhesion molecule, or a tricellulin. The step (b) of the method can be performed in vitro or in vivo. In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(227) These methods can be used to fuse any types of muscle cells, e.g., human muscle cells; or non-muscle cells, e.g., human non-muscle cells. Thus, the first and second cells can be selected from a muscle cell, a fibroblast, a bone marrow cell, a blood cell, a hepatocyte, a stem cell, an epithelial cell, an endothelial cell, a dendritic cell, or a tumor cell. In some embodiments, the methods are used to fuse a muscle cell or a non-muscle cell (e.g., a fibroblast, a bone marrow cell, a blood cell, a hepatocyte, a stem cell, an epithelial cell, an endothelial cell, or a dendritic cell) with a tumor cell or a dysfunctional cell.
(228) In some embodiments, the first cell can express a detectable marker, e.g., a fluorescent molecule (e.g., fluorescein, Texas red, rhodamine, green fluorescent protein, and the like), an enzyme (e.g., horse radish peroxidase, alkaline phosphatase), a luminescent molecule (e.g., luciferase), a radioactive molecule (e.g., .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), or calorimetric labels such as colloidal gold or colored beads. Cells expressing a detectable marker can be traced or visualized by appropriate detection methods such as microscopy, autoradiography, and/or other imaging methods.
(229) In some embodiments, the first cell can include a gene of interest, and the fusion of the first and the second cells delivers the gene of interest to the second cell. In some embodiments, the gene of interest corrects a pathologic phenotype of the second cell. In some embodiments, the second cell can include a gene of interest, and the fusion of the first and the second cells delivers the gene of interest to the first cell. In some embodiments, the gene of interest corrects a pathologic phenotype of the first cell.
(230) In some embodiments, the gene of interest is a gene of the mitochondrial DNA, and the methods described herein can be used to treat a mitochondrial disease. For example, the pathologic phenotype can be selected from mitochondrial DNA depletion; mitochondrial myopathy; Myoclonic Epilepsy with Ragged Red Fibers (MERRF); mitochondrial myopathy, encephalomyopathy, lactic acidosis, stroke-like symptoms (MELAS); Kearns-Sayre syndrome (KSS); Leigh syndrome (subacute necrotizing encephalomyopathy) and maternally inherited Leigh syndrome (MILS); Mitochondrial neurogastrointestinal encephalomyopathy (MNGIE); Myoclonus epilepsy with ragged red fibers (MERRF); Neuropathy, ataxia and retinitis pigmentosa (NARP); or Pearson syndrome.
(231) In some embodiments, the gene of interest is a gene encoding fumaryl acetoacetate hydrolase (Fah), and the methods described herein can be used to treat Hereditary Tyrosinemia type I. In some embodiments, the gene of interest is a gene encoding Dystrophin, and the methods described herein can be used to treat Duchenne muscular dystrophy (DMD) or Becker muscular dystrophy (BMD). In some embodiments, the gene of interest is a gene encoding Dysferlin, and the methods described herein can be used to treat Miyoshi myopathy (MM), Limb-girdle muscular dystrophy type 2B (LGMD2B), and Distal Myopathy (DM).
(232) The compositions and methods described herein can be used to treat a cancer, e.g., head and neck cancer, skin cancer, breast cancer, prostate cancer, ovarian cancer, cervical cancer, lung cancer, liver cancer, renal cancer, pancreatic cancer, colorectal cancer, brain cancer, neuroblastoma, glioma, sarcoma, lymphoma, or leukemia. In some embodiments, the compositions and methods described herein can be used to treat a sarcoma selected from angiosarcoma, dermatofibrosarcoma, epithelioid sarcoma, Ewing's sarcoma, fibrosarcoma, gastrointestinal stromal tumors (GISTs), Kaposi sarcoma, Leiomyosarcoma, liposarcoma, malignant fibrous histiocytoma, neurofibrosarcoma, rhabdomyosarcoma, undifferentiated pleomorphic sarcoma, or synovial sarcoma.
(233) Methods of Treating Cancer Using Oncolytic Virus
(234) Provided herein are methods of treating cancer in a subject by administering to the subject a virus, e.g., an oncolytic virus, comprising a nucleic acid encoding a MINION polypeptide. In an alternative embodiment, provided herein is a virus, e.g. an oncolytic virus, comprising a nucleic acid encoding a MINION polypeptide for use in treating cancer. Infection of a cell with a virus encoding a fusogenic protein can cause extensive multinucleated syncytial formation, effectively increasing the area and number of cells transduced by the virus (Wong, PLOS ONE, DOI:10.1371/journal.pone.0151516, Mar. 17, 2016). Mixing of cytoplasmic contents of fusing cells means that any gene product encoded within the vector is efficiently transferred to all cells fused into the syncytium. Moreover, fusogenic proteins can act as effective single-agent therapeutics, as the process of fusion ultimately compromises cell function and induces cell death. In the context of oncolytic virus, in addition to normal tumor cell lysis resulting in release of virus, an infected cell can spread its infectious payload through direct cell-cell fusion (Wong, PLOS ONE, DOI:10.1371/journal.pone.0151516, Mar. 17, 2016).
(235) In some embodiments, methods of treating cancer in a subject can include administering to the subject an effective amount of an oncolytic virus comprising a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a Myomaker polypeptide. In an alternative embodiment, provided herein is an oncolytic virus comprising a nucleic acid encoding a MINION polypeptide and a nucleic acid encoding a Myomaker polypeptide for use in treating cancer in a subject, wherein an effective amount of the oncolytic virus is administered to the subject.
(236) In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(237) In some embodiments, the Myomaker polypeptide comprises an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide consists of an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide comprises SEQ ID NO: 16 or a variant thereof. In some embodiments, the Myomaker polypeptide consists of SEQ ID NO: 16 or a variant thereof.
(238) In some embodiments, methods of treating cancer in a subject can include administering to the subject an effective amount of an oncolytic virus comprising a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a receptor that mediates homotypic interaction. In an alternative embodiment, provided herein is an oncolytic virus comprising a nucleic acid encoding a MINION polypeptide and a nucleic acid encoding a receptor that mediates homotypic interaction for use in treating cancer in a subject, wherein an effective amount of the oncolytic virus is administered to the subject. The receptor that mediates homotypic interaction includes but not limited to, e.g., a cadherin (e.g., N-Cadherin, P-Cadherin, E-Cadherin, or M-Cadherin), a selectin, a claudin, an occludin, a junctional adhesion molecule, or a tricellulin. In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(239) Suitable oncolytic viruses are known in the art, e.g., those described in Kaufman, Nat Rev Drug Discov. 2015; 14(9):642-662, which is incorporated by reference herein in its entirety. In some embodiments, the oncolytic virus specifically targets cancer cells, e.g., the oncolytic virus has no effect or a minimal effect on non-cancer cells. In some embodiments, the oncolytic virus selectively replicates in cancer cells. In embodiments, the oncolytic virus is capable of selectively replicating in and triggering the death of or slowing the growth of a cancer cell. An oncolytic virus includes but is not limited to an oncolytic adenovirus, oncolytic adeno-associated virus, oncolytic Herpes Simplex Virus (HSV), oncolytic parvovirus, oncolytic retrovirus, oncolytic lentivirus, oncolytic vaccinia virus, oncolytic Sinbis virus, oncolytic influenza virus, oncolytic reovirus, oncolytic Newcastle disease virus (NDV), oncolytic measles virus, oncolytic vesicular stomatitis virus (VSV), oncolytic poliovirus, oncolytic poxvirus, oncolytic Seneca Valley virus, oncolytic coxsackievirus, oncolytic enterovirus, oncolytic myxoma virus, or oncolytic maraba virus.
(240) In some embodiments, the oncolytic virus is a recombinant oncolytic virus, such as those described in US2010/0178684, which is incorporated herein by reference in its entirety. In some embodiments, a recombinant oncolytic virus comprises a nucleic acid sequence (e.g., heterologous nucleic acid sequence) encoding an inhibitor of an immune or inflammatory response, e.g., as described in US2010/0178684, which is incorporated herein by reference in its entirety. In embodiments, the recombinant oncolytic virus, e.g., oncolytic NDV, comprises a pro-apoptotic protein (e.g., apoptin), a cytokine (e.g., GM-CSF, CSF, interferon-gamma, interleukin-2 (IL-2), tumor necrosis factor-alpha), an immunoglobulin (e.g., an antibody against ED-B fibronectin), tumor associated antigen, a bispecific adapter protein (e.g., bispecific antibody or antibody fragment directed against NDV HN protein and a T cell co-stimulatory receptor, such as CD3 or CD28; or fusion protein between human IL-2 and single chain antibody directed against NDV HN protein). See, e.g., Zamarin et al. Future Microbiol. 7.3(2012):347-67, incorporated herein by reference in its entirety. In some embodiments, the oncolytic virus is a chimeric oncolytic NDV described in U.S. Pat. No. 8,591,881 B2, US 2012/0122185 A1, or US 2014/0271677 A1, each of which is incorporated herein by reference in their entireties.
(241) In some embodiments, the oncolytic virus comprises a conditionally replicative adenovirus (CRAd), which is designed to replicate exclusively in cancer cells. See, e.g., Alemany et al. Nature Biotechnol. 18(2000):723-27. In some embodiments, an oncolytic adenovirus comprises one described in Table 1 on page 725 of Alemany et al., incorporated herein by reference in its entirety.
(242) Exemplary oncolytic viruses include but are not limited to the following:
(243) Group B Oncolytic Adenovirus (ColoAd1) (PsiOxus Therapeutics Ltd.) (see, e.g., Clinical Trial Identifier: NCT02053220);
(244) ONCOS-102 (previously called CGTG-102), which is an adenovirus comprising granulocyte-macrophage colony stimulating factor (GM-CSF) (Oncos Therapeutics) (see, e.g., Clinical Trial Identifier: NCT01598129);
(245) VCN-01, which is a genetically modified oncolytic human adenovirus encoding human PH20 hyaluronidase (VCN Biosciences, S.L.) (see, e.g., Clinical Trial Identifiers: NCT02045602 and NCT02045589);
(246) Conditionally Replicative Adenovirus ICOVIR-5, which is a virus derived from wild-type human adenovirus serotype 5 (Had5) that has been modified to selectively replicate in cancer cells with a deregulated retinoblastoma/E2F pathway (Institut Català d'Oncologia) (see, e.g., Clinical Trial Identifier: NCT01864759);
Celyvir, which comprises bone marrow-derived autologous mesenchymal stem cells (MSCs) infected with ICOVIR5, an oncolytic adenovirus (Hospital Infantil Universitario Niño Jesús, Madrid, Spain/Ramon Alemany) (see, e.g., Clinical Trial Identifier: NCT01844661);
CG0070, which is a conditionally replicating oncolytic serotype 5 adenovirus (Ad5) in which human E2F-1 promoter drives expression of the essential E1a viral genes, thereby restricting viral replication and cytotoxicity to Rb pathway-defective tumor cells (Cold Genesys, Inc.) (see, e.g., Clinical Trial Identifier: NCT02143804); or
DNX-2401 (formerly named Delta-24-RGD), which is an adenovirus that has been engineered to replicate selectively in retinoblastoma (Rb)-pathway deficient cells and to infect cells that express certain RGD-binding integrins more efficiently (Clinica Universidad de Navarra, Universidad de Navarra/DNAtrix, Inc.) (see, e.g., Clinical Trial Identifier: NCT01956734).
(247) In some embodiments, the oncolytic virus can express a detectable marker, e.g., a fluorescent molecule (e.g., fluorescein, Texas red, rhodamine, green fluorescent protein, and the like), an enzyme (e.g., horse radish peroxidase, alkaline phosphatase), a luminescent molecule (e.g., luciferase), a radioactive molecule (e.g., .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), or calorimetric labels such as colloidal gold or colored beads.
(248) In some embodiments, an oncolytic virus described herein is administering by injection, e.g., subcutaneous, intra-arterial, intravenous, intramuscular, intrathecal, or intraperitoneal injection. In some embodiments, an oncolytic virus described herein is administered intratumorally, transdermally, transmucosally, orally, intranasally, subcutaneously, intra-arterially, intravenously, intramuscularly, intrathecally, or intraperitoneally, or via pulmonary administration.
(249) Cancer Vaccines and Therapeutic Uses
(250) Cancer vaccines based on tumor-dendritic cell heterokaryons can potently induce immunity through the enhanced presentation of tumor antigens via both class I and class II MHC (Gong et al., Induction of antitumor activity by immunization with fusions of dendritic and carcinoma cells. Nat Med 1997, 3:558-561, the content of which is hereby incorporated by reference in its entirety), and co-expression of Minion/Myomerger and Myomaker could dramatically improve the efficiency of forming these hybrids.
(251) Accordingly, in some embodiments, provided herein are a cancer vaccine comprising a dendritic-tumor fusion cell comprising a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a Myomaker polypeptide. In an alternative embodiment, provided herein is a cancer vaccine comprising a dendritic-tumor fusion cell comprising a nucleic acid encoding a MINION polypeptide and a nucleic acid encoding a Myomaker polypeptide for use in treating cancer in a subject, wherein an effective amount of the cancer vaccine is administered to the subject. In some embodiments, provided herein is a cancer vaccine comprising a dendritic-tumor fusion cell comprising a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a receptor that mediates homotypic interaction. In an alternative embodiment, provided herein is a cancer vaccine comprising a dendritic-tumor fusion cell comprising a nucleic acid encoding a MINION polypeptide and a nucleic acid encoding a receptor that mediates homotypic interaction for use in treating cancer in a subject, wherein an effective amount of the cancer vaccine is administered to the subject.
(252) In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(253) In some embodiments, the Myomaker polypeptide comprises an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide consists of an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide comprises SEQ ID NO: 16 or a variant thereof. In some embodiments, the Myomaker polypeptide consists of SEQ ID NO: 16 or a variant thereof.
(254) The receptor that mediates homotypic interaction includes but not limited to, e.g., a cadherin (e.g., N-Cadherin, P-Cadherin, E-Cadherin, or M-Cadherin), a selectin, a claudin, an occludin, a junctional adhesion molecule, or a tricellulin.
(255) Methods of producing a dendritic-tumor fusion cell as a cancer vaccine are known in the art. For example, fusing dendritic cells (DC) and whole tumor cells by chemical, physical, or biological means creates heterokaryons, which include dendritic cell-derived MHC class I, MHC class II, and costimulatory molecules as well as whole tumor-derived tumor-associated antigens. See, e.g., Koido, S.; Ohana, M.; Liu, C.; Nikrui, N.; Durfee, J.; Lerner, A.; Gong, J. Dendritic cells fused with human cancer cells: Morphology, antigen expression, and T cell stimulation. Clin. Immunol. 2004, 113, 261-269; Gong, J.; Koido, S.; Calderwood, S. K. Cell fusion: From hybridoma to dendritic cell-based vaccine. Expert Rev. Vaccines 2008, 7, 1055-1068; Kajihara, M.; Takakura, K.; Ohkusa, T.; Koido, S. The impact of dendritic cell-tumor fusion cells on cancer vaccines—Past progress and future strategies. Immunotherapy 2015, 7, 1111-1122; Takakura, K.; Kajihara, M.; Ito, Z.; Ohkusa, T.; Gong, J.; Koido, S. Dendritic-tumor fusion cells in cancer immunotherapy. Discov. Med. 2015, 19, 169-174, the contents of which are hereby incorporated by reference in their entireties. DC-tumor fusion approach offers the following advantages for inducing antitumor immune responses: (1) DC-tumor FCs present whole tumor-derived antigenic peptides, which avoids the need to identify antigenic peptides for individual patients; (2) a broad array of known and unidentified tumor-associated antigens (TAAs) can be simultaneously presented on the surface of DC-tumor FCs, which increases the frequency of polyclonal antigen-specific CD4+ and CD8+ T cells, resulting in long-term efficient antitumor immunity; (3) numerous TAAs are presented in the context of co-stimulatory molecules, which prevents tolerance induction, resulting in efficient antitumor immune response; and (4) DC-tumor FCs migrate into draining lymph nodes and form clusters with CD4+ and CD8+ T cells in the T cell area of lymph nodes, such that DC-tumor FCs do not have to take up exogenous TAAs in order to activate CD4+ and CD8+ T cells. See Koido S., Dendritic-Tumor Fusion Cell-Based Cancer Vaccines. Int'l J. Mol. Sci. 2016, 17, 828, the content of which is hereby incorporated by reference in its entirety.
(256) In some embodiments, the dendritic-tumor fusion cell is produced by fusing a dendritic cell and a tumor cell, whereas the fusion of the dendritic cell and the tumor cell is facilitated by the expression of a MINION polypeptide and a Myomaker polypeptide. In some embodiments, the dendritic cell comprises a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a Myomaker polypeptide. In some embodiments, the tumor cell comprises a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a Myomaker polypeptide. In some embodiments, the dendritic cell comprises a nucleic acid encoding a MINION polypeptide, and the tumor cell comprises a nucleic acid encoding a Myomaker polypeptide, or vice versa.
(257) The dendritic cell and/or the tumor cell can be autologous or allogeneic. For example, the use of DCs from healthy donors as a source of allogeneic DCs to generate allogeneic DC-tumor FC vaccines has been investigated. See, e.g., Koido, S.; Hara, E.; Homma, S.; Ohkusa, T.; Gong, J.; Tajiri, H. Cancer immunotherapy by fusions of dendritic cells and tumor cells. Immunotherapy 2009, 1, 49-62, the content of which is hereby incorporated by reference in its entirety. Alternatively, allogeneic tumor cell lines have been used in place of autologous tumor cells to induce autologous tumor-specific antitumor immune responses. See, e.g., Koido, S.; Hara, E.; Homma, S.; Torii, A.; Toyama, Y.; Kawahara, H.; Watanabe, M.; Yanaga, K.; Fujise, K.; Tajiri, H.; et al. Dendritic cells fused with allogeneic colorectal cancer cell line present multiple colorectal cancer-specific antigens and induce antitumor immunity against autologous tumor cells. Clin. Cancer Res. 2005, 11, 7891-7900; Koido, S.; Tanaka, Y.; Tajiri, H.; Gong, J. Generation and functional assessment of antigen-specific T cells stimulated by fusions of dendritic cells and allogeneic breast cancer cells. Vaccine 2007, 25, 2610-2619; Koido, S.; Hara, E.; Homma, S.; Namiki, Y.; Komita, H.; Takahara, A.; Nagasaki, E.; Ito, M.; Sagawa, Y.; Mitsunaga, M.; et al. Dendritic/pancreatic carcinoma fusions for clinical use: Comparative functional analysis of healthy-versus patient-derived fusions. Clin. Immunol. 2010, 135, 384-400, the content of which is hereby incorporated by reference in its entirety. Further, allogeneic DC lines and allogeneic tumor cell lines may be used instead of autologous cells. Cell lines are well characterized and can be well propagated in vitro under GMP standards. DC-tumor FC vaccines with fully allogeneic components have been demonstrated to induce clinical responses. See Märten, A.; Renoth, S.; Heinicke, T.; Albers, P.; Pauli, A.; Mey, U.; Caspari, R.; Flieger, D.; Hanfland, P.; von Ruecker, A.; et al. Allogeneic dendritic cells fused with tumor cells: Preclinical results and outcome of a clinical phase I/II trial in patients with metastatic renal cell carcinoma. Hum. Gene Ther. 2003, 14, 483-494, the content of which is hereby incorporated by reference in its entirety.
(258) In some embodiments, the DCs may be immunomodulated, e.g., treated by an agonist for a Toll-like receptor (TLR), before being fused to tumor cells. In some embodiments, the DCs may be fused to an immunogenic tumor cell, e.g., a tumor cell treated with heat or ethanol. In some embodiments, the fusion of DCs and immunogenic whole tumor cells activates antigen-specific CD4+ and CD8+ T cells that produce high levels of IFN-γ.
(259) In some embodiments, the DCs may be fused to cancer stem cells (CSCs). For example, the DCs may be fused to CSCs expressing one or more stem cell markers, including OCT3/4, ABCG2, nestin, SOX2, Bmi-1, Notch-1, CD44, CD133, and CD177. In some embodiments, the DCs may be fused to CSCs overexpressing survivin, MUC1, hTERT, HER2, CERP55, COA-1, or WT1.
(260) In some embodiments, the dendritic-tumor fusion cell comprises one or more tumor-associated antigens (TAAs). Exemplary tumor-associated antigens include, but are not limited to, Alphafetoprotein (AFP), Carcinoembryonic antigen (CEA), Immature laminin receptor, TAG-72, HPV E6, HPV E7, BING-4, Calcium-activated chloride channel 2, Cyclin-B1, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, Mesothelin, SAP-1, Survivin, CT9, CT10, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, Gp100/pmel17, TRP-1, TRP-2, P.polypeptide, MC1R, Prostate-specific antigen (PSA), β-catenin, BRCA1, BRCA2, CDK4, CML66, Fibronectin, MART-2, TGF-βRII, CA-125, MUC-1, Epithelial tumor antigen (ETA), Tyrosinase, B melanoma antigen (BAGE), CAGE, GAGE-1, GAGE-2, GAGE-3, GAGE-6, Melanoma-associated antigen (MAGE), sarcoma antigen 1 (SAGE-1), XAGE-1, XAGE-2, XAGE-3, Ras, p53, etc.
(261) Further provided are methods of treating cancer in a subject using the a cancer vaccine disclosed herein. In some embodiments, a cancer vaccine described herein is administering by injection, e.g., subcutaneous, intra-arterial, intravenous, intramuscular, intrathecal, or intraperitoneal injection. In some embodiments, a cancer vaccine described herein is administered intratumorally, transdermally, transmucosally, orally, intranasally, subcutaneously, intra-arterially, intravenously, intramuscularly, intrathecally, or intraperitoneally, or via pulmonary administration.
(262) Methods of Treating Muscular Dystrophy
(263) The compositions and methods disclosed herein may be used to treat a muscular dystrophy, such as Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), Congenital muscular dystrophy (CMD), Distal muscular dystrophy, Emery-Dreifuss muscular dystrophy (EDMD), Facioscapulohumeral muscular dystrophy (FMD), Limb-Girdle muscular dystrophy (LGMD), Myotonic muscular dystrophy (MMD), Oculopharnyngeal muscular dystrophy (OMD), Miyoshi myopathy (MM), Limb-girdle muscular dystrophy type 2B (LGMD2B), Distal Myopathy (DM), etc. Early work in the mdx mouse model of DMD suggested that exogenously delivered cells arising from either the muscle or hematopoietic lineage could contribute to myofiber formation via cell fusion (Gussoni et al., Dystrophin expression in the mdx mouse restored by stem cell transplantation. Nature 1999, 401:390-394; Gibson et al., Dermal fibroblasts convert to a myogenic lineage in mdx mouse muscle. J Cell Sci 1995, 108 (Pt 1):207-214). The identification of Myomaker opened the door to increasing the fusogenic potential of cell-based therapies, thereby increasing their complementation potential. Studies utilizing non-muscle derived cells, such as fibroblasts and mesenchymal stem cells, indeed demonstrated that overexpression of Myomaker could promote the fusion of these cells into muscle in vivo (Mitani et al., In vivo myomaker-mediated heterologous fusion and nuclear reprogramming. FASEB J 2017, 31:400-411).
(264) Accordingly, provided herein are methods of treating muscular dystrophy in a subject using the compositions disclosed herein. In some embodiments, methods of treating muscular dystrophy in a subject can include administering to the subject an effective amount of a therapeutic cell comprising a nucleic acid encoding a MINION polypeptide. In some embodiments, methods of treating muscular dystrophy in a subject can include administering to the subject an effective amount of a therapeutic cell comprising a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a Myomaker polypeptide. In an alternative embodiment, provided herein is a therapeutic cell comprising a nucleic acid encoding a MINION polypeptide and/or a nucleic acid encoding a Myomaker polypeptide for use in treating muscular dystrophy in a subject, wherein an effective amount of the therapeutic cell is administered to the subject.
(265) In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(266) In some embodiments, the Myomaker polypeptide comprises an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide consists of an amino acid sequence selected from SEQ ID NO: 16, 18, 20, 22, 24, 26, 28, or 30, or a variant thereof. In some embodiments, the Myomaker polypeptide comprises SEQ ID NO: 16 or a variant thereof. In some embodiments, the Myomaker polypeptide consists of SEQ ID NO: 16 or a variant thereof.
(267) In some embodiments, methods of treating muscular dystrophy in a subject can include administering to the subject an effective amount of a therapeutic cell comprising a nucleic acid encoding a MINION polypeptide, and a nucleic acid encoding a receptor that mediates homotypic interaction. In an alternative embodiment, provided herein is a therapeutic cell comprising a nucleic acid encoding a MINION polypeptide and a nucleic acid encoding a receptor that mediates homotypic interaction for use in treating muscular dystrophy in a subject, wherein an effective amount of the therapeutic cell is administered to the subject. The receptor that mediates homotypic interaction includes but not limited to, e.g., a cadherin (e.g., N-Cadherin, P-Cadherin, E-Cadherin, or M-Cadherin), a selectin, a claudin, an occludin, a junctional adhesion molecule, or a tricellulin. In some embodiments, the MINION polypeptide comprises an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide consists of an amino acid sequence selected from SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, or 15, or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide comprises SEQ ID NO: 3 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 1 or a variant thereof. In some embodiments, the MINION polypeptide consists of SEQ ID NO: 3 or a variant thereof.
(268) In some embodiments, the therapeutic cells may restore the function of the dysfunctional cell by introducing a gene of interest, e.g., a correct version of the gene that is mutated in the dysfunctional cell, to the dysfunctional cell, and thereby correct the genetic abnormality in the dysfunctional cell. For example, the therapeutic cells may contain a correct version of the dystrophin gene. The therapeutic cells may be autologous or allogeneic. In embodiments where the therapeutic cells are autologous, the genetic abnormality of the therapeutic cells may be corrected by a variety of gene editing systems known in the art. As used herein, the term “gene editing system” refers to a system comprising one or more DNA-binding domains or components and one or more DNA-modifying domains or components, or isolated nucleic acids, e.g., one or more vectors, encoding said DNA-binding and DNA-modifying domains or components. Gene editing systems are used for modifying the nucleic acid of a target gene and/or for modulating the expression of a target gene. In known gene editing systems, for example, the one or more DNA-binding domains or components are associated with the one or more DNA-modifying domains or components, such that the one or more DNA-binding domains target the one or more DNA-modifying domains or components to a specific nucleic acid site.
(269) Gene editing systems are known in the art, and include but are not limited to, zinc finger nucleases, transcription activator-like effector nucleases (TALENs); clustered regularly interspaced short palindromic repeats (CRISPR)/Cas systems, and meganuclease systems. Without wishing to be bound by theory, it is believed that the known gene editing systems may exhibit unwanted DNA-modifying activity which is detrimental to their utility in therapeutic applications. These concerns are particularly apparent in the use of gene editing systems for in vivo modification of genes or gene expression, e.g., where cells are engineered to constitutively express components of a gene editing system, such as through lentiviral or adenoviral vector transfection.
(270) “CRISPR” as used herein refers to a set of clustered regularly interspaced short palindromic repeats, or a system comprising such a set of repeats. “Cas,” as used herein, refers to a CRISPR-associated protein. The diverse CRISPR-Cas systems can be divided into two classes according to the configuration of their effector modules: class 1 CRISPR systems utilize several Cas proteins and the crRNA to form an effector complex, whereas class 2 CRISPR systems employ a large single-component Cas protein in conjunction with crRNAs to mediate interference. One example of class 2 CRISPR-Cas system employs Cpf1 (CRISPR from Prevotella and Francisella 1). See, e.g., Zetsche et al., Cell 163:759-771 (2015), the content of which is herein incorporated by reference in its entirety. The term “Cpf1” as used herein includes all orthologs, and variants that can be used in a CRISPR system.
(271) It is contemplated that the therapeutic cells may be the same or different cell type from the dysfunctional cell. For example, the therapeutic cell may be a muscle cell such as a myoblast, a cardiac muscle cell, a skeletal muscle cell, or a smooth muscle cell; or a non-muscle cell such as a fibroblast, a bone marrow cell, a blood cell, a hepatocyte, a stem cell, an epithelial cell, an endothelial cell, a dendritic cell, etc.
(272) Methods of Studying Cell Fate and Reprogramming
(273) The methods and compositions disclosed herein may be further used to study cell fate and reprogramming, e.g., identifying genes that are expressed or inhibited during cell specialization. Early studies on somatic cell nuclear reprogramming relied on chemical methods such as PEG treatment to induce heterokaryon formation (Blau et al., Cytoplasmic activation of human nuclear genes in stable heterocaryons. Cell 1983, 32:1171-1180, the content of which is hereby incorporated by reference in its entirety). It is contemplated that transient expression of Myomaker and MINION via conditional/inducible systems will allow far greater control of fusion, with resulting insights into the temporal dynamics of nuclear reprogramming.
(274) Accordingly, the methods and compositions disclosed herein may be used to fuse a first cell and a second cell to generate a stable heterokaryon, wherein the first cell is reprogrammed by the second cell, e.g., the expression of one or more genes in the first cell are modulated by the second cell. In some embodiments, the first and second cells can be selected from a muscle cell, a fibroblast, a bone marrow cell, a blood cell, a hepatocyte, a stem cell, an epithelial cell, an endothelial cell, a dendritic cell, or a tumor cell. In some embodiments, the first cell and the second cell are from different species, such as human, monkey, mouse, rat, pig, etc. In some embodiments, the methods may comprise identifying the one or more genes that are modulated, for example, by comparing the gene expression profile of the first cell before fusion to that of the stable heterokaryon.
(275) Pharmaceutical Compositions
(276) Also provided herein are compositions, e.g., pharmaceutical compositions, comprising one or more MINION polypeptides (e.g., one or more human MINION polypeptides), one or more nucleic acids encoding a MINION polypeptide (e.g., a human MINION polypeptide), one or more liposomes comprising a MINION polypeptide (e.g., a human MINION polypeptide), one or more therapeutic cells comprising a MINION polypeptide (e.g., a human MINION polypeptide), one or more oncolytic viruses comprising a MINION polypeptide (e.g., a human MINION polypeptide), or one or more cancer vaccines comprising a MINION polypeptide (e.g., a human MINION polypeptide) described herein. Pharmaceutical compositions typically include a pharmaceutically acceptable carrier. As used herein the language “pharmaceutically acceptable carrier” includes saline, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Pharmaceutical compositions are typically formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral (e.g., intravenous, intraarterial, intraperitoneal), oral, intracranial, intrathecal, intranasal (e.g., inhalation), intradermal, subcutaneous, or transmucosal administration.
(277) In some embodiments, the pharmaceutical compositions comprise one or more pharmaceutically acceptable carriers, including, e.g., ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol, and wool fat.
(278) Methods of formulating suitable pharmaceutical compositions are known in the art, see, e.g., Remington: The Science and Practice of Pharmacy. 21st ed., 2005; and the books in the series Drugs and the Pharmaceutical Sciences: a Series of Textbooks and Monographs (Dekker, NY). For example, solutions or suspensions used for parenteral, intradermal, intrathecal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
(279) Pharmaceutical compositions suitable for injectable use can include sterile aqueous solutions (where water soluble) or dispersions and sterile powders, for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin.
(280) Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
(281) Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying, which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
(282) Parenteral formulations can be a single bolus dose, an infusion or a loading bolus dose followed with a maintenance dose. These compositions can be administered at specific fixed or variable intervals, e.g., once a day, or on an “as needed” basis.
(283) A suitable pharmaceutical composition for injection can comprise a buffer (e.g., acetate, phosphate or citrate buffer), a surfactant (e.g., polysorbate), optionally a stabilizer agent (e.g., human albumin), etc. Preparations for peripheral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include, e.g., water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. In some embodiments, the pharmaceutical composition comprises 0.01-0.1 M phosphate buffer or 0.8% saline. Other common parenteral vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives can also be present such as, for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
(284) Oral compositions generally include an inert diluent or an edible carrier. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules, e.g., gelatin capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
(285) For administration by inhalation, the compounds can be delivered in the form of an aerosol spray from a pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer. Such methods include those described in U.S. Pat. No. 6,468,798. Systemic administration of a therapeutic compound as described herein can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
(286) In one embodiment, the therapeutic compounds are prepared with carriers that will protect the therapeutic compounds against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
(287) The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
(288) In non-limiting examples, the pharmaceutical composition containing at least one pharmaceutical agent is formulated as a liquid (e.g., a thermosetting liquid), as a component of a solid (e.g., a powder or a biodegradable biocompatible polymer (e.g., a cationic biodegradable biocompatible polymer)), or as a component of a gel (e.g., a biodegradable biocompatible polymer). In some embodiments, the at least composition containing at least one pharmaceutical agent is formulated as a gel selected from the group of an alginate gel (e.g., sodium alginate), a cellulose-based gel (e.g., carboxymethyl cellulose or carboxyethyl cellulose), or a chitosan-based gel (e.g., chitosan glycerophosphate). Additional, non-limiting examples of drug-eluting polymers that can be used to formulate any of the pharmaceutical compositions described herein include, carrageenan, carboxymethylcellulose, hydroxypropylcellulose, dextran in combination with polyvinyl alcohol, dextran in combination with polyacrylic acid, polygalacturonic acid, galacturonic polysaccharide, polysalactic acid, polyglycolic acid, tamarind gum, xanthum gum, cellulose gum, guar gum (carboxymethyl guar), pectin, polyacrylic acid, polymethacrylic acid, N-isopropylpolyacrylomide, polyoxyethylene, polyoxypropylene, pluronic acid, polylactic acid, cyclodextrin, cycloamylose, resilin, polybutadiene, N-(2-Hydroxypropyl)methacrylamide (HP MA) copolymer, maleic anhydrate-alkyl vinyl ether, polydepsipeptide, polyhydroxybutyrate, polycaprolactone, polydioxanone, polyethylene glycol, polyorganophosphazene, polyortho ester, polyvinylpyrrolidone, polylactic-co-glycolic acid (PLGA), polyanhydrides, polysilamine, poly N-vinyl caprolactam, and gellan.
(289) An “effective amount” is an amount sufficient to effect beneficial or desired results. For example, a therapeutic amount is one that achieves the desired therapeutic effect. This amount can be the same or different from a prophylactically effective amount, which is an amount necessary to prevent onset of disease or disease symptoms. An effective amount can be administered in one or more administrations, applications or dosages. A therapeutically effective amount of a therapeutic compound (i.e., an effective dosage) depends on the therapeutic compounds selected. The compositions can be administered one from one or more times per day to one or more times per week; including once every other day. The skilled artisan will appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but are not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of the therapeutic compounds described herein can include a single treatment or a series of treatments.
(290) Dosage, toxicity and therapeutic efficacy of the therapeutic compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population), and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Compounds which exhibit high therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
(291) The data obtained from cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
(292) Kits
(293) Also provided are kits including one or more MINION polypeptides (e.g., one or more human MINION polypeptides), one or more nucleic acids encoding a MINION polypeptide (e.g., a human MINION polypeptide), one or more liposomes comprising a MINION polypeptide (e.g., a human MINION polypeptide), one or more cells comprising a MINION polypeptide (e.g., a human MINION polypeptide), one or more oncolytic viruses comprising a MINION polypeptide (e.g., a human MINION polypeptide), or one or more cancer vaccines comprising a MINION polypeptide (e.g., a human MINION polypeptide) described herein, and instructions for use. Instructions for use can include instructions for diagnosis or treatment of a disease. Kits as provided herein can be used in accordance with any of the methods described herein. Those skilled in the art will be aware of other suitable uses for kits provided herein, and will be able to employ the kits for such uses. Kits as provided herein can also include a mailer (e.g., a postage paid envelope or mailing pack) that can be used to return the sample for analysis, e.g., to a laboratory. The kit can include one or more containers for the sample, or the sample can be in a standard blood collection vial. The kit can also include one or more of an informed consent form, a test requisition form, and instructions on how to use the kit in a method described herein. Methods for using such kits are also included herein. One or more of the forms (e.g., the test requisition form) and the container holding the sample can be coded, for example, with a bar code for identifying the subject who provided the sample.
(294) One skilled in the art will recognize many methods and materials similar or equivalent to those described herein, which could be used in the practice of the present invention. Indeed, the present invention is in no way limited to the methods and materials described.
EXAMPLES
(295) The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
Example 1: Materials and Methods
(296) The following materials and methods are used in Examples 2-6.
(297) Animals
(298) All animal experiments were approved by the GNF IACUC, and carried out in accordance with approved guidelines. C57BL/6J mice were obtained through in-house breeding. Please see the “Generation of MINION-knockout mice by CRISPR/Cas9-mediated gene editing” section below for details regarding genetically engineered mice generated in-house.
(299) Cardiotoxin (CTX) Injury Model
(300) The cardiotoxin (CTX) injury model is a well-established model to study mouse skeletal muscle regeneration. CTX from Naja mossambica mossambica (Sigma C9759) was dissolved in normal saline (0.9% w/v of NaCl) to make a 10 μM working solution which was aliquoted and stored at −20° C. After anesthesia of the mouse with isoflurane (1.5%-2% in oxygen), the anterior aspect of the adult mouse hindlimb (8-10-week C57BL/6) was sterilized with 70% ethanol, shaved to expose the skin, and approximately 50 μL of CTX solution was injected into the midbelly of the tibialis anterior (TA) muscle using a 0.3 ml U100 BD insulin syringe. TA muscles were collected and examined at different time points after CTX. Adult mice at a similar age without CTX injection or with equal volume normal saline injection were used as controls.
(301) Mouse Skeletal Muscle RNA Sequencing
(302) Twelve 8-10-week C57BL/6 mice were injected with CTX into the TA muscle as described above, and their TA muscles were collected at 1, 3, 5, 7 days after CTX injection respectively with 3 mice for each time point. TA muscles from three 8-10-week uninjured mice were also collected. Total RNA from each muscle sample was isolated by TRIzol Reagent (Thermo Fisher 15596026) according to manufacturer's instructions and purified by Qiagen RNeasy columns. The RNA samples (3 replicates for each time point) were submitted to the in-house Sequencing and Expression Analysis Core for quality checking, library preparation, and next-generation single-read sequencing. One microgram of total RNA was used to make Illumina-compatible sequencing libraries, and the libraries were sequenced using 50 bp single reads on an Illumina HiSeq 1000. Reads were aligned to the mouse transcriptome (Refseq mouse transcripts as of March 2013) using BWA (H. Li, et al., Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics 25, 1754, 2009). An average of 36 million reads per sample mapped to the mouse transcriptome. To analyze the raw data, reads per kilobase of transcript per million mapped reads (RPKM) were calculated for each gene at each time point, the RPKM of each gene at CTX day 1, 3, 5, 7 was normalized to that of uninjured muscles, and the results were averaged to generate the fold change in expression level. The data were then analyzed in two ways: 1) genes that exhibited more than 100-fold increase in CTX day 3 muscles compared to uninjured muscles were selected; 2) genes predicted to contain an open reading frame (ORF) of less than 100 codons were selected. Genes meeting both criteria were then selected and further examined against in-house RNA-Seq data from undifferentiated and differentiated primary myoblasts and C2C12 immortalized myoblasts. sMINION was the only small ORF that was not only dynamically expressed and but also exhibited greater than 10-fold change between undifferentiated and differentiated myoblast samples.
(303) Generation of MINION-Knockout Mice by CRISPR/Cas9-Mediated Gene Editing
(304) Four week old female C57BL/6J mice were superovulated by intraperitoneal injection of 5 IU pregnant mare's serum gonadotropin (PMSG) followed 47 hours later by 5 IU of human chorionic gonadotropin (HCG). Female mice were mated 1:1 immediately after HCG injection to C57BL/6J male mice. The following morning, the females were checked for copulatory plugs and zygotes collected from the oviducts of plugged females. In vitro transcribed Cas9 mRNA (100 ng/μL) and two gRNAs (50 ng/μL) were coinjected into the pronuclei of fertilized zygotes. Zygotes surviving the injection procedure were transferred into a single oviduct, (50-60 embryos/oviduct) of pseudopregnant ICR recipient females. Mice produced from injected embryos were genotyped and sequenced (see Assay for genome modification below) to determine the presence of mutations within the genomic region of MINION. Mutant founder animals were then bred to C57BL/6J mice and offspring were analyzed for germline transmission.
(305) In order to generate in vitro transcribed Cas9 mRNA, a 10 bp spacer and the T7 promoter were added to the Streptococcus pyogenes Cas9 coding region by PCR amplification from a construct (pCR-Blunt II-TOPO-NLS-Cas9-NLS) made in house, and the amplified gel-purified Cas9 PCR product was used as the template for in vitro transcription using mMESSAGE mMACHINE T7 ULTRA kit (Life Technologies). In order to generate in vitro transcribed gRNA, two oligonucleotides were first synthesized (IDT):
(306) TABLE-US-00003 Oligonucleotide 1: (SEQ ID NO: 67 and 95, respectively) 5′ TTAATACGACTCACTATAG-(gRNA protospacer)-GTTTTAGA GCTAGAAATAGCAAGTTAAAATAAGGCTAGTCG; Oligonucleotide 2: (SEQ ID NO: 68) 5′ AAAAAGCACCGACTCGGTGCCACTTTTTCAAGTTGATAACGGACTAG CCTTATTTTAACTT.
(307) After oligonucleotide annealing followed by PCR amplification, the T7 promoter with an additional “G” at the 5′ end (see oligonucleotide 1) was added to the gRNA. The amplified gel-purified gRNA PCR product was used as the template for in vitro transcription using a MEGAshortscript T7 kit (Life Technologies). Both the Cas9 mRNA and the gRNAs were purified using a MEGAclear kit (Life Technologies) and eluted into RNase-free water. The gRNA protospacer sequences targeting the mouse MINION ORF region were as follows: sgRNA 1: 5′ GGACCGGGCCGTCGTGGAGG (SEQ ID NO: 69); sgRNA 2: 5′ CCAGAGTGGACCACTCCCAG (SEQ ID NO: 70) for generation of the 135 bp deletion allele; sgRNA3: 5′ GGCGGGCAACAGGCAGCAGC (SEQ ID NO: 104); and sgRNA4: 5′ CTGGGAGTGGTCCACTCTGG (SEQ ID NO: 105) for generation of the 155 bp deletion allele.
(308) Assay for Genome Modification and Genotyping
(309) To detect mutations in the mice arising from injected embryos, PCR was performed using primers flanking the targeted region: Seq-F: 5′ GAGTGAACTCCTTAACCAGCTTTC (SEQ ID NO: 71); Seq-R: 5′ GCGTTGCTGTTTCCAGGACCCGTG (SEQ ID NO: 72). The PCR products were used in a surveyor assay according to manufacturer's instructions. The PCR products were then analyzed by agarose gel electrophoresis and selected products were cloned into a pCR-blunt-cloning vector and sequenced. Mice containing mutations in the target region were bred to confirm germline transmission. Among the mouse strains with mutations, one with a 135 bp in-frame deletion within the MINION ORF was selected for further analysis.
(310) For genotyping of the subsequent progeny with the 135 bp deletion, a primer set flanking the targeted region: F0: 5′-CAAAGGGAGGGAGGGATTAAAG-3′ (SEQ ID NO: 73); R0: 5′-CAGAGAGGAAG GGTCAATCAAC-3′ (SEQ ID NO: 74) was used to amplify genomic DNA, generating a ˜760 bp product from the unmodified allele and a ˜625 bp product from the mutated allele respectively. For genotyping of the progeny carrying the 155 bp deletion allele, a different primer set was used to amplify genomic DNA: Fwd-2: 5′ AACACAATCTGTAGCCTGCTAGGAG (SEQ ID NO: 106); and Rev-2: 5′ TATAAGCTGAAGGGAGGACTCCAC (SEQ ID NO: 107), generating a ˜555 bp product from the unmodified allele and a ˜400 bp product from the mutant allele, respectively. The PCR products were separated by gel electrophoresis using 2% agarose (Sigma A9539). Wild-type mice demonstrate a single band of the larger size, while homozygotes containing the deletion demonstrate a single band of the smaller size, and heterozygous mice demonstrate both bands.
(311) Myoblast Isolation
(312) For mouse embryonic myoblast isolation, pregnant C57BL/6J female mice were humanely euthanized, embryos from were rapidly but gently dissected and placed into dissection buffer containing Ham's F10 nutrient mix (Gibco 11550043) with 1× antibiotic-antimycotic (Gibco 15240062). For each embryo, the tail was kept in a numbered tube for genotyping, while all four limbs were skinned, dissected, and placed into a 2 ml numbered Eppendorf tube containing ˜1.5 ml dissection buffer including 4 mg/ml Collagenase type II (Worthington LS004176; freshly made and filtered before use). The samples were rotated on a platform rocker at 80 rpm and 37° C. for 30-45 min, until the muscles were mostly digested and only bones and soft tissues were left. In general, earlier stage embryos required shorter incubation times. Cell suspensions were checked microscopically after each step to avoid over-digestion. After allowing the unwanted tissues to settle at room temperature, the supernatant was transferred to a 50 ml conical tube. Then Dispase II (Gibco 17105041) was added at a final concentration of >=1.2 mg/ml (>0.6 U/ml) to both tubes: (1) For the supernatant in the 50 ml tubes, cells were incubated at 37° C. for 20-30 min with occasional mixing; (2) For the remaining tissues in the 2 ml tubes, 1.5 ml freshly made and filtered dissection buffer with 4 mg/ml Collagenase type II and >=1.2 mg/ml Dispase II, and the tubes were rotated again on the rocker at 80 rpm and 37° C. for 20-30 min to allow further digestion and dissociation.
(313) After dissociation, the suspension in the 2 ml tube was mixed with that in the 50 ml tube. Then after adding ˜4-5 times wash medium (Ham's F10 and 10% horse serum, filtered), the digested mixture was passed through a 10 ml 20 gauge needle slowly and gently approximately 4 times, while scrupulously avoiding bubbles. More wash medium was then added to bring the final volume to 30 ml. This suspension was filtered through a prewashed 40 μm Nylon Mesh filter on top of a new 50 ml conical tube, and the filter was rinsed with 10 ml wash medium into the same tube. All of the 50 ml tubes were then centrifuged at 125 g for 5 min at room temperature, and the supernatant was transferred and spun down again at 125 g for 5 min. The pellets from two centrifugations were resuspended and mixed in 2 ml myoblast isolation medium followed by and additional 20 ml of media containing a 1:1 mixture of DMEM low glucose (Gibco 11885084) and Ham's F-10 Nutrient Mix (Gibco 11550043); 20% (v/v) FBS; 1× antibiotic-antimycotic; and freshly added 2.5 ng/ml rhFGF (Promega G5071). Medium lacking DMEM but containing the remaining items above also produced similar results.
(314) The isolated cell mixture from each embryo was first plated into a regular 150 mm TC-treated dish for 30 min at 37° C. (preplate I) and replated into another 150 mm dish for 30 min at 37° C. (preplate II) in order to eliminate fibroblasts, and then the supernatant containing mostly myoblasts was transferred into two 100 mm collagen-coated dishes. Cells were examined the next day to determine necessity for passaging. Occasionally the preplate II dish also contained a some amount of myoblasts, and these were kept and expanded in addition to those in the collagen dishes. 0.05% trypsin was used for dissociating the cells from dishes. After a few passages, 1× antibiotic-antimycotic was replaced by 1× penicillin-streptomycin (Gibco®). As the fibroblast number decreases in culture, the embryonic myoblasts may start to proliferate very slowly and they should be seeded more densely to recover from the slow growth.
(315) Adult mouse myoblasts were isolated similarly but with a few modifications: the muscles were removed from bones and minced with small scissors; 15 ml conical tubes were used instead of 2 ml tubes, with twice the volume of digestion buffer; and longer digestion and dissociation times were used.
(316) In Vitro Myoblast Differentiation Assay
(317) For primary myoblasts derived from both embryos and adult mice, around 3000 cells in 50 μl myoblast growth medium (1:1 mixture of DMEM low glucose and Ham's F-10 Nutrient Mix; 20% (v/v) FBS; freshly added 2.5 ng/ml rhFGF) were seeded into each well of a 384-well Collagen-coated PerkinElmer CellCarrier™ plate (6007550) for imaging purposes. The next day, differentiation medium (DMEM high glucose (Gibco® 11995073) with 3% to 5% horse serum) was added to the cells (DM day 0). Differentiation medium was replaced daily. The cells were fixed at DM day 3 and day 4 for immunofluorescence staining. For C2C12 cells, ˜1500-2000 cells were seeded into each well of a 384-well plate (DMEM high glucose with 10% FBS) and around 2×10.sup.5 cells were seeded into each well of a 6-well plate, using C2C12 growth medium (DMEM high glucose with 10% FBS). On the next day, differentiation medium (DMEM high glucose with 2% horse serum) was added to the cells (DM day 0), and differentiation medium was likewise replaced daily. The cells were collected or fixed at different time points as described.
(318) Histology
(319) For paraffin sections with embryonic samples, mouse embryos (E14.5 and later) were decapitated and the tails were collected in numbered tubes for genotyping. To enhance fixation in later-stage embryos (E17.5 and later), embryos were skinned in the area to be studied. Embryos were fixed overnight using 4% paraformaldehyde (PFA; Electron Microscopy Sciences #15714) in PBS at 4° C. with gentle rotation. Following two quick rinses with PBS, embryos were placed into 70% ethanol for dehydration and long-term storage. For the tissues/organs to be studied, the appropriate portions were cut and submitted for paraffin embedding and sectioning using routine protocols.
(320) For cryosections of adult mouse tissue, skeletal muscle samples were dissected and partially embedded in gum tragacanth (Sigma G1128; 10% w/v in PBS) on a wooden dowel, and frozen in 2-methylbutane in a glass beaker cooled in liquid nitrogen. The fresh frozen muscle samples were then sectioned at 10 μm thickness using a cryostat cooled to −20° C. These fresh frozen muscle sections were then fixed in 1% PFA diluted in PBS at room temperature for 5 min before subsequent staining procedures. Both cryosections and paraffin sections were stained with Hematoxylin and Eosin (H&E) following routine protocols.
(321) Immunofluorescence Staining on Tissue Sections
(322) For muscle cryosections, after fixation with 1% PFA/PBS as described above, slides were washed with PBS and permeabilized with 0.2% Triton X-100 diluted in PBS at room temperature for 10 min, and were then washed again with PBS. Sections were blocked at room temperature for 1 hour using a freshly-prepared and filtered solution containing 1% heat-inactivated donkey serum, 1% BSA, 0.025% Tween20 in PBS. After blocking, sections were incubated with primary antibody at 4° C. overnight, washed with PBS, and then incubated with secondary antibody for 2 hours at room temperature. After a 5 min wash with PBS, the sections were incubated with the nuclear stain DAPI (Molecular Probes D1306; 5 mg/ml stock) at a 1:20,000 dilution in PBS for 5 min, and slides were mounted and sealed using ImmuMount (Shandon) and glass coverslips. For paraffin sections with embryonic tissues, the deparaffinized and rehydrated slides were permeabilized with 0.2% Triton X-100 in PBS for 10 min and washed again with PBS. The sections were then blocked at room temperature for 1 hour using a freshly-made and filtered solution containing 5% heat inactivated normal goat serum in PBS. After blocking, similar procedures were performed as mentioned above for cryosections.
(323) Primary antibodies used for immunofluorescence were: Mouse anti-MHC (MY32 clone, Sigma M4276, 1:300 dilution on paraffin sections and 1:500 dilution on cryosections); Mouse anti-Desmin (D33 clone, DAKO M0760, 1:300 dilution); Sheep anti-MINION (R&D systems AF4580; 1:200 dilution). All secondary antibodies (Invitrogen Alexa-Fluor) were used at 1:250 dilution, and the host species was either donkey or goat. Only secondary antibodies from the same host species were used together for co-staining.
(324) Immunofluorescence Staining with Adherent Cells
(325) For immunofluorescence staining of actin filaments in fibroblasts and myoblasts, the high-affinity F-actin probe Alexa Fluor 546-conjugated phalloidin (Invitrogen, A22283) was used according to manufacturer's instructions. Briefly, 384-well PerkinElmer CellCarrier plates were again used. Cells were fixed with 4% PFA in PBS for 8-10 min and quickly washed twice with PBS before permeabilization with 0.2% Triton X-100 in PBS for 10 min. After one wash with PBS, cells were blocked with freshly made and filtered 5% heat inactivated normal goat serum in PBS for 1 hour, and were incubated with primary antibodies overnight at 4° C. The next day, after two quick washes with PBS, cells were incubated with secondary antibodies for 1-2 hours at room temperature. After three quick washes with PBS, the cells were incubated with DAPI (5 mg/ml stock, 1:20,000 dilution in PBS) for 10 min. The 384-well plate was then imaged using either UltraVIEW confocal or ImageXpress Micro (IXM; Molecular Devices) confocal imaging systems (see the Microscopy part below).
(326) Primary antibodies used were: Mouse anti-MHC (MY32 clone, Sigma M4276, 1:400 dilution); Mouse anti-Desmin (D33 clone, DAKO M0760, 1:300 dilution). All secondary antibodies (Invitrogen Alexa-Fluor) were used at 1:250 dilutions, and the host species was either donkey or goat. Only secondary antibodies from the same host species were used together for co-staining.
(327) Microscopy and Imaging
(328) The Invitrogen EVOS FL Auto Imaging System was used for routine examination of immunofluorescence staining, GFP virus infection, and cell labeling. For imaging of the H&E and immunostained tissue sections on glass slides, the Hamamatsu NanoZoomer and Aperio VERSA scanners were used to obtain whole-slide images using a 20× objective. For imaging of the immunofuorescence cell samples in 384-well plates, the IXM confocal high-content imaging system was used with 10× and 20× objectives. In order to acquire higher resolution images for tissue sections and cell samples, the UltraVIEW VoX 3D live cell imaging system (PerkinElmer) spinning disk confocal microscope system was used with 40× and 60× objectives. All pictures of whole mouse embryos were taken using iPhone 5S in combination with Leica KL200 LED dissection microscope.
(329) Cell Culture
(330) For culture of primary myoblasts isolated from later-stage mouse embryos and adult mice, filtered myoblast growth medium (1:1 mixture of DMEM low glucose and Ham's F-10 Nutrient Mix; 20% FBS) with freshly added 2.5 ng/ml rhFGF was used. In general, around 2-4×10.sup.5 cells were seeded into a 100 mm collagen-coated dish, and the cells were split once every 2 to 3 days at a ratio of 1:2 to 1:4, depending on proliferation speed. 0.05% trypsin was used for dissociating cells from dishes. Myoblasts typically went through a crisis period after the removal of most fibroblasts, and could be seeded more densely at this point. Primary myoblasts in culture were monitored every day with fresh medium replacement as needed. For the culture of immortalized C2C12 myoblast cells (ATCC), filtered C2C12 growth medium (DMEM high glucose with 10% FBS) was used. Approximately 1-1.5×10.sup.5 cells were seeded into a 100 mm tissue culture-treated dish, and cells were split every 2 days. 0.25% trypsin was used for cell dissociation. For the culture of the immortalized 10T1/2 fibroblast line, filtered fibroblast growth medium (DMEM high glucose with 15% FBS) was used. Approximately 1×10.sup.5 cells were seeded into a 100 mm tissue culture-treated dish, and the cells were split once every 3 days. 0.25% trypsin was used for cell dissociation. For the culture of immortalized RAW264.7 macrophage line, filtered growth medium containing DMEM high glucose with 10% FBS was used. Around 2-3×10.sup.6 cells were seeded into a 175 cm.sup.2 flask. The cells were split once every 2 to 3 days, when they were ˜60-75% confluent. To ensure cell lifting and reduce cell death, 0.25% trypsin and a cell scraper were used in combination. To induce the formation of multinuclear osteoclast-like cells, 50 ng/ml sRANKL (Peprotech, 174aa) was incubated with the cells for 3 days. For the culture of CJ7 embryonic stem cells from 129 mice, freshly made and filtered growth medium was used, consisting of ESGRO Complete PLUS medium (Millipore SF001-500P) with 15% FBS and 3 inhibitors: GSK3β inhibitor which comes with the medium; MEK inhibitor PD184352 (0.8 μM final); and FGFR inhibitor PD173074 (0.1 μM final). Normally the cells were co-cultured with mouse embryonic fibroblasts according to standard procedures, but for the purpose of RNA and protein isolation were seeded into gelatin-coated dishes without the fibroblast feeder layer. Approximately 1×10.sup.6 cells were seeded into each 100 mm dish. The medium was replaced every day. Cells were split once every two days at a ratio of 1:5 to 1:10, depending on experimental need. 0.05% trypsin was used for cell dissociation. All cell culture media contained 100 units/ml of penicillin and 100 μg/ml of streptomycin, unless otherwise specified.
(331) Tissue and Cell Lysates Preparation for Protein Analysis
(332) Both embryonic and adult mouse tissue samples were weighed, snap-frozen in liquid nitrogen, and stored at −80° C. until use. For preparation of protein lysates, eight volumes of ice-cold lysis buffer (50 mM Tris-HCl pH7.5, 150 mM NaCl, 1 mM EDTA, 10% glycerol, with freshly added 2× Halt protease inhibitor cocktail and 1× Roche PhosSTOP phosphatase inhibitor cocktail) and 1-2 3 mm tungsten carbide beads (Qiagen) were added to each sample in a 1.5 ml or 2 ml Eppendorf tube. These were then homogenized at 30 cycles/s for 3-8 min at 4° C. using a TissueLyser II. Detergents were then added to the lysates to a final concentration of 0.1% SDS, 0.1% sodium deoxycholate and 1% Triton X 100, and the samples were rotated at 4° C. for 2-4 hours. Lysates were then transferred to new tubes and spun down at 15000-21000 g for 10 min at 4° C. For organs containing significant amount of lipids, the supernatant was transferred and spun down again at 15000-21000 g for 10 min at 4° C.
(333) For cell samples, buffer from Alfa Aesar (J60423) was generally used (50 mM Tris-HCl pH7.5, 150 mM NaCl, 5% Glycerol, 0.1% SDS, 0.5% sodium deoxycholate and 1% Triton X 100, with the above mentioned protease and phosphatase inhibitor cocktails). Cells were quickly rinsed with DPBS and then ˜300 μL ice-cold lysis buffer was added to each well of a 6-well plate. After incubation on ice for 5 min, the cells were pipetted up and down and transferred to 1.5 ml Eppendorf tubes and incubated on ice for 30 min, with 1-second of vortexing every 10 min. The samples were then spun down at 15000-21000 g for 10 min at 4° C. A second buffer without ionic detergents was used for some of experiments (50 mM Tris-HCl pH7.5, 150 mM NaCl, 10% Glycerol, 1 mM EDTA, and 1% Triton X 100, with the above mentioned protease and phosphatase inhibitor cocktails), with similar results. Bio-Rad DC protein assay with BSA standard was performed to measure protein concentration of supernatants. Lysates were mixed with NuPAGE LDS Sample Buffer (NP0007) and dithiothreitol (100 mM final), and boiled at 94 degree for 10 min prior to SDS-PAGE.
(334) Subcellular Fractionation Analysis
(335) C2C12 cells incubated with differentiation medium for 3 days were used for the subcellular fractionation studies using the Qproteome Cell Compartment system (Qiagen, 37502) following the manufacturer's instructions. The cells were dissociated from the dishes first before adding the first buffer in the kit. The cytosolic/membrane/nuclear/cytoskeletal fractions were extracted from the cells, and around 10 μg protein lysates from each fraction was loaded for Western blot.
(336) SDS-PAGE and Western Blots
(337) Approximately 10-30 μg cell lysates and 40-60 μg tissue lysates were loaded per well. The NuPAGE Novex gel electrophoresis system was used for the separation of proteins. NuPAGE MES SDS Running Buffer (NP0002) and 4-12% NuPAGE Novex Bis-Tris gels were used. Proteins were transferred to PVDF or nitrocellulose membranes using the iBlot transfer system (Thermo Fisher). Freshly prepared 5% milk in TBST (137 mM NaCl, 20 mM Tris, 0.10% Tween-20, pH7.6) was generally used as the blocking buffer with both PVDF and nitrocellulose membranes. However, for the detection of MINION using primary antibody raised in sheep, freshly made and filtered 10% donkey serum in TBST was used as the blocking buffer with PVDF membrane (Millipore Immobilon-P.sup.SQ, 0.2 μm pore size). The information of primary and secondary antibodies used in western blots is listed in the table below (Table 3). Two ECL substrates with different sensitivity were used as indicated. We found that the anti-human TMEM8C antibody recognized both endogenous and overexpressed Myomaker protein in both mouse primary muscle and cultured cell lysates (
(338) TABLE-US-00004 TABLE 3 Antibody and ECL substrate information for Western blots Primary HRP Secondary antibody conjugated antibody ECL Primary incubation secondary incubation substrate antibody Dilution conditions antibody Dilution conditions used most Sheep anti- 1:1000 4° C. Donkey 1:5000 Room Luminata MINION (R&D (1 ug/ml) overnight anti-sheep temperature Forte (EMD AF4580) (Thermo (RT) for 1-2 Millipore Fisher hours WBLUF0100; A16047) increased sensitivity). Diluted with equal volume of water. Mouse anti- 1:20,000 RT 30 min- Goat anti- 1:20,000 RT 1 hour SuperSignal GAPDH (EMD 1 hour mouse West Pico Millipore (Thermo (Thermo MAB374) Fisher Fisher 34080). A16078) Diluted with equal volume of water. Mouse anti- 1:20,000 RT 1-2 Same as 1:20,000 RT 1-2 SuperSignal alpha-Tubulin hours above hours West Pico; (Sigma T9026) Diluted with equal volume of water. Mouse anti- 1:1000 4° C. Same as 1:5000 RT 1-2 Luminata MHC MY32 overnight above hours Forte; Diluted (Sigma M4276) with equal volume of water. Mouse anti- 1:200 4° C. Same as 1:5000 RT 1-2 Luminata Myogenin overnight above hours Forte (DSHB F5Dc) Mouse anti-Pax7 1:100 4° C. Same as 1:5000 RT 1-2 Luminata (sc-81648) overnight above hours Forte Mouse anti- 1:200 4° C. Same as 1:5000 RT 1-2 Luminata Desmin clone overnight above hours Forte D33 (DAKO M0760) Rabbit anti- 1:5000 4° C. Goat anti- 1:2000 RT 1-2 Luminata MyoD1 (Novus overnight rabbit (Cell hours Forte Biologicals Signaling NBP1-54153) #7074) Rabbit anti-N- 1:1000 4° C. Same as 1:2000 RT 1-2 Luminata Cadherin(Cell overnight above hours Forte signaling #4061) Rabbit anti- 1:1000 4° C. Same as 1:2000 RT 1-2 SuperSignal Calnexin (Novus overnight above hours West Pico Biologicals NB100-1965SS) Rabbit anti-H2B 1:1000 4° C. Same as 1:2000 RT 1-2 Luminata (Cell signaling overnight above hours Forte #8135) Rabbit anti- 1:10,000 4° C. Same as 1:2000 RT 1-2 SuperSignal Vimentin overnight above hours West Pico [EPR3776] (Abcam ab92547) Rabbit anti- 1:200 4° C. at Same as 1:500- 4° C. Luminata Human least two above 1:800 overnight Forte TMEM8C days plus RT 3 (Myomaker) hours; or (Abcam 4° C. two ab188300) days HRP conjugated 1:10,000 4° C. — — — SuperSignal mouse anti- overnight West Pico; FLAG M2 Diluted with (Sigma A8592) equal volume of water.
RNA Preparation and RT-qPCR
(339) Total RNA was isolated from different cell line samples using TRIzol Reagent (Thermo Fisher 15596026) according to manufacturer's instructions. First-strand cDNA synthesis was performed using qScript cDNA SuperMix (Quanta BioSciences) according to manufacturer's instructions. For PCR, cDNA from ˜5 ng RNA was used in a 12.5 μl reaction with Power SYBR Green PCR Master Mix (Thermo Fisher 4367659). Reactions with RNA only were prepared as negative controls. An Applied Biosystems 7900HT thermocycler was used with the following primers: MINION (5′-GGACCACTCCCAGAGGAAGGA-3′ (SEQ ID NO: 75) and 5′-GGACCGACGCCTGGACTAAC-3′ (SEQ ID NO: 76) and GAPDH (5′-AGGTCGGTGTGAACGGATTTG-3′ (SEQ ID NO: 77) and 5′-TGTAGACCATGTAGTTGAGGT-3′ (SEQ ID NO: 78). Relative quantification was performed using the comparative CT method. The CT value of MINION gene was normalized to that of the reference gene GAPDH in the same sample using the formula: 2.sup.ΔΔCT.
(340) Lung Flotation Assay
(341) Lung flotation assay was adapted from previously described methods (Z. Jakus et al., Lymphatic function is required prenatally for lung inflation at birth. The Journal of experimental medicine 211, 815, 2014; and M. Borensztein et al., Myod and H19-Igf2 locus interactions are required for diaphragm formation in the mouse. Development 140, 1231, 2013). E18.5 embryos from MINION.sup.Δ/+×MINION.sup.Δ/+ crosses were quickly isolated by cesarean section from humanely sacrificed pregnant females, and were placed on dry Kimwipes. To maintain body temperature, these newborns were incubated by hand and subsequently in a 37° C. chamber. Pups were exposed to normal room air following delivery, and were monitored for at least 1 hour. MINION.sup.Δ/Δ newborns were uniformly atonic, apneic, and became cyanotic almost immediately after delivery. The majority of MINION.sup.+/+ and MINION.sup.Δ/+ mice exhibited normal breathing and demonstrated pink body color indicative of adequate perfusion. After at least 1 hour of air breathing, pups were anesthetized, weighed, tailed for genotyping, decapitated, and the lungs were dissected and placed into PBS in 15 ml conical tubes or 2 ml Eppendorf tubes for flotation assay. The lungs were then monitored for more than 15 min, after which they were scored as either floating or sinking. Approximately 50 E18.5 preterm newborns were examined.
(342) Plasmids and Cloning
(343) For the cloning of shRNA constructs, 19-21 nucleotide target sequences were selected using both BLOCK-iT RNAi Designer (Thermo Fisher) and in-house optimized algorithms. For the mouse MINION gene, four shRNA target sequences were chosen initially, two targeting the coding sequence and two targeting the 3′ UTR. A control sequence was used targeting the firefly (Photinus pyralis) luciferase gene, which exists in the pGL3 luciferase reporter vector but which lacks similar sequence in the mouse transcriptome. For each shRNA, two 55-59 nt oligonucleotides were designed as shown below and synthesized (IDT). The oligonucleotides, each containing sense and antisense target sequences, a 9 nt intervening hairpin loop, and TTTG at the 5′ends with GATC at 3′ ends for cohesive-end cloning, were annealed. These were then ligated with BbsI/SpeI-digested pGWL-si2/U6 vector. Subsequently using Gateway LR Clonase II Enzyme Mix, these shRNA cassettes were cloned into the vector pLentiLox3.7-GW (pLL3.7-GW), a 3rd generation lentiviral gateway vector that expresses shRNAs under the mouse U6 promoter. A CMV-EGFP reporter cassette was included in the vector to monitor expression.
(344) TABLE-US-00005 TABLE 4 shRNA target sequence and oligonucleotide design information shRNA Oligonucleotide construct names (S: Sense; name Target sequence A: Antisense) Oligonucleotide sequence mMINION- GCTAAGAGGTGGTAT 3′UTR TTTGCTAAGAGGTGGTATTTAATTCAAGAGATT U1 TTAA shRNA_1S AAATACCACCTCTTAGCTTTTT (SEQ ID NO: 79) (SEQ ID NO: 84) 3′UTR CTAGAAAAAGCTAAGAGGTGGTATTTAATCTCT shRNA_1A TGAATTAAATACCACCTCTTAG (SEQ ID NO: 85) mMINION- GCAGCAGGTAGTCAA 3′UTR TTTGCAGCAGGTAGTCAATAAACGTTCAAGAGA U2 TAAACG shRNA_2S CGTTTATTGACTACCTGCTGCTTTTT (SEQ ID NO: 80) (SEQ ID NO: 86) 3′UTR CTAGAAAAAGCAGCAGGTAGTCAATAAACGTCT shRNA_2A CTTGAACGTTTATTGACTACCTGCTG (SEQ ID NO: 87) mMINION- GCTGTCTGCTCTTTG CDS shRNA_1S TTTGCTGTCTGCTCTTTGTCCTTTCAAGAGAAG C1 TCCT GACAAAGAGCAGACAGCTTTTT (SEQ ID NO: 81) (SEQ ID NO: 88) CDS shRNA_1A CTAGAAAAAGCTGTCTGCTCTTTGTCCTTCTCT TGAAAGGACAAAGAGCAGACAG (SEQ ID NO: 89) mMINION- GTGGACCACTCCCAG CDS shRNA_2S TTTGTGGACCACTCCCAGAGGATTCAAGAGATC C2 AGGA CTCTGGGAGTGGTCCACTTTTT (SEQ ID NO: 82) (SEQ ID NO: 90) CDS shRNA_2A CTAGAAAAAGTGGACCACTCCCAGAGGATCTCT TGAATCCTCTGGGAGTGGTCCA (SEQ ID NO: 91) Control GACGAACACTTCTTC Ctrl shGL3_S TTTGACGAACACTTCTTCATCGTTCAAGAGACG (Ctrl) ATCG ATGAAGAAGTGTTCGTCTTTTT (SEQ ID NO: 83) (SEQ ID NO: 92) Ctrl shGL3_A TAGAAAAAGACGAACACTTCTTCATCGTCTCTT GAACGATGAAGAAGTGTTCGT (SEQ ID NO: 93)
(345) For the cloning of cDNA constructs, the coding sequences (CDS) of mouse MINION (for the 84 aa isoform), human MINION ortholog, mouse tmem8c (myomaker), nanoluc (control A), luciferase (control B), mouse MINION with 1 bp insertion, human MINION with 1 bp deletion, and mouse MINION truncation (39 aa form) were synthesized (IDT) with attB sites at both ends and a consensus Kozak sequence (5′ GCCACC (SEQ ID NO: 94)) before the start codon. For mouse and human MINION CDS, both untagged and C-terminally 3×FLAG-1×HA-tagged (3F1H) versions were generated. For the nanoluc CDS, a C-terminal 1×FLAG tag was added. Using Gateway BP Clonase II Enzyme mix (Thermo Fisher 11789020), the synthesized DNA sequences were cloned into the pDONR221 vector and the sequence-confirmed entry vectors were subsequently cloned into the pCIGAR gateway retroviral vector using Gateway LR Clonase II Enzyme mix. The pCIGAR vector is an MSCV-based bicistronic retroviral vector modified to permit Gateway-mediated insertional recombination of transgenes immediately upstream of IRES-eGFP. In addition, the empty pCIGAR vector (MCS version) was used as another control vector (control C). After expression testing of the two 3F1H-tagged mouse and human MINION constructs, it was noticed that two bands were detected by Western blot with anti-FLAG antibody (
(346) Lentiviral shRNA Knockdown Assay in Primary and Transformed Myoblasts
(347) Lentiviral particles were produced in HEK 293T cells using a 3.sup.rd generation lentiviral packaging system and FuGENE 6 transfection reagent (Promega). Fresh medium was replaced one day after transfection and the supernatant medium was collected on the following day. The medium was briefly centrifuged to remove dead cells, and neat virus was used for QC infection by reverse infection method on 293T cells with 8 μg/ml polybrene (overnight incubation without spin infection). Analysis of GFP expression by FACS 3 days after infection generally demonstrated a titer of approximately 1×10.sup.6 vp/mL. Neat virus was further concentrated ˜100 fold using a 100 kDa centrifugal filter unit (Amicon), aliquoted, and stored at −80° C.
(348) To examine the knockdown efficiency of the mouse MINION transcript, shRNA-encoding lentiviruses were used to infect C2C12 cells. Viruses were diluted in growth medium containing 8 μg/ml polybrene, and after a brief incubation at 37° C. with C2C12 cells, one round of spin infection was performed at 1100 g for 1-1.5 hours and 32° C., using either 24-well or 12-well plates. Based on an estimated viral titer of 1×10.sup.8 vp/ml (as measured on 293T cells), a virus amount equivalent to MOI30 on 293T cells was used on C2C12 cells. Fresh medium was replaced the next day and GFP.sup.+ cells were sorted by FACS two days later (see gating strategy in
(349) Similar infection steps were followed in order to knock down MINION in primary myoblasts derived from adult mice, except that 6 μg/ml polybrene was used and fresh medium lacking polybrene was added by the end of the day instead of on the next day, as primary myoblasts appeared more sensitive to polybrene treatment. Due to the difficulty in expanding these infected and sorted primary cells, one round of virus infection was performed using either Ctrl virus or 1:1 ratio mixture of U1 and U2 viruses, and the cells were sorted by GFP signal after 2-3 days. Around one-third or one-half the amount of virus used on C2C12 cells was used on primary myoblasts. The sorted primary myoblasts were recovered for 3 days and then seeded into 384-well plates for in vitro differentiation assay.
(350) Retrovirus Infection of C2C12 and 10T1/2 Cells
(351) The cDNA-encoding retroviruses were made by co-transfecting HEK 293 cells with pCIGAR retroviral vectors and pCL-Eco or pCL-10A1 packaging vectors using FuGENE 6 transfection reagent (Promega). Media was replaced one day after transfection and the supernatant medium was collected on the following day. After a brief centrifugation to eliminate dead cells, the neat virus was used for QC infection in 384-well plate by reverse infection method on NIH-3T3 cells (for pCL-Eco packaged virus) or 293T cells (for pCL-10A1 packaged virus) with 8 μg/ml polybrene (overnight incubation without spin infection). GFP expression was analyzed by FACS 3 days after infection, usually giving a titer of 0.3-1.2×10.sup.6 vp/nl.
(352) In order to infect C2C12 cells and 10T1/2 cells, neat virus was incubated with 8 μg/ml polybrene at 37° C. for 10 min and then added to the cells, which were then incubated for 15 min at 37° C. One round of spin infection was performed using 24-well or 12-well plates at 1100 g for 1-1.5 hours and 32° C. After 4-6 hours, fresh neat virus with polybrene was added and a second round of spin infection was performed. Fresh medium was added to the infected cells to dilute the polybrene. Media was replaced the following day, and 2-3 days later, the infected cells usually exhibited very strong GFP fluorescence by microscopy. Infection efficiency of this two-round infection method was generally >95% over a large range of viral concentrations, therefore FACS was not generally necessary. This strong GFP signal was used to mark the boundary of cells, in addition to phase contrast imaging and nuclear markers (
(353) For each round of infection, a viral amount equivalent to MOI 3-6 on 3T3 or 293T cells was used on MINION.sup.KD C2C12 cells, and the infected cells were expanded and used for in vitro reconstitution assay in differentiation medium. For co-expression and cell-mixing experiments on wild type 10T1/2 cells and C2C12 cells, a viral amount equivalent to MOI 2-4 on 3T3 or 293T cells was used. For each comparison, the viruses made with the same packaging plasmid and at similar MOI were used for infection. The experiments were repeated with different types of control viruses (Luciferase, NanoLuc-FLAG, empty vector). For co-expression and mixing experiments, cells were infected with one type of cDNA retrovirus first using the 2-round spin infection protocol described above, expanded for several days, then reinfected with a second cDNA-encoding retrovirus using the same method. On the day following the final infection, the cells were labeled with different dyes, mixed, and seeded into 384-well or 24-well plates as described below.
(354) Cell Labeling and Mixing Experiments
(355) The performance of a series of cell-permeant fluorescent dyes was tested on 10T1/2 fibroblasts and C2C12 myoblasts over multiple dilutions and using different labeling methods, with signal strength and pattern monitored continuously by microscopy for at least four days. CellTracker Deep Red dye (Thermo Fisher C34565, 1:250 final) and CellTrace Violet dye (Thermo Fisher C34571, 1:500 final) were selected for subsequent experiments, and were observed to label the cytoplasmic and nuclear regions of mononuclear cells. However, in fused multinuclear cells (
(356) Cell labeling was performed according to manufacturer's instructions with slight modifications. Cells were trypsinized, centrifuged, washed once with PBS, transferred to a 2 ml Eppendorf tube, centrifuged, and resuspended in PBS at a concentration of 0.8-1×10.sup.6 cells/ml. 2× cell labeling solution was prepared separately in PBS with fluorescent dyes (Deep Red dye at 1:125 and Violet dye at 1:250) and was mixed well by brief vortexing. Equal volumes of the 2× labeling solution and the cell suspension (usually 250 μL each) were mixed and incubated at 37° C. for 40-45 min with occasional mixing. The labeled cells were then mixed with 1 ml fresh medium, incubated at 37° C. for 5 min and centrifuged at 150 g. At this point, 3 more washes of the labeled cells was performed using fresh medium, incubation at 37° C. for 10-15 min, and centrifugation at 150×g. After the last wash, the cells were counted and diluted to the concentration needed for the final mixing experiment in a 384-well or 24-well plate, and were incubated at 37° C. for 30 min. These additional washes and incubation steps were used to eliminate remaining unbound dye in the cell suspension and on the cell surface, which was critical for cell mixing experiments performed on the same day. After incubation, cells labeled with Deep Red dye were mixed with those labeled with Violet dye at a 1:1 ratio, and were seeded into 384-well or 24-well plates, with a range of concentrations tested from 800-4000 cells per well. Cells in 384-well plates were fixed at different time points (24-48 hours) with 4% PFA for 10 min at room temperature, and were washed with PBS before imaging. Growth medium containing 10%-15% FBS was used for all experiments in both 10T1/2 and C2C12 cells.
(357) Differentiation and Fusion Indices
(358) Several indices were used to examine the fusion efficiency in C2C12 cells as well as adult and embryonic primary myoblasts during in vitro differentiation. The differentiation index shown in C2C12 (
(359) For co-expression experiments in 10T1/2 cells, two indices were used to examine fusion efficiency. The first fusion index (
Example 2: MINION is a Skeletal Muscle-Specific Microprotein Highly Expressed During Muscle Regeneration, Development, and Differentiation
(360) Muscle development requires requires temporally regulated stem cell activation and differentiation, fusion of progenitors to form syncytial myotubes, and maturation of myotubes to generate contractile myofibers. While the early and late stages of this process have been intensively studied (Comai, et al., Molecular and cellular regulation of skeletal myogenesis. Current Topics In Developmental Biology 110: 1, 2014; Buckingham, et al., Gene regulatory networks and transcriptional mechanisms that control myogenesis. Developmental Cell 28: 225, 2014), our understanding of the mechanisms and regulatory factors controlling cell fusion remains incomplete, particularly in mammals (Hindi, et al., Signaling mechanisms in mammalian myoblast fusion. Science signaling 6, re2, 2013; Hochreiter-Hufford et al., Phosphatidylserine receptor BAI1 and apoptotic cells as new promoters of myoblast fusion. Nature 497, 263, 2013). Recently, the transmembrane protein Tmem8c/Myomaker was identified and was shown to be necessary for myoblast fusion and sufficient for fusion of non-muscle cells to differentiating myoblasts (Millay et al., Myomaker is a membrane activator of myoblast fusion and muscle formation. Nature 499: 301, 2013). Importantly however, Myomaker expression was insufficient to drive fusion of a non-muscle cell to another non-muscle cell.
(361) In addition to canonically defined protein coding genes, recent studies have indicated that existence of a new class of regulatory factors in muscle. These small ORFs (smORFs) are transcribed and translated but are largely bioinformatically silent by virtue of their size, typically encoding microproteins <100 amino acids (aa) in length. Although estimates vary widely, the human and mouse genomes are thought to contain at least several thousand of these “hidden” genes (Saghatelian et al., Discovery and characterization of smORF-encoded bioactive polypeptides. Nature chemical biology 11, 909, 2015). Intriguingly, of the small number of mammalian microproteins reported to date, several have been identified in muscle, all of which encode regulatory factors for the sarco/endoplasmic reticulum Ca.sup.2+-ATPase (SERCA), with structural similarity to known SERCA-regulatory proteins such as sarcolipin and phospholamban (Nelson et al., A peptide encoded by a transcript annotated as long noncoding RNA enhances SERCA activity in muscle. Science 351, 271, 2016; Anderson et al., A micropeptide encoded by a putative long noncoding RNA regulates muscle performance. Cell 160, 595, 2015; Magny et al., Conserved regulation of cardiac calcium uptake by peptides encoded in small open reading frames. Science 341, 1116, 2013).
(362) Whole transcriptome RNA-seq analysis of uninjured and regenerating muscle was performed to identify novel microproteins that play an important role in skeletal muscle development and regeneration (Bentzinger, et al., Building muscle: molecular regulation of myogenesis. Cold Spring Harbor perspectives in biology 4, 2012). We searched for transcripts demonstrating strong temporal regulation (upregulation at day 3 following injury), annotated ORF length of less than 100 codons, and a similarly dynamic pattern of regulation during mouse myoblast differentiation in vitro (
(363) Western blot confirmed that MINION transcript is translated; MINION protein was absent in uninjured tibialis anterior (TA) muscle but strongly induced during regeneration, peaking on day 3-4 following injury (
(364) TBLASTN search revealed a putative human MINION homolog with an intact ORF of 84 codons (
(365) In summary, these data show MINION is a membrane associated microprotein specifically expressed in developing and regenerating skeletal muscle, at a time of rapid expansion and fusion of stem cell-derived myoblasts.
Example 3: The MINION Microprotein is Required for Skeletal Muscle Development
(366) The spatial and temporal expression pattern of MINION and the presence of functional MRF-binding E-boxes in MINION regulatory sequences suggested a role in skeletal muscle development. To test this, CRISPR/Cas9 genome editing was used to generate MINION-deficient mice (
(367) Late stage MINION.sup.Δ/Δ embryos were distinguishable by their decreased size and weight, reduced limb diameter, spinal curvature, and atony, as well as by characteristic dorsal and nuchal subcutaneous edema at earlier stages (
(368) Cumulatively, these data suggest that MINION.sup.Δ/Δ embryos die at perinatal stages due to sequela of skeletal muscle insufficiency.
Example 4: The MINION Microprotein is Required for Fusion of Muscle Progenitors
(369) The absence of multinucleated myofibers in MINION.sup.Δ/Δ muscle suggests that MINION may be specifically required for myoblast fusion. Indeed, induction of differentiation and fusion in primary embryonic myoblasts derived from MINION.sup.Δ/Δ or control muscle demonstrated near complete failure to form multinucleated myotubes (≥3 nuclei) specifically in MINION-deficient cells (
(370) Since the shRNAs used to target MINION transcript recognize the 3′ UTR, we tested the ability of various cDNAs to complement the MINION.sup.KD cell fusion defect (
(371) The above results demonstrate that MINION protein is required for cell fusion in developing muscle. Interestingly, this effect appears to be muscle-specific, as MINION expression was not detectable in other settings of physiologic cell fusion, such as the placenta or fusing macrophage lineage cells (
Example 5: Coexpression of MINION and Myomaker is Sufficient to Induce Cell Fusion in a Heterologous System
(372) To better understand the mechanism of MINION-associated cell fusion, and the functional relationship between MINION and Myomaker was investigated. Myomaker protein was readily detectable in regenerating muscle and differentiating mouse myoblasts (
(373) It was previously reported that Myomaker is sufficient to induce the fusion of fibroblasts to differentiating myoblasts (Anderson et al. Widespread control of calcium signaling by a family of SERCA-inhibiting micropeptides. Sci. Signal. 9, ra119, 2016), and we therefore examined whether Minion exhibited a similar phenotype when expressed in fibroblasts. C3H 10T1/2 fibroblasts were infected with retroviruses encoding GFP and either control, Myomaker or Minion; GFP-positive fibroblasts were then mixed with wild-type C2C12 myoblasts and kept in differentiation medium for 3-4 days. Differentiating myoblasts and myotubes were marked by MHC expression, and fusion of GFP-positive fibroblasts to myotubes was readily detected when Myomaker, but not Minion or control, was expressed (
(374) Previous studies have demonstrated that myomaker alone is incapable of inducing fusion between non-myogenic cells (Millay et al., Nature 499, 301, 2013). When expressed heterologously in 10T1/2 fibroblasts, neither Myomaker nor Minion alone (
(375) Therefore, MINION is required for Myomaker to mediate cell fusion with differentiating myoblasts, and that MINION and Myomaker together represent a minimal program for induction of fusion in both muscle cells as well as non-fusogenic lineages such as non-muscle cells, e.g., fibroblasts.
Example 6: Minion-Induced Fusion Requires Cytoskeletal Remodelling
(376) Mechanistically, the small size and lack of functional domains within microproteins has led to the suggestion that they function primarily via protein-protein interactions (Ma J. et al. Improved identification and analysis of small open reading frame encoded polypeptides. Anal. Chem. 88, 3967-3975, 2016). While the simplest model for Minion function is physical interaction with Myomaker, such a model would not explain the differences in loss of function phenotype (lack of alignment and presence of alignment, respectively). In fact, extensive attempts at co-immunoprecipitation using both tagged and untagged versions of Minion with endogenous and overexpressed Myomaker revealed no detectable physical interaction between the two proteins in differentiating muscle cells, as determined by western blot (data not shown). We therefore performed affinity purification followed by mass spectrometry (AP-MS) analysis using FLAG-tagged Minion expressed in differentiating myoblasts. Whereas Myomaker was again not recovered as a specific interacting protein, several classes of highly enriched interacting proteins were identified (
(377) TABLE-US-00006 TABLE 5 Proteins significantly enriched in complex with Minion following affinity purification-mass spectrometry. Fisher's Exact Test Number Sequence Accession Molecular (p-value) of Unique Coverage Description Number Weight *(p < 0.00414) Spectra Peptide (%) Embryonic stem Q2Q5T5 9.6 kDa <0.00010 33 3 50 cell-and germ cell- specific protein ESGP OS = Mus musculus GN = Gm7325 PE = 2 SV = 1 Dysferlin OS = Mus DYSF_MOUSE 238 kDa <0.00010 23 17 13 musculus GN = Dysf PE = 1 SV = 3 Aldehyde AL3B1_MOUSE 52 kDa <0.00010 58 15 46 dehydrogenase family 3 member B1 OS = Mus musculus GN = Aldh3b1 PE = 2 SV = 1 ATPase family ATAD1_MOUSE 41 kDa <0.00010 15 7 30 AAA domain- containing protein 1 OS = Mus musculus GN = Atad1 PE = 1 SV = 1 Signal recognition SRP68_MOUSE 71 kDa <0.00010 19 11 25 particle 68 kDa protein OS = Mus musculus GN = Srp68 PE = 2 SV = 2 Calsequestrin-2 CASQ2_MOUSE 48 kDa <0.00010 35 9 24 OS = Mus musculus GN = Casq2 PE = 2 SV = 3 Calcium uniporter MCU_MOUSE 40 kDa <0.00010 34 12 38 protein, mitochondrial OS = Mus musculus GN = Mcu PE = 2 SV = 2 Inositol 1,4,5- ITPR3_MOUSE 304 kDa 0.0027 14 11 6 trisphosphate receptor type 3 OS = Mus musculus GN = Itpr3 PE = 1 SV = 3 Synaptopodin 2-like SYP2L_MOUSE 103 kDa 0.0024 9 5 8 protein OS = Mus musculus GN = Synpo21 PE = 2 SV = 1 DnaJ homolog DJC16_MOUSE 89 kDa 0.00032 12 9 19 subfamily C member 16 OS = Mus musculus GN = Dnajc16 PE = 1 SV = 2 Syntaxin-8 STX8_MOUSE 27 kDa 0.00062 11 4 19 OS = Mus musculus GN = Stx8 PE = 1 SV = 1 NADH-ubiquinone NDUS1_MOUSE 80 kDa 0.00010 19 9 20 oxidoreductase 75 kDa subunit, mitochondrial OS = Mus musculus GN = Ndufs1 PE = 1 SV = 2 Adenylate kinase KAD4_MOUSE 25 kDa 0.00010 15 6 52 isoenzyme 4, mitochondrial OS = Mus musculus GN = Ak4 PE = 2 SV = 1 Sorbin and SH3 SRBS2_MOUSE 132 kDa 0.0024 9 6 7 domain-containing protein 2 OS = Mus musculus GN = Sorbs2 PE = 1 SV = 2 Vacuolar protein VPS45_MOUSE 65 kDa 0.0012 10 7 15 sorting-associated protein 45 OS = Mus musculus GN = Vps45 PE = 1 SV = 1 NADH NDUV1_MOUSE 51 kDa 0.0022 12 7 24 dehydrogenase lubiquinonel flavoprotein 1, mitochondrial OS = Mus musculus GN = Ndufv1 PE = 1 SV = 1 B-cell receptor- BAP31_MOUSE 28 kDa 0.00032 12 7 27 associated protein 31 OS = Mus musculus GN = Bcap31 PE = 1 SV = 3 NADH NDUAA_MOUSE 41 kDa 0.0040 12 7 24 dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS = Mus musculus GN = Ndufa10 PE = 1 SV = 1 Cluster of Guanine GNAS2_MOUSE 46 kDa 0.00012 22 9 34 nucleotide-binding [7] protein G(s) subunit alpha isoforms short OS = Mus musculus GN = Gnas PE = 1 SV = 1 (GNAS2_MOUSE) Acetolactate ILVBL_MOUSE 68 kDa 0.0011 22 10 32 synthase-like protein OS = Mus musculus GN = Ilvbl PE = 2 SV = 1 Cytoskeleton- CKAP5_MOUSE 226 kDa 0.0038 23 13 8 associated protein 5 OS = Mus musculus GN = Ckap5 PE = 2 SV = 1 Voltage-dependent VDAC1_MOUSE 32 kDa 0.00094 28 10 15 anion-selective channel protein 1 OS = Mus musculus GN = Vdac1 PE = 1 SV = 3 Apolipoprotein APOOL_MOUSE 29 kDa 0.0039 28 9 49 O-like OS = Mus musculus GN = Apool PE = 2 SV = 1 Junctional JSPR1_MOUSE 36 kDa 0.0023 31 8 53 sarcoplasmic reticulum protein 1 OS = Mus musculus GN = Jsrp1 PE = 1 SV = 2 Tripartite motif- TRI72_MOUSE 53 kDa 0.00048 40 16 55 containing protein 72 OS = Mus musculus GN = Trim72 PE = 1 SV = 1 Cytochrome b-c1 QCR1_MOUSE 53 kDa 0.0010 38 13 41 complex subunit 1, mitochondrial OS = Mus musculus GN = Uqcrc1 PE = 1 SV = 2 Eukaryotic IF4A2_MOUSE 46 kDa 0.0023 45 9 53 initiation factor 4A- II OS = Mus musculus GN = Eif4a2 PE = 2 SV = 2 T-complex protein 1 TCPQ_MOUSE 60 kDa <0.00010 57 22 48 subunit theta OS = Mus musculus GN = Cct8 PE = 1 SV = 3 Isovaleryl-CoA IVD_MOUSE 46 kDa 0.0012 50 16 49 dehydrogenase, mitochondrial OS = Mus musculus GN = Ivd PE = 1 SV = 1 T-complex protein 1 TCPB_MOUSE 57 kDa 0.00076 53 20 55 subunit beta OS = Mus musculus GN = Cct2 PE = 1 SV = 4 Nascent NACAM_MOUSE 220 kDa 0.0031 50 23 18 polypeptide- associated complex subunit alpha, muscle-specific form OS = Mus musculus GN = Naca PE = 1 SV = 2 Coproporphyrinoge HEM6_MOUSE 50 kDa 0.0014 57 19 52 n-III oxidase, mitochondrial OS = Mus musculus GN = Cpox PE = 1 SV = 2 T-complex protein 1 TCPA_MOUSE 60 kDa 0.0035 65 20 52 subunit alpha OS = Mus musculus GN = Tcp1 PE = 1 SV = 3 Very long-chain ACADV_MOUSE 71 kDa 0.0017 72 26 57 specific acyl-CoA dehydrogenase, mitochondrial OS = Mus musculus GN = Acadv1 PE = 1 SV = 3 Trifunctional ECHB_MOUSE 51 kDa <0.00010 93 22 68 enzyme subunit beta, mitochondrial OS = Mus musculus GN = Hadhb PE = 1 SV = 1 Trifunctional ECHA_MOUSE 83 kDa <0.00010 201 33 66 enzyme subunit alpha, mitochondrial OS = Mus musculus GN = Hadha PE = 1 SV = 1 ATP synthase ATPB_MOUSE 56 kDa <0.00010 231 26 77 subunit beta, mitochondrial OS = Mus musculus GN = Atp5b PE = 1 SV = 2 Cytoplasmic dynein DYHC1_MOUSE 532 kDa <0.00010 444 157 46 1 heavy chain 1 OS = Mus musculus GN = Dync1h1 PE = 1 SV = 2 Cluster of Myc box- BIN1_MOUSE [3] 64 kDa 0.003 75 16 42 dependent- interacting protein 1 OS = Mus musculus GN = Bin1 PE = 1 SV = 1 (BIN1_MOUSE)
(378) The data provided herein uncover an evolutionarily conserved pathway for cell fusion mediated by the microprotein MINION and the transmembrane protein Myomaker. Our studies revealed an unanticipated polarity within the fusion pair, in which both cells must express Myomaker but only one cell need express MINION in order to drive cell fusion. This suggests that vertebrate muscle formation has previously unrecognized similarities with invertebrates, in which fusion occurs between distinct populations of founder cells and fusion competent myoblasts (Chen, et al., Unveiling the mechanisms of cell-cell fusion. Science 308: 369, 2005). Based on this asymmetry, we propose a model for vertebrate muscle development, in which fusion involves the coordinated action of a transmembrane protein (Myomaker) which may induce apposition or adhesion of cell membranes, and a fusogenic protein, MINION, which may serve as the alpha-helical, hydrophobic fusion peptide to drive pore formation.
(379) Beyond the implications for muscle biology, the current description of a defined two-component system opens the door to programmable and potentially targeted cell fusion, which may find a variety of therapeutic and research applications, including oncolytic fusion of cancer cells (see Nakamura et al., Antibody-targeted cell fusion. Nature biotechnology 22, 331, 2004), fusion of dendritic cells to cancer cells in immunotherapy (see Avigan, et al., Dendritic/tumor fusion cells as cancer vaccines. Seminars in oncology 39: 287, 2012), uses in regenerative medicine (see Dittmar, et al., Cell fusion in health and disease. Volume II: cell fusion in disease. Introduction. Advances in experimental medicine and biology 714: 1, 2011), and for heterokaryon-based studies of nuclear reprogramming (see Blau et al., Plasticity of the differentiated state. Science 230: 758, 1985). Finally and importantly, our studies constitute the first report, to our knowledge, of an essential mammalian microprotein-MINION. As such, they represent the strongest evidence to date that this class of small, little studied, and mostly bioinformatically silent proteins has critical and unexplored functions in vertebrate biology.
(380) Unless defined otherwise, the technical and scientific terms used herein have the same meaning as that usually understood by a specialist familiar with the field to which the disclosure belongs.
(381) Unless indicated otherwise, all methods, steps, techniques and manipulations that are not specifically described in detail can be performed and have been performed in a manner known per se, as will be clear to the skilled person. Reference is for example again made to the standard handbooks and the general background art mentioned herein and to the further references cited therein. Unless indicated otherwise, each of the references cited herein is incorporated in its entirety by reference.
(382) Claims to the invention are non-limiting and are provided below.
(383) Although particular aspects and claims have been disclosed herein in detail, this has been done by way of example for purposes of illustration only, and is not intended to be limiting with respect to the scope of the appended claims, or the scope of subject matter of claims of any corresponding future application. In particular, it is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the disclosure without departing from the spirit and scope of the disclosure as defined by the claims. The choice of nucleic acid starting material, clone of interest, or library type is believed to be a matter of routine for a person of ordinary skill in the art with knowledge of the aspects described herein. Other aspects, advantages, and modifications considered to be within the scope of the following claims. Those skilled in the art will recognize or be able to ascertain, using no more than routine experimentation, many equivalents of the specific aspects of the invention described herein. Such equivalents are intended to be encompassed by the following claims. Redrafting of claim scope in later filed corresponding applications may be due to limitations by the patent laws of various countries and should not be interpreted as giving up subject matter of the claims.