MODIFIED MRNA FOR MULTICELL TRANSFORMATION
20230270860 · 2023-08-31
Inventors
- MICHAEL J. P. LAWMAN (TEMPLE TERRACE, FL, US)
- PATRICIA D. LAWMAN (TEMPLE TERRACE, FL, US)
- MARINA VICTOR ABDELMASEEH BASTAWROUS (PORT ORANGE, FL, US)
- MICHAEL J. SHAMBLOTT (ST. PETERSBURG, FL, US)
Cpc classification
A61K2039/545
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
Synthetic bacterial messenger RNA can be used to prepare autologous, allogenic or direct nucleic acid cancer vaccines. Cancer cells are transfected either in vitro or in vivo with mRNA obtained from DNA that encodes an immunogenic bacterial protein. An immune response to the cancer is generated from direct administration of the mRNA in vivo or administration of vaccines prepared from cancer cells in vitro. Codon modification of the mRNA can optimize expression of an immunogenic polypeptide in cancer cells.
Claims
1. A human codon optimized ribonucleic acid transcribed from a template nucleic acid selected from the group consisting of SEQ ID NO:17, SEQ ID NO:18 and SEQ ID NO:19 wherein the ribonucleic acid expresses an immunogenic polypeptide in transfected cells.
2. The human codon optimized ribonucleic acid of claim 1 wherein the expressed immunogenic polypeptide has the sequence of SEQ ID NO:2.
3. The human codon optimized ribonucleic acid of claim 1 wherein the transfected cells are cancer cells.
4. The cancer cells of claim 3 wherein the cancer cells are carcinoma, sarcoma, myeloma or leukemia cells.
5. The human codon optimized bacterial ribonucleic acid of claim 1 wherein the amount of polypeptide expressed in a transfected cell is increased compared to the amount expressed from the corresponding non codon optimized ribonucleic acid SEQ ID NO:1.
6. The group of template nucleic acids having sequences SEQ ID NO:17, SEQ ID NO:18 and SEQ ID NO:19 of claim 1 wherein each has a different number of codon adaptations for translation in human cells.
7. The human codon optimized ribonucleic acid of claim 1 which has the sequence of SEQ ID NO:17 and which has a codon adaptiveness index of 0.95 compared to an index of 1.0 for perfectly optimized translation in human cells.
8. The human codon optimized ribonucleic acid of claim 1 which has the sequence of SEQ ID NO:18 and which has a codon adaptiveness index of 0.82 compared to an index of 1.0 for perfectly optimized translation in human cells.
9. The human codon optimized ribonucleic acid of claim 1 which has the sequence of SEQ ID NO:19 and which has a codon adaptiveness index of 0.28 compared to an index of 1.0 for perfectly optimized translation in human cells.
10. A method of preparing a cancer cell vaccine comprising using the ribonucleic acid of claim 1 to transfect human cancer cells in vitro which express an immunogenic polypeptide.
11. The method of claim 10 wherein the cancer cells are carcinoma, sarcoma, myeloma or leukemia cells.
12. A method of forming a cancer cell vaccine in vivo by using the ribonucleic acid of claim 1 to transfect solid tumor cells in a cancer patient wherein the polypeptide expressed in the tumor cells produces an immune response.
13. The method of claim 12 wherein the solid tumor cells are comprised in a carcinoma or sarcoma.
14. The method of claim 12 wherein the expressed polynucleotide has the sequence of SEQ ID NO:2.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
DETAILED DESCRIPTION OF THE INVENTION
[0047] The present invention provides a cancer vaccine that can be prepared efficiently and with less expense than previously used vaccines, which are prepared by introducing plasmid DNA directly into the nucleus of the cell. The use of an emmL encoding mRNA (SEQ ID NO: 1, SEQ ID NO: 13, SEQ ID NO: 15 and SEQ ID NO: 16) inserted into the cell cytoplasm is more effective in transfecting tumor cells.
[0048] The present invention further provides several new emmL encoding RNAs designed to optimize increased expression in transformed cells. The more robust expression of Emm55 protein was achieved using several codon optimization algorithms designed to adapt the emm55 nucleotide sequence to mammalian expression.
[0049] mRNA is capable of antigenic protein message delivery into cancer cells. Not only is mRNA a safer alternative because it cannot integrate into the host DNA, but also expression is limited to only a few hours to a few days at maximum. mRNA delivery also places the antigenic message further down the cellular protein production process, therefore providing a quicker expression in the cells. The mRNA only has to be delivered into the cell cytoplasm, whereas DNA must ultimately end up in the nucleus to be effective. The use of mRNA is an advantage for production of protein antigen because mRNA can induce protein production in both post mitotic and non-dividing cells.
[0050] Although mRNA delivery of antigenic proteins is a safer alternative to DNA delivery, stability and immunogenicity of mRNA must be addressed. Many of the elements that facilitate increased stability and immunogenicity were engineered into the recombinant vector template. If appropriate elements are not contained in the vector, they can be added; for example, if the template vector does not contain a poly(A) tail coding sequence, the tail is added during transcription.
[0051] In order to have increased stability in the cytoplasm, the mRNA must contain both a 5′-methylguanosine cap and a 3′-poly(A) tail (SEQ ID NO: 3). These elements are responsible for attracting and attaching the components of the cell machinery responsible for translating the mRNA into proteins. Absence of these components can decrease the time in which the mRNA is available for protein translation prior to degradation. Accordingly, these elements have been incorporated into the mRNA as described in the examples.
[0052] Efficient immunogenicity can be increased by utilization of techniques such as enhanced delivery with viral vectors, nanoparticles, cationic polymers, lipids and electroporation. Viral vectors have been used extensively in delivery of plasmid DNA (pDNA) but have several risks, as well as increased cost. Electroporation with mRNA is less toxic to cells due to less stringent electrical settings and is a preferable method for delivery of mRNA. DNA requires a higher electrical charge to pass the DNA through the outer cellular membrane and the nuclear membrane, while mRNA needs to pass only though the outer cellular membrane.
[0053] Production of mRNA for vaccines has both economic and production benefits compared to pDNA. mRNA is synthesized in vitro from a linearized pDNA template and only a small amount of DNA is required. On the other hand, production of large amounts of pDNA is labor intensive and requires equipment such as large fermentation tanks to grow sufficient bacteria to produce the massive amount of pDNA required for vaccine production. While pDNA isolated from large cultures is pure, due to the circular nature of plasmids the end product occurs in three structural forms; relaxed, linear and supercoiled. Although each form has the ability to produce an antigenic protein once inside a cell, each DNA form varies in its ability to enter the cell via the plasma membrane. Production of mRNA creates only one structural form. Moreover, due to the synthetic method of production the batch to batch reproducibility is high.
[0054] From a production standpoint, mRNA is synthesized from DNA and is highly reproducible. This is important for use as a vaccine because no large scale growth is required, i.e. it takes less time and materials and there is less risk of contamination. These factors contribute to reduced costs. Further, synthesis of mRNA leads to higher yield since it only takes one linearized plasmid DNA to yield one hundred mRNA molecules. mRNA is produced in vitro, so there is no E. coli contamination post isolation (genomic DNA or endotoxin). This leads to fewer purification steps and quality control tests. The synthetic nature of in vitro transcription also ensures better batch to batch reproducibility and purer product since vector sequences, including selection markers, are not part of final product. Also in contrast to DNA, mRNA has a single molecular conformation, whereas plasmid DNA has three. mRNA is also easier to transfect than plasmid DNA and results in less cell death during electroporation since lower voltage is required. Like DNA, mRNA can also be lyophilized. From a regulatory standpoint, mRNA is safer because it is non-replicating and is transient. mRNA also poses minimal to no environmental issues since it is easily degraded and confers no antibiotic resistance.
[0055] The below comparison illustrates the advantages of using mRNA instead of DNA for antigenic emmL message delivery into cancer cells. The comparison is broken up into three parts; upstream production, downstream production and cellular delivery. The bulk of the benefits, including decreased production cost, reduced manufacturing time, superior message delivery and increased safety, are seen in the upstream production and cellular delivery. Each section shows a large difference between the DNA and mRNA processes as well as similar steps for each process.
[0056] Upstream Production:
[0057] The upstream production of both nucleic acid products is almost identical up to bacterial culture expansion. Only a small amount of DNA is required to produce approximately 100 times the amount of mRNA. For example, in vitro transcription experiments have yielded 25 μg of mRNA from only 0.2 μg of DNA. This is 25 times more mRNA than DNA produced using the same amount of culturing. Culture expansion can be very expensive and time consuming and leads to increase risk of contamination or mutation of DNA.
[0058] The benefit of having to grow only a small bacterial culture is significant. The small amount of DNA from this culture requires a smaller isolation to be performed. This downsizing saves time and resources and decreases contamination risk. The production of the final mRNA product requires an additional step of transcribing the mRNA from the DNA template. This is a synthetic step performed in vitro. Due to the synthetic nature of transcription, there is good batch to batch reproducibility and the procedure takes only a few hours. Culturing DNA-containing bacteria can require up to several days.
[0059] A significant disadvantage of using pDNA rather than mRNA is that the end product has the potential to be contaminated with genomic DNA (gDNA). Also, the isolated pDNA forms three configurations; linear, super-coiled and circular that do not transfect cells with the same efficiency. The mRNA final product is pure, in a single conformation, and is not contaminated with gDNA or pDNA.
[0060] Chart 1 compares steps employed for DNA and mRNA production.
TABLE-US-00001 CHART 1 Process Steps DNA Process Steps mRNA Vector Designed to Vector Designed to create a Engineering maximize Engineering stable mRNA number of molecule plasmid DNA that will lead to (pDNA) copies increased protein created in expression each bacterium Transformation Vector transformed Transformation Vector transformed of Bacteria into competent of Bacteria into competent Growth E. coli Growth E. coli Bacterial Transformed Bacterial Culture E. coli used to Culture Transformed E. coli inoculate a small used to inoculate a culture for small culture further expansion for later harvesting and purification Culture Culture must be N/A Culture expansion Expansion expanded not needed for to 2.5L-1000L mRNA because depending only a small on how much quantity of DNA is DNA is needed needed to Depending on synthesize mRNA the desired Approx. one quantity this linearized step can add pDNA = 100 days or weeks mRNA to the process molecules Harvesting Large scale must Harvesting Small scale due to be performed to above generate adequate Saves time amount of DNA Labor intensive Plasmid End product can Plasmid Small scale due to Isolation and have a Isolation and above Purification genomic DNA Purification Saves time contamination 3 conformation of DNA produced, not all transfect efficiently N/A End product mRNA RNA is synthesized is purified Transcription from linearized plasmid DNA and Purification pDNA Once synthesized it must be purified Good batch to batch reproducibility
[0061] Downstream Production (Autologous Preparation):
[0062] The majority of downstream production is the same for DNA and mRNA. One difference lies within the electroporation step. mRNA requires a lower voltage since it only has to pass through the plasma membrane and not the nuclear membrane, unlike DNA, which must pass through both the plasma and nuclear membranes. A lower voltage is favorable because it results in less cell death during electroporation. The increased viability of the mRNA transfected cells translates into an adequate proportion of vaccine cells expressing M-like proteins with ease.
[0063] Chart 2 compares processing of DNA and mRNA in tumor tissue through preparation to vaccination in transfected cells.
TABLE-US-00002 CHART 2 Process Process Steps DNA Steps mRNA Specimen Tumor tissue is excised Specimen Tumor tissue Arrival and from the patient and Arrival and is excised Processing shipped to the Processing from the laboratory patient and If the tumor tissue is shipped to the solid, it is digested laboratory using enzymes to If the tumor release cells. If from tissue is solid, lymphoma, cells are it is digested using aspirated. enzymes to release cells. If from lymphoma, cells are aspirated Cell The released cells are Cell The released Cultivation cultured to expand total Cultivation cells are cell number, if cultured to necessary expand total cell If the cell number is number, if adequate, can proceed necessary to transfection If the cell number is adequate, can proceed to transfection Transfection Must have enough Transfection Less voltage voltage to pass through needed two membranes; because plasma and nuclear only need to pass through the plasma membrane Irradiation Transfected cells are Irradiation Transfected irradiated so they cells are cannot divide once they irradiated so are administered back they cannot into the patient divide once they are administered back into the patient Administration The vaccine of Ad- The vaccine of irradiated cells is ministration irradiated cells administered is administered intradermally intradermally
[0064] Cellular Delivery:
[0065] Significant advantages of using mRNA delivery are demonstrated in the cellular delivery flow chart below. As shown in the chart, mRNA delivery into the cells skips ahead to immediate translation into the antigenic M-like protein. Not only does transfected DNA have to pass through an additional cellular membrane, but it also has to be transcribed into mRNA for delivery back into the cytosol, which is the starting point for the protein synthesis initiated by the mRNA vaccine.
[0066] mRNA vaccines can be conjugated with compatible immunologic adjuvants or repressors depending on the effect desired. Adjuvants such as TriMix, a cocktail of immunostimulatory molecules, can be added to an mRNA-based vaccine eliciting an increased immune response against the encoded immunogen. Immunologic repressors can be useful to combat immunosuppressive enzymes of other elements that may hinder the body's ability to mount a sufficient immune response. These immunosuppressive elements can be silenced by using silencing RNA (siRNA) that can be co-delivered during immunization. An additional type of immune repressor that can be administered in conjunction with an mRNA based cancer vaccine is a check-point inhibitor. These generally consist of antibodies, such as anti-PD1 and anti-CTLA4, that bind to receptors present on tumor cells or immune activated cells that if left unblocked will induce immune suppression. This process has been termed as “taking off the brakes” and as it implies this release of the “brakes” allows an immunotherapy, such as the mRNA cancer vaccine, to hone the immune system efforts on attacking the cancerous cells.
[0067] The vaccine can be used not only in conjunction with checkpoint inhibitor therapy but also chemotherapy, radiation therapy, whole cell vaccines, other nucleic acid therapy, natural killer cell therapy or chimeric antigen receptor therapy prior to or concurrently with administration of the RNA vaccine.
[0068] In other cases, a cancer patient is treated with regimens that alter the tumor microenvironment, including but not limited to, cytokines, anti-fugetaxis agents, chemotactic agents and metronomic doses of chemicals prior to or concurrently with administration of the vaccine.
[0069] Chart 3 compares DNA and mRNA processing in cells from cell entry to translation.
TABLE-US-00003 CHART 3 Process Process Steps DNA Steps mRNA Enter DNA must first pass Enter Plasma mRNA only has to Plasma through the plasma Membrane enter the cytosol to Membrane membrane become active Enter Nuclear Next the DNA must N/A The cellular Membrane pass through the machinery needed to nuclear membrane process the mRNA is located outside the nucleus so this step is not required Leads to quicker protein expression Transcription Once in the nucleus N/A The step of into mRNA the DNA will be transaction has transcribed into already been mRNA accomplished previously in vitro during the upstream production Exit Nucleus After the mRNA N/A The mRNA never message has been enters the nucleus so created it needs to pass this step does not back through the apply to mRNA nuclear membrane to reach the cytosol mRNA The mRNA is mRNA The mRNA is Translation translated as soon as it Translation translated as soon as reaches the cytosol it reaches the cytosol
[0070] In examples 23-25, mRNA encoding emmL can be produced using an in vitro transcription reaction. Several modifications to the resultant mRNA can be made in this reaction to improve mRNA and EmmL protein stability and translation efficiency, and to reduce mRNA immunogenicity. For example, a modified nucleic acid can be attached to the 5′ end of emmL mRNA such as, but not limited to, anti-reverse Cap Analog [ARCA, P1-(5′-(3′-O-methyl)-7-methyl-guanosyl) P3-(5′-(guanosyl))triphosphate)], N1-methyl-guanosine, 2′ fluoro-guanosine, 7-deaza-guanosine, inosine, 8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine and 2-azido-guanosine.
[0071] In another example, a poly(A) tail approximately 50-200 adenosine monophosphates in length can be attached to the 3′ end of emmL mRNA or both 5′ modified nucleotide cap and poly(A) tail can be added to emmL mRNA.
[0072] emmL mRNA can be synthesized with ribonucleotide analogs. Chemical modifications can be made at this stage to further improve translation efficiency and stability. Examples include; 5-methyl-cytidine-5′-triphosphate, pseudouridine-5′-triphosphate, 2-thiouridine-5′triphosphate, and N1-methylpseudouridine-5′-triphosphate.
[0073] There are numerous methods to deliver mRNA to a cell such that EmmL protein will be produced at high levels. For example, emmL mRNA produced following in vitro transcription can be injected directly into a tissue or tumor.
[0074] Complexing agents such as lipids or polymers can be used to protect RNA from degradation, enhance uptake by cells and improve delivery to the translation machinery in the cytoplasm. In one embodiment, emmL mRNA is complexed with a liposome prepared from a lipophilic material such as cholesterol and synthetic phospholipids.
[0075] In one embodiment, emmL mRNA is complexed with a liposome prepared from a lipophilic material such as cholesterol and natural phospholipids.
[0076] In one embodiment, emmL mRNA is complexed with a cationic lipid such as, but not limited to, N-[1-(2,3-Dioleoyloxy)propyl]-N,N,N-trimethylammonium methyl-sulfate (DOTAP).
[0077] In one embodiment, emmL mRNA is complexed with a zwitterionic lipid such as, but not limited to, 3-[(3-Cholamidopropyl)dimethylammonio]-1-Propanesulfonate (CHAPS).
[0078] In one embodiment, emmL mRNA is complexed with a PEGylated lipid such as, but not limited to, N-(Carbonyl-methoxypolyethyleneglycol 2000)-1,2-distearoyl-sn-glycero-3 phosphoethanolamine (DSPE-PEG).
[0079] In one embodiment, emmL mRNA is complexed with a mixture of cationic, zwitterionic and PEGylated lipids.
[0080] In one embodiment, emmL mRNA is complexed with protamine.
[0081] In one embodiment, emmL mRNA is complexed with a liposome prepared from a specific material such as the Hemagglutinating virus of Japan, which has been used to prepare mRNA vaccine for the treatment of melanoma [26].
[0082] In one embodiment, emmL mRNA can be complexed with a polymer that is rationally designed with multiple materials that mimic viral components to transfect specific cells with high efficiency. These would include, but are not limited to membrane-disrupting peptides, nucleic acid binding components, a protective coat layer, and an outer targeting ligand.
[0083] In one embodiment, complexing components can be combined and formulated into a single nanoparticle.
[0084] In one embodiment, emmL mRNA or emmL mRNA complexes can be combined with interfering RNAs or interfering RNA complexes directed against immune checkpoint molecules such as programmed cell death protein 1 (PD-1), programmed death-ligand 1 (PD-L1), cytotoxic T-lymphocyte associated protein 4 (CTLA-4) or T-cell immunoreceptor with Ig and ITIM domains (TIGIT). One non-limiting example is emmL mRNA complexes and short interfering RNA (siRNA) complexes targeted to PD-1.
[0085] In one embodiment, the emmL coding region can be combined with viral RNA replication genes to form a linear RNA molecule capable of self-replication. This linear RNA molecule can then be formulated with lipophilic compounds and lipids to form liposomes capable of transfecting cells with self-replicating mRNA.
[0086] In one embodiment, emmL mRNA or emmL mRNA formulated with lipids, protamine or in liposomes, is complexed with a biodegradable polymer. One non-limiting example is polycaprolactone, which has been approved by the Food and Drug Administration for use as a drug delivery device. The advantage of biodegradable polymer complexing is that mRNA or mRNA complexes can be delivered over a long-time frame as the polymer degrades. This sustained delivery can enhance the effectiveness of a vaccine.
[0087] In one embodiment, emmL mRNA or emmL mRNA complexes can be formulated in a biodegradable polymer containing tissue- or tumor-specific factors that enhance the efficacy of the emmL mRNA vaccine. An example can be an emmL mRNA vaccine formulated with a biopolymer containing factors that inhibit angiogenesis or vasculogenesis, thereby providing a synergistic anti-tumor effect.
[0088] In one embodiment, emmL mRNA or emmL mRNA complexes can be formulated in a biodegradable polymer containing factors that reduce the expression of immune checkpoint molecules such as PD-1, PD-L1, CTLA-4 or TIGIT. As a non-limiting example, this can include existing or novel pharmaceutical reagents such as small molecules or antibodies that reduce the expression of PD-1, thereby providing a synergistic anti-tumor effect.
[0089] In one embodiment, emmL mRNA or emmL mRNA complexes can be formulated in a biodegradable polymer containing interfering RNAs or interfering RNA complexes for factors that reduce the expression of immune checkpoint molecules such as PD-1, PD-L1, CTLA-4 or TIGIT. One non-limiting example is emmL mRNA complexes and short interfering RNA (siRNA) complexes.
[0090] In one embodiment, emmL mRNA or emmL mRNA complexes can be combined with an adjuvant such as synthetic double-stranded RNA polyriboinosinic polyribocytidylic acid [poly(I: C)].
[0091] Analysis of pSFCMVT/emmL Design Elements
[0092] Several design elements could improve the level of EmmL protein production.
[0093] The mRNA vaccine detailed in example 1 (SEQ ID NOs: 1-3) was cloned into the Oxford Genetics pSF-CMV_T7 plasmid DNA vector to produce pSFCMVT7/emmL. Although mRNA expression following transfection of mammalian cells was detected, only low levels of Emm55 protein were detected on western blots. A retrospective analysis of pSFCMVT7/emmL identified design elements that could improve translation efficiency in mammalian cells.
[0094] There are at least two different types of design element that could improve the level of EmmL protein production. Proximal elements are close to the emmL coding region and are added during polymerase chain reaction (PCR) amplification of emmL from pAc/emm55 Distal elements are distant from the emmL coding region and are of general utility for enhancing expression of protein from an mRNA.
[0095] Proximal elements include the introduction of a translation initiation sequence optimized for mammalian cell expression to the N-terminal end of the emmL coding region. This sequence has been determined to be RYMRMVATGGC, where R is A or G, Y is C or T, M is A or C and V is A, C or G (SEQ ID NO: 4). In one embodiment, the optimal translation initiation sequence, ATAGCCATGGC (SEQ ID NO: 5), replaces the native start codon of emmL.
[0096] In one embodiment of this proximal design element, oligonucleotide PCR primers are synthesized such that there is an equimolar concentration of each nucleotide at the degenerate positions (R, Y, M and V in SEQ ID NO: 4) and the final oligonucleotide synthesis product contains all possible primer sequences. In the current embodiment, the optimal translation initiation sequence is determined empirically by comparing the level of EmmL protein expression in assays such as western blots after the emmL gene has been sub-cloned into a mammalian expression plasmid DNA vector.
[0097] Another proximal design element that can be used to modify the C-terminal end of the emmL coding region is the addition of stop codons added after the native stop codon. Many eukaryotic expression plasmid vectors contain the DNA sequence of all three stop codon variants, TAG, TAA and TGA, immediately after the last codon of the expressed gene. Since the DNA sequence of the native emmL stop codon is TAG, SEQ ID NO: 6. can be included as an added proximal design element.
[0098] Another proximal design element is the addition of restriction endonuclease recognition sites that can be added to the N- and C-terminal ends of the emmL coding region to facilitate its insertion into plasmid cloning vectors. The choice of restriction endonuclease recognition site is made based on the destination plasmid. Some examples of restriction endonucleases that could be used are SacI, NotI, BglII, EcoRV and SpeI. In one preferred embodiment, SacI and SpeI sites are added to the N- and C-terminal ends of the emmL coding region, as they do not cut within the emmL coding region and share reaction conditions, so they can be used simultaneously to prepare the emmL coding region PCR amplimer for insertion into the destination plasmid.
[0099] Design elements that are distal to the emmL coding region are added to a plasmid cloning vector such that any variation of the emmL coding region, or other gene that is adapted with the proximal design elements, can be inserted. These distal elements can be engineered to create an mRNA expression vector capable of driving high-level mRNA and protein expression of emmL or any other mammalian mRNA.
[0100] One distal design element is the DNA sequence for a bacteriophage RNA polymerase promoter region. Examples of bacteriophage RNA polymerases are T7, T3 and SP6. In one embodiment, the promoter for T7 RNA polymerase (SEQ ID NO: 8) is the first of several distal elements added in such a way that it is ultimately upstream, with respect to the action of T7 RNA polymerase, from the emmL coding region.
[0101] RNA sequences immediately 5′ and 3′ of eukaryotic gene coding regions that are transcribed but not translated, termed untranslated regions (UTRs), can have strong positive or negative effects on protein translation from in vitro transcribed mRNA. In general, UTRs that support high level protein expression are unstructured, lack negative regulatory sequences and may contain the binding sites for microRNAs that serve to further refine the gene expression pattern. Both UTRs of genes that are highly expressed in mammalian cells in general, or UTRs from genes with an expression pattern matching the tissue where mRNA vaccine expression is desired, can be used to optimize delivery of a gene product such as EmmL protein. UTRs from the Xenopus laevis beta globin gene have been used extensively to mediate high levels of translation in a wide range of eukaryotic cells, including in the design of RNAs used for mammalian immune therapy Examples of tissue-specific UTRs are the tryptophan hydroxylase (TPH) isoforms, which drive differential expression in the pineal gland and brain stem.
[0102] In one embodiment, the Xenopus laevis beta globin gene 5′ UTR can be positioned upstream, with respect to RNA polymerase activity, from the emmL coding region. SEQ ID NO: 9 is one non-limiting example of a Xenopus laevis beta globin gene 5′ untranslated region.
[0103] In one embodiment, the Xenopus laevis beta globin gene 3′ UTR can be positioned downstream, with respect to RNA polymerase activity, from the emmL coding region. SEQ ID NO: 10 is one non-limiting example of a Xenopus laevis beta globin gene 3′ untranslated region.
[0104] In one embodiment, both the Xenopus laevis beta globin gene 5′ and 3′ UTRs can be positioned to flank the emmL coding region.
[0105] In one embodiment, 5′ and 3′ UTRs are selected based on the type of neoplastic cell targeted by the vaccine. In one non-limiting set of examples, the 5′ and 3′ UTRs of genes expressed highly in melanoma cells, such as tyrosinase (TYR), melanogenesis associated transcription factor (MITF), melanocortin receptor 1 (MC1R), telomerase (TERT), cyclooxygenase 2 (COX2), C-X-C motif chemokine receptor 4 (CXCR4) and baculoviral IAP repeat containing 5 genes (BIRCS), can be used to provide high levels of cell-specific expression to an emmL-based vaccine when used to treat melanoma.
[0106] In one embodiment, other genetic elements not located within the primary gene transcript that confer desired expression level and specificity can be included before, after or within the 5′ and 3′ UTRs to further refine vaccine expression.
[0107] Another distal design element is a synthetic DNA sequence that provides restriction endonuclease recognition sites that can be used to insert the emmL coding region into the other flanking distal design elements. In one embodiment, the restriction endonuclease recognition sites for SacI, NotI, BglII, EcoRV and SpeI are used (SEQ ID NO: 7).
[0108] Another distal design element is a synthetic DNA sequence that provides restriction endonuclease recognition sites to cut the destination plasmid immediately after the emmL coding region to produce a linear plasmid DNA molecule. Linearization provides effective termination for RNA polymerase activity, which increases the production of uniform length mRNA transcripts. An example of a sequence is SEQ ID NO: 11, which contains restriction endonuclease recognition sites for BamHI, EcoRI and XbaI. In one preferred embodiment, BamHI can be used to linearize a plasmid containing the emmL coding region as it does not cut within the emmL coding region and leaves a 5′ nucleotide overhang, which may allow for higher efficiency transcription than a 3′ nucleotide overhang.
[0109] In one embodiment, a double stranded DNA molecule containing the abovementioned distal design elements is synthesized by use of overlapping complementary synthetic single stranded oligonucleotide molecules. These molecules are annealed and gaps remaining are filled in with a DNA polymerase such as Taq polymerase.
[0110] In one embodiment, two complementary synthetic single stranded oligonucleotide molecules can be synthesized to encompass all desired distal design elements. These oligonucleotide molecules are then annealed. In either of the abovementioned embodiment, the resultant blunt-ended synthetic DNA molecule can be inserted into a PCR cloning vector such as the Invitrogen pCR®II-TOPO plasmid by adding a template non-specific adenosine. This is accomplished by incubating the blunt-ended synthetic DNA molecule with Taq polymerase and deoxyadenosine triphosphate at approximately 200 μM final concentration at 72° C. for 10 minutes.
[0111] In one embodiment, a plasmid containing the abovementioned distal design elements is named pT7XLUTR. A map of the synthetic DNA molecule inserted into pCR®II-TOPO is shown as
[0112] pT7XLUTR can be used to transform E. coli. Bacterial transformed with pT7XLUTR can be selected on an agar plates containing an antibiotic that matches the PCR cloning vector, such as agar plates containing Luria Bertani broth supplemented with 50-100 μg/mL kanamycin or carbenicillin. The bacterial culture can be expanded by growth in a liquid antibiotic selective media, such as Luria Bertani broth supplemented with 50-100 μg/mL kanamycin or carbenicillin, and plasmid DNA prepared using methods known to a person practiced in the art.
[0113] RNAs incorporating several of the described design elements were found to increase expression of Emm55. The sequences are shown in SEQ ID NO: 13, SEQ ID NO: 15 and SEQ ID NO: 16.
EXAMPLES
[0114] The following examples are provided as illustrations of the invention and are in no way to be considered limiting.
Example 1. Autologous mRNA Vaccine for Canine Lymphoma
[0115] A 75 lb. male neutered Rhodesian Ridgeback, presents to his veterinarian with swollen mandibular and inguinal lymph nodes. The patient has a fine needle aspirate performed on one of the enlarged nodes. Upon review by the pathologist he is diagnosed with low grade diffuse lymphoma.
[0116] The patient's owner elects to pursue immunotherapy treatment instead of chemotherapy and steroids, due to the minimal side effects reported in immunotherapy treatments. The veterinarian excises the right mandibular lymph node while the patient is under general anesthesia. The tissue sample is shipped overnight for laboratory processing.
[0117] Upon receiving the tissue sample at the lab the following is performed: 1) the travel medium is checked for any bacterial contamination, 2) the tissue dimensions are measured, 3) the intact lymph node is aspirated repeatedly using several boluses of wash medium to release the tumor cells, and 4) the aspirated cells are collected and counted.
[0118] An appropriate amount of cells is made available to electroporate with emmL encoding mRNA. Using a BioRad Gene Pulse machine, 120×10.sup.6 cells are transfected with 80 μg of mRNA. A small portion of the transfected cells are cryopreserved, while the rest are placed in culture for approximately 24 hours. After 24 hours the cells are irradiated and aliquoted into 10×10.sup.6 cell vaccine doses that are cryopreserved until needed.
[0119] The patient is administered a total of 8 vaccine doses. Each dose is shipped overnight from the laboratory to the veterinary clinic, arriving on the scheduled administration day. The veterinarian administers each dose intradermally using a syringe with needle. The 8 vaccine doses are given every 7 days (+/−1 day) for 4 weeks and then once a month for 4 months. Prior to the first dose a blood sample is taken. Subsequent blood samples are taken preceding the 5th vaccine, 8th vaccine and 8 weeks after the last vaccine. The blood samples are processed for peripheral blood & plasma and preserved at the lab. They are later used for evaluation of anti-tumor immune response.
[0120] Throughout the course of treatment, the patient's lymph node size is monitored along with his overall quality of life. Overall disease state is assessed by tumor burden reduction and anti-tumor immune response. Tumor burden is evaluated through measurements performed on each of the lymph nodes throughout the course of treatment. Anti-tumor immune response is measured using standard enzyme-linked immunosorbent assay (ELISA) to assess antibody levels and flow cytometry to assess cytotoxic T-cell (CTL) response.
[0121] During the course of treatment, the patient's lymph node size increases and later decreases as the course continues. This observation is probably due to infiltration of immune cells into the tumor site, in this case, the lymph nodes. The ELISA and flow cytometry results show an increase in antibody production and CTLs after the fourth vaccine that then persists after the completion of the series of vaccines.
Example 2. Direct mRNA Vaccine for Equine Melanoma
[0122] A 15 year old Andalusian, presented to her veterinarian with black lesions on her neck, mane and in the perianal area. Upon review of a fine needle aspirate the pathologist diagnoses the patient with melanoma. The owner elects to pursue immunotherapy treatment due to the complicated nature of excising the perianal lesion on the patient.
[0123] Three vaccine doses are prepared containing 100 μg mRNA in 100 μL sterile nuclease free H.sub.20. The three doses and three needle-free injection devices (J-Tip) are shipped to the veterinarian. Three of the patient's lesions are chosen to receive the treatment course, a total of 300 μg mRNA per time point. Every two weeks three more doses are shipped to the veterinary clinic as previously done and each dose is administered to the same three lesions using the J-Tip device. The patient receives a total of six vaccine doses per lesion.
[0124] Blood samples are collected prior to initiation of the vaccine series, prior to the 5th vaccine dose and two weeks after the series is completed. The blood samples are processed for peripheral blood & plasma and preserved. They are later used for evaluation of anti-tumor immune response.
[0125] Overall disease state is assessed by tumor burden reduction and anti-tumor immune response. Tumor burden is evaluated through measurements performed on the lesions before each of the six vaccine doses are administered. Anti-tumor immune response is measured using standard ELISA to assess antibody levels and flow cytometry to assess the CTL response.
[0126] As seen in other patients receiving immunotherapy treatment, the melanoma lesions will initially increase in size followed by a decrease as the vaccine series progresses. The ELISA and FACS results show an increase in antibody production and CTLs after the second vaccine that will persist after the completion of the series of vaccines.
Example 3. Overview of Methods for emmL mRNA Creation
[0127] Methods Overview:
[0128] Restriction Enzyme Digestion of Vector and Insert
[0129] To create the appropriate recombinant plasmid for optimal mRNA production, a plasmid backbone including dual prokaryote and eukaryote promoters, untranslated 3′ and 5′ regions, and a selective marker was used. A vector of this type; for example, pSFCMVT7, has multiple features that aid in the production and stabilization of the mRNA encoding an antigenic M-like protein, such as Emm55. Both the vector pSFCMVT7 and the insert containing plasmid pAc/emmL were cut using restriction enzymes SacI and EcoRV. Refer to
[0130] DNA Fragment Separation with Gel Electrophoresis
[0131] Once the restriction digestion was performed with the appropriate enzymes, the DNA fragments were isolated through gel electrophoresis. A reference DNA ladder is run with both the digestion reactions to assess DNA band lengths, thus aiding in identification of the bands of interest. The bands containing the DNA were extracted from the gel.
[0132] Gel Extraction/DNA Isolation
[0133] The gel slices containing the DNA of interest were solubilized and the DNA extracted in order for the vector and insert to be ligated together to create the recombinant plasmid pSFCMVT7/emmL.
[0134] Vector and Insert Ligation
[0135] During the restriction digestion of the vector and insert containing plasmids, “sticky ends” were created, which were pieced together later with a ligation reaction. The “sticky ends” refer to unpaired nucleotides that are available for hydrogen bonding with the complementary nucleotides. Since the vector pSFCMVT7 and insert emmL were cut with the same restriction enzymes they contain complementary ends that were joined upon exposure to T4 DNA ligase.
[0136] Transfection into Bacteria
[0137] After the mRNA production plasmid pSFCMVT7/emmL was created, it was transformed, i.e., transfected, into competent bacteria that produce sufficient DNA that was isolated and will be used for in vitro mRNA synthesis. Invitrogen's Stb13 E. coli is an example of the type of bacteria that can be used for transfection. Transformation was induced by heat shocking the bacteria to open up small orifices in the cell membranes allowing the plasmid to enter the cell and ultimately the nucleus.
[0138] Growth and Expansion of Bacterial Culture
[0139] The bacteria transfected with the plasmid were placed onto appropriate growth medium containing a selective antibiotic. In the case of pSFCMVT7 this is a kanamycin. If the bacteria are correctly transformed with the plasmid they will produce a protein that will hinder the anti-bacterial properties of the kanamycin and allow the kanamycin-resistant bacteria to selectively grow on the medium.
[0140] Plasmid Isolation and Purification
[0141] Once an adequate number of bacteria containing pDNA had grown, the cells were lysed allowing for the plasmid to be released from inside the cells. The pDNA was isolated from the gDNA, proteins and other cellular debris through filtration and an anionic exchange column.
[0142] Preparation of Template DNA: Plasmid DNA Linearization
[0143] The isolated DNA contains the template DNA for mRNA production. In order for the transcription reaction to occur, the plasmid must be linearized. It is important that the linearization occur down-stream from the open reading frame gene of interest.
[0144] mRNA Transcription Reaction
[0145] After the template has been prepared, the message is created through an in vitro transcription reaction. This reaction simulates the transcription of mRNA in the cell, including the capping of the 5′ end and addition of a poly(A) tail for increased stabilization.
[0146] mRNA Purification
[0147] Once the message has been transcribed into mRNA, the residual DNA template is degraded so that a pure mRNA product can be used to transfect into autologous cells, allogeneic cells or intratumorally. Once inside the cells the mRNA will produce and display the M-like protein on the cell surface for immune activation.
[0148] Transfection of Cancer Cells with mRNA
[0149] One way the mRNA can be delivered into the cancer cells is by the method of electroporation. This method utilizes a weak electrical current that causes the cellular membrane to open up small pores that then allow the mRNA to move through the membrane and into the cytoplasm.
Example 4. Restriction Enzyme Digestion
[0150] Table 1 shows the procedure for rapid digestion of pDNA.
TABLE-US-00004 TABLE 1 STEP 1 Set up two reactions as follows, each in a separate 0.5 mL tube: pSFCMVT7 pAc/emmL (Vector) (Insert) Sterile, nuclease-free water To 50 μL To 50 μL RE 10X Buffer 5.0 μL 5.0 μL Acetylated BSA (10 μg/mL) 0.5 μL 0.5 μL DNA (5 μg) 5 μg 5 μg SacI (10 μg/μL) 3.0 μL 3.0 μL EcoRV (10 μg/μL) 3.0 μL 3.0 μL Total Volume 50.0 μL 50.0 μL 2 Mix reaction well by pipetting up and down gently. 3 Pulse centrifuge all the tubes to get the entire contents to the bottom. 4 Incubate in dry heating block at 37° C. for 1 hour. 5 Run gel electrophoresis to separate fragments.
Example 5. DNA Fragment Separation with Gel Electrophoresis
[0151] Table 2 shows the procedure for DNA fragment separation.
TABLE-US-00005 TABLE 2 STEP 1 Dissolve 1.0% agarose in 50 mL of 1X TAE buffer by heating in the microwave. Ok it boils. Ensure all granules have solubilized. 2 Cool flask with liquid agar under running tap water. 3 Pour liquid agar into gel cast with comb making sure not to create any bubbles 4 Allow gel to solidify at room temperature. 5 While gel is cooling, Create 1 kb ladder solution by adding 10 μL Promega 1 kb ladder and 2 μL dye in a microcentrifuge tube. 6 Add 2 μL Blue juice to each reaction. 7 Load 12 μL of 1 kb ladder and 50 μL of each reaction into gel. 8 Run gel at 80 volts until samples move out of the gel wells, then increase to 100 volts until dye reaches the bottom of gel. 9 Take picture of gel using bioimaging equipment with ultraviolet light. Do not expose the gel to the UV light more than 1 minute to prevent mixing of the DNA. 10 Cut out bands of interest pSFCMVT7 vector (~4234 bp) and emmL (~1700 bp) using a sterile scalpel and store at −20° C. until needed.
Example 6. Gel Extraction/DNA Isolation
[0152] Table 3 shows the procedure for Extraction and DNA Isolation.
TABLE-US-00006 TABLE 3 STEP 1 Minimize the size of the gel slice by removing extra agarose with a scalpel. 2 Weight gel slices. 3 Add 3 volumes of gel solubilization buffer to 1 volume of gel to each. 4 Incubate at 50° C. for 10 minutes (or until the gel slice has completely dissolved). Mix by vortexing every 2-3 minutes to help dissolve gel. 5 After gel slice appears dissolved, incubate the tube for an additional 5 minutes. 6 Add 1 gel volume of isopropanol to the sample and mix. 7 Place a gel extraction column in a provided 2 mL collection tube for each sample. 8 Apply samples (maximum capacity 700 μL, meaning more than one centrifugation may need to be performed) from step 6 to the labeled columns and centrifuge at >12,000 × g for 1 minute. 9 Discard flow-through by pipetting contents out of tube, carefully avoiding leaving droplets on sides of tubes, and place column back in the same 2 mL collection tubes. 10 Add 0.5 mL of wash buffer to the columns and centrifuge at >12,000 × g for 1 minute. 11 Repeat Steps 9 and then 10. 12 Repeat Step 9 and then proceed to Step 13. 13 Remove excess buffer by centrifuging the tubes at >12,000 × g for 1 minute and repeat Step 9. 14 Remove excess ethanol by centrifuging the tubes at > 12,000 × g for 3 minutes and repeat Step 9. 15 Place columns in clean 1.5 mL microcentrifuge tube. 16 Elute DNA by adding 50 μL of elution buffer to the center of each column's membrane and centrifuge for 1 minute at >12,000 × g. 17 Use spectrophotometer to measure the DNA concentration in each sample. Use these numbers to calculate the quantity of vector and insert needed for ligation.
Example 7. Vector and Insert Ligation
[0153] Table 4 shows the procedure for vector insert and ligation.
TABLE-US-00007 TABLE 4 STEP 1 Use the following equation to calculate the quantity of vector and insert needed for ligation (use molar ratio of 1:2 vector to insert):
Example 8. Transformation of DNA into E. coli
[0154] Table 5 shows the procedure for transformation of E. coli.
TABLE-US-00008 TABLE 5 STEP 1 Thaw three tubes of E. coli in an ice bath immediately before using. 2 Label these tubes ligation, positive control and negative control. Negative control consists of vector only from ligation protocol. Positive control consists of the original intact plasmid. Ligation consists of the newly constructed plasmid. 3 Add 10 pg to 100 ng of the corresponding DNA to each tube. 4 Incubate tubes in an ice bath for 30 minutes. 5 Heat shock cells for 45 seconds at 42° C. 6 Return to the ice bath for 2 minutes. 7 Add 250 μL SOC medium to each tube (pre-warmed to 37° C.). 8 Cap vials tightly and shake horizontally at 37° C. and 225 rpm for 1 hour. 9 Plate 25 μL and 100 μL of each transformation, at 100% and 1:10 dilution in LB medium, onto LB with kanamycin agar plates. 10 Store remaining mix at 4° C. in case additional cells need to be plated the following day. 11 Invert and incubate the plates overnight at 37° C. 12 The following day count colonies and calculate transformation efficiency using the following equation.
Example 9. Growth and Expansion of Bacterial Culture
[0155] The Table 6 shows the procedure for growth and expansion of the bacterial culture.
TABLE-US-00009 TABLE 6 STEP 1 Select one colony from agar plate and place in culture tube with 5 mL LB broth containing kanamycin. 2 Place in 37° C. shaking incubator at 300 rpm overnight. 3 After 8-12 hours measure OD 600. When reaches 8.0 AU centrifuge bacteria and proceed according to plasmid isolation protocol.
Example 10. Plasmid Isolation and Purification
[0156] Table 7 shows the procedure for plasmid isolation and purification.
TABLE-US-00010 TABLE 7 STEP 1 Add LyseBlue reagent (one vial) to Buffer P1 and mix to yield a 1:1000 dilution. Use a sterile biological hood to add reagent. 2 Add RNase A solution (one vial) to Buffer P1 to yield a final concentration of 100 μg/mL. Use a sterile biological hood to add solution. 3 Pre-chill Buffer P1 and Buffer P3 in 4º C. refrigerator. 4 Prepare 70% ethanol by adding 3.5 mL 100% ethanol to 1.5 mL nuclease-free water. 5 Check Buffer P2 for SDS precipitation. If necessary dissolve SDS by warming to 37° C. Leave Buffer P2 bottle closed when not in use to avoid acidification from CO.sub.2 in air. 6 Harvest the bacterial cells by centrifugation at 2773 × g for 30 minutes at 4° C. using the Beckman centrifuge. If you wish to stop the protocol and continue later, freeze cell pellets at −20° C. 9 Decant supernatant and resuspend bacterial pellet in 0.3 mL of chilled Buffer P1 (vigorously shake bottle to mix before adding to the pellet). The pellet should be completely resuspended by pipetting up and down to ensure complete mixing of lysis buffer. 10 Add 0.3 mL of Buffer P2, mix by gently inverting four to six times, and incubate at room temperature for five minutes. The solution should turn blue. 11 Add 0.3 mL of chilled Buffer P3 and mix thoroughly by inverting four to six times. The solution should turn colorless with a fluffy white precipitate. 12 Incubate on ice for 5 minutes. 13 Centrifuge at 14,000-18,000 × g for 10 minutes. Remove supernatant containing plasmid DNA. 19 Equilibrate a QIAGEN-tip 20 by applying 1 mL buffer QBT and allow the column to empty by gravity flow. 20 Apply supernatant from step 13 to the QIAGEN-tip 20 and allow column to empty by gravity flow. 21 Wash the QIAGEN-tip 20 with 2 × 2 mL buffer QC. 22 Elute DNA into a clean 1.5 mL microcentrifuge tube by adding 0.8 mL Buffer QF to the column. 23 Precipitate DNA by adding 0.7 volumes (590 μL per 800 μL of elution volume) of room-temperature isopropanol to the eluted DNA. 24 Mix and centrifuge immediately at 15,000 × g for 30 minutes. Decant supernatant. 25 Wash DNA pellet with 1 mL of 70% ethanol and centrifuge 15,000 × g for 10 minutes. Decant supernatant. 26 Air-dry pellet for 15-30 minutes and re-dissolve in suitable volume of TE buffer. Ideal final concentration is 1 mg/ml or less. 26 Measure yield of plasmid DNA following 27 Store sample at −80° C.
Example 11. Preparation of Template DNA
[0157] Table 8 shows the procedure for preparation of template DNA and plasmid linearization.
TABLE-US-00011 TABLE 8 STEP 1 Add the following to a Biopur tube (2 mL): 40 μL 10X restriction enzyme buffer, 4.0 μL BSA, 5 μg of plasmid DNA, and sterile nuclease-free water up to a final volume of 390 μL. 2 Mix by gently pipetting up and down. 3 Add 10 μL of restriction enzyme BamHI. 4 Incubate at 37° C. for 1-2 hours. 5 Terminate the digestion by adding the following into the tube in sequential order: 20 μL of 0.5M EDTA, 40 μL of 3M NH.sub.4OAc, and 800 μL ethanol. 6 Mix and chill at −20° C. for 15 minutes. 7 Centrifuge the tube to pellet the DNA for 15 minutes at 16,000 = g and 4º C. 8 Decant the supernatant and pulse centrifuge. 9 Remove the remaining supernatant with a fine-tipped pipette. 10 Resuspend the DNA in nuclease-free water or TE buffer to yield a final concentration of 0.5 μg- −1.0 μg/uL.
Example 12. mRNA Transcription
[0158] Table 9 shows the procedure for transcribing mRNA
TABLE-US-00012 TABLE 9 STEP 1 Thaw all frozen reagents. 2 Place RNA Polymerase Enzyme Mix on ice. 3 Vortex 10X T7 Reaction Buffer and T7 2X NTP/ARCA to ensure they are completely mixed. Place T7 2X NTP/ARCA on ice and leave 10X T7 Reaction Buffer at room temperature. 4 Set up the following reaction at room temperature: Sample Nuclease-free water To 20 μL T7 2X NTP/ARCA 10 μL 10X T7 Reaction Buffer 2 μL Linearized plasmid DNA 0.5 μg T7 Enzyme Mix 2 μL Total volume 20 μL 5 Mix gently by pipetting up and down. Pulse centrifuge. 6 Incubate at 37° C. for 1 hour. 7 Add 1 μL of TURBO DNase and mix well. 8 Incubate at 37° C. for 15 minutes. 9 To the 20 μL reaction add the following: 36 μL nuclease-free water, 20 μL 5X E-PAP Buffer, 10 μL 25 mM MnCl.sub.2, and 10 μL ATP solution. 10 Pull 2.5 μL and set aside for gel. 10 Add 4 μL E-PAP and mix gently. 11 Incubate at 37° C. for 30-45 minutes. 12 Place reaction on ice until needed for purification reaction.
Example 13. mRNA Purification
[0159] Table 10 shows the procedure for purifying the mRNA
TABLE-US-00013 TABLE 10 STEP 1 Bring RNA sample to 100 μL with elution solution. Mix gently by pipetting up and down. 2 Add 350 μL binding solution concentrate to the sample and mix gently by pipetting up and down. 3 Add 250 μL of 100% ethanol to the sample and mix gently. 4 Insert a filter cartridge into the collection tube. 5 Add mRNA mixture to the filter cartridge. 6 Centrifuge for 1 minute at 10,000-15,000 × g. Make sure the entire mixture has passed through the filter at the end of the centrifugation. 7 Discard the flow-through and place filter back in the tube. 8 Add 500 μL wash solution and repeat step 6 and 7. 9 Repeat Step 8. 10 Pulse centrifuge the filter one more time to remove any residual wash solution. 11 Place filter in a new collection/elution tube. 12 Apply 50 μL of elution solution, close the tube cap and incubate in a heat block at 65-75° C. for 5-10 minutes. 13 Recover eluted mRNA by centrifuging for 1 minute at 10,000-15,000 × g. 14 Measure purity and quantity using a spectrophotometer.
Example 14. Transfection of Cancer Cells with mRNA
[0160] Table 11 below shows the procedure for transfection of mammalian cancer cells with emmL mRNA.
TABLE-US-00014 TABLE 11 STEP 1 Assess the viability of the cell suspension using Trypan Blue dye exclusion. 2 For transfection collect 15 × 10.sup.6 cells in a 15 ml conical tube. Centrifuge cells at 638 × g and 10° C. for 10 minutes. 3 Decant supernatant and add 10 mL DPBS. Centrifuge cells at 638 × g and 10° C. for 10 minutes. 4 Repeat Step 3 two more times. 5 Resuspend cells in 300 μL transfection buffer. Mix gently using a pipette and then transfer suspension to 0.4 cm electroporation cuvette. 6 Add 20 μg mRNA to cell suspension in cuvette. Mix gently using pipette. 7 Set gene pulser to 260 v and 750 μF. Load cuvette and pulse. 8 Transfer electroporated cells in cuvette to T-75 flask with 20 ml of medium. 9 Place flask in incubator at 37° C. and 5% CO.sub.2 overnight. 10 After 24 hours assay for expression of M-like protein on cancer cell surface.
Example 15. Cloning Steps for DNA pSFCMVT7/emmL
[0161]
Example 16. Direct Binding of Antibody to M-Like Protein
[0162] The Western blot shown in
[0163] Proteins were separated by SDS-PAGE (10%) using 130 mM (3-ME in the loading buffer. Samples were boiled for 3 minutes at 100° C. and spun at 13,000×g for 2 minutes at room temperature. The blots (far left) were probed with primary antibody (α-M-like Protein) for 1.5 hours at room temperature in 5% milk. The primary antibody dilution was 1:500. The secondary antibody (goat α-mouse conjugated HRP) was at a dilution of 1:5000. The null blot (second from left) shows the non-specific binding of secondary antibody.
[0164] Chemiluminescence was used to visualize the protein on the nitrocellulose blots (exposure: 10 minutes).
Example 17. Fluorescence Microscope Images and Chart Demonstrating the Increased
[0165] expression seen with mRNA as compared with DNA. Results were compared from an experiment in which RNA and DNA were transfected into mammalian cells and assayed for protein expression. The results show that RNA at equivalent transfection quantity produced five times the amount of expression. (See
Example 18. Synthesized emmL mRNA, Untailed and Tailed
[0166] The procedure used to perform the denaturing agarose gel shown in
[0167] 20 ng samples and 100 ng ladder were prepared by diluting the total quantity into a 2.5 μL volume using DEPC treated water. An equivalent volume of formaldehyde sample buffer was added to each sample. The samples were mixed and then incubated at 65° C. for 15 minutes followed by a 1 minute incubation on ice. Samples were loaded into a 1.2% RNA gel cassette and then run at 225 volts for 8 minutes. The gel was incubated at room temperature for 10 minutes and then visualized using the FlashGel camera. mRNA sizes are determined by the RNA Millennium Marker.
Example 19
[0168] Chart 4 displays the results from an experiment in which RNA (emmL mRNA) and DNA (pSFCMVT17/emmL) were transfected into mammalian cells, stained with α-M-like protein, and assayed using flow cytometric analysis. The results show that the RNA-transfected cells produce an equivalent signal to the DNA transfected cells, i.e. 9%.
TABLE-US-00015 CHART 4 % Minus Minus Stained Tube Treatment Parent Unstained Untransfected Unstained Untransfected 1 emmL mRNA 0.4 pSFCMVT17/emmL 1.9 Stained Untransfected 5.6 4.6 −1 emmL mRNA 14.8 14.4 9 pSFCMVT17/emmL 16.6 14.7 9
Example 20
[0169] Blood samples from mice vaccinated with either emmL mRNA (treatment) or sterile water (control) were tested for the presence of antibodies that react to emmL protein. As shown in
Example 21
[0170] Chart 5 shows the results from an experiment in which mice were transplanted with melanoma tumor cells and subsequently injected with either emmL mRNA (treatment) or sterile water (control). The injection regimen began 10 days after tumor implantation. The regimen consisted of three injections, of either treatment or control, administered every seven days. All five mice in the experiment lived past injection #2. At this time, two out of three treatment mice had smaller tumors than the control mice. Three of the five mice survived past injection #3, at which point the two remaining treatment mice tumors were still smaller than the remaining control mouse tumor.
TABLE-US-00016 CHART 5 Tumor Measurements (mm.sup.2) Post Injection #2 Post Injection #3 Treatment 1 44 163 2 102 100 3 235 n/a Control 1 115 193 2 188 n/a
Example 22
[0171]
Example 23
[0172] A PCR with high fidelity Taq DNA polymerase is used to amplify the emmL coding region from the pAc/emm55 plasmid. In one embodiment, this amplimer is designed with proximal elements that include restriction endonuclease sites compatible with the pSF-CMV_T7 vector to minimize potentially inhibitory elements within the 5′ and 3′ UTRs of pSFCMVT7/emmL.
[0173] The proximal design elements include restriction endonuclease recognition sites for NcoI and XhoI, an optimal translation initiation sequence (SEQ ID NO: 4 or 5) and two additional stop codons (SEQ ID NO: 6) downstream of the emmL coding region, with respect to the activity of T7 RNA polymerase. The resultant amplimer can be inserted into a PCR cloning vector such as pCR®II-TOPO. The resultant plasmid can be used to transform E. coli, select for positive transformation on an agar plates containing a selective antibiotic that matches the PCR cloning vector, such as agar plates containing Luria Bertani broth supplemented with 50-100 μg/mL kanamycin or carbenicillin in the case of pCR II-TOPO.
[0174] Bacterial cultures containing the resultant plasmid can expanded by growth in a liquid antibiotic selective media, such as Luria Bertani broth supplemented with 50-100 μg/mL kanamycin or carbenicillin in the case of pCR®II-TOPO. Plasmid DNA can be prepared from these bacterial cultures using methods known to a person practiced in the art. The restriction endonucleases NcoI and XhoI can then be used to excise the emmL coding region flanked by proximal design elements from pCR II-TOPO plasmid DNA. The emmL coding region flanked by proximal design elements DNA fragment can then be inserted into the pSF-CMV_T7 vector, which has been digested with NcoI and XhoI. After ligation, bacterial transformation, selection for positive transformation on an agar plates containing 50-100 μg/mL kanamycin, expansion in Luria Bertani broth supplemented with 50-100 μg/mL kanamycin and plasmid DNA preparation using methods known to a person practiced in the art, the resultant plasmid, pSF/emmL can be used as a template for in vitro mRNA synthesis following linearization with the restriction endonuclease XhoI. The resultant mRNA and predicted amino acid sequences are shown as SEQ ID NOs: 13 and 14, respectively.
Example 24
[0175] High fidelity Taq DNA polymerase is used to amplify the emmL coding region from the pAc/emm55 plasmid with proximal design elements that include restriction endonuclease sites compatible with the polylinker region of pT7XLUTR. In one embodiment, this can also include an optimal translation initiation sequence (SEQ ID NO: 4 or 5) and two additional stop codons (SEQ ID NO: 6). The full sequence of this embodiment is shown in SEQ ID 15. The resulting amplimer can be inserted into a PCR cloning vector such as pCR®II-TOPO. Following bacterial transformation, selection, expansion and plasmid DNA preparation described in example 23, the resultant plasmid can be digested with restriction endonucleases SacI and SpeI to excise the emmL coding region with proximal design elements from pCR®II-TOPO. The emmL coding region with proximal design elements can then be ligated into the pT7XLUTR plasmid vector that has been digested with SacI and SpeI to generate pT7XLUTR/emmL. The resultant pT7XLUTR/emmL plasmid can be used to transform E. coli.
[0176] Following selection, expansion and plasmid DNA preparation described in example 23, the resultant pT7XLUTR/emmL plasmid can be used as a template for in vitro mRNA synthesis following linearization with the restriction endonuclease BamHI. The resultant mRNA and predicted amino acid sequences are shown as SEQ ID NOs: 15 and 14, respectively.
Example 25
[0177] High fidelity Taq DNA polymerase is used to amplify the emmL coding region from the pAc/emm55 plasmid with minimal 5′ and 3′ UTRs. The T7 RNA polymerase promoter sequence (SEQ. ID NO 8) is added as a proximal design element along with an optimal translation initiation sequence (SEQ ID NO: 4 or 5), two additional stop codons (SEQ ID NO: 6) and an XhoI restriction endonuclease site.
[0178] The resultant PCR product can be inserted into a PCR cloning vector such as pCR®II-TOPO. Following bacterial transformation, selection, expansion and plasmid DNA preparation described in example 23, the resultant plasmid, pT7/emmL can be used as a template for in vitro mRNA synthesis following linearization with the restriction endonuclease XhoI. The resultant mRNA and predicted amino acid sequences are shown as SEQ ID NOs: 16 and 14, respectively.
[0179] In examples 23-25, mRNA encoding emmL can be produced using an in vitro transcription reaction. Several modifications to the resultant mRNA can be made in this reaction to improve mRNA and EmmL protein stability and translation efficiency, and to reduce mRNA immunogenicity. For example, a modified nucleic acid can be attached to the 5′ end of emmL mRNA such as, but not limited to, anti-reverse Cap Analog [ARCA, P1-(5′-(3′-O-methyl)-7-methyl-guanosyl) P3-(5′-(guanosyl))triphosphate)], N1-methyl-guanosine, 2′ fluoro-guanosine, 7-deaza-guanosine, inosine, 8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine and 2-azido-guanosine.
[0180] In another example, a polyadenylated [poly(A)] tail approximately 50-200 adenosine monophosphates in length can be attached to the 3′ end of emmL mRNA or both 5′ modified nucleotide cap and poly(A) tail can be added to emmL mRNA.
[0181] emmL mRNA can be synthesized with ribonucleotide analogs. Chemical modifications can be made at this stage to further improve translation efficiency and stability. Examples include; 5-methyl-cytidine-5′-triphosphate, pseudouridine-5′-triphosphate, 2-thiouridine-5′triphosphate, and N1-methylpseudouridine-5′-triphosphate.
[0182] SEQ ID NO: 4. Degenerate DNA sequence of an optimal translation initiation sequence. R is A or G, Y is C or T, M is A or C and V is A, C or G.
TABLE-US-00017 RYMRMVATGGC
[0183] SEQ ID NO: 5. DNA sequence of an optimal translation initiation sequence.
TABLE-US-00018 ATAGCCATGGC
[0184] SEQ ID NO: 6. DNA sequence containing 2 stop codons.
TABLE-US-00019 TAATGA
[0185] SEQ ID NO: 7. DNA sequence of the restriction endonuclease recognition sites for SacI, NotI, BglII, EcoRV and SpeI.
TABLE-US-00020 GAGCTCGCGGCCGCAGATCTGATATCACTAGT
[0186] SEQ ID NO: 8. DNA sequence of the T7 RNA polymerase promoter.
TABLE-US-00021 TAATACGACTCACTATAG
[0187] SEQ ID NO: 9. 50 ribonucleotides of the Xenopus laevis beta globin gene 5′ untranslated region.
TABLE-US-00022 aagcuucuuguucuuuuugcagaagcucagaauaaacgcucaacuuuggc
[0188] SEQ ID NO: 10. 74 ribonucleotides of the Xenopus laevis beta globin gene 3′ untranslated region.
TABLE-US-00023 cuuuuugaugccauugccgacgcccuuggcaaggguuaccacuaaaccag ccucaagaacacccgaauggaguc
[0189] SEQ ID NO: 11. DNA sequence of the restriction endonuclease recognition sites for BamHI, EcoRI and XbaI.
TABLE-US-00024 GGATCCGAATTCTCTAGA
[0190] SEQ ID NO: 12. DNA sequence of the synthetic double stranded DNA molecule used to prepare pT7XLUTR. T7 RNA polymerase, restriction endonuclease recognition sites for SacI, NotI, BglII, EcoRV, SpeI, as well as BamHI, EcoRI and XbaI are underlined.
TABLE-US-00025 TAATACGACTCACTATAGAAGCTTCTTGTTCTTTTTGCAGAAGCTCAGAA TAAACGCTCAACTTTGGCGAGCTCGCGGCCGCAGATCTGATATCACTAGT CTTTTTGATGCCATTGCCGACGCCCTTGGCAAGGGTTACCACTAAACCAG CCTCAAGAACACCCGAATGGAGTCGGATCCGAATTCTCTAGA
[0191] SEQ ID NO: 13 (RNA sequence of example 23). Synthetic mRNA sequence following in vitro mRNA synthesis of emmL from a plasmid template, written from 5′ to 3′ with respect to the mRNA molecule. An anti-reverse cap analog (ARCA) is added to the 5′ end of the transcript and approximately 50-200 adenosine monophosphates (a.sup.50-200) are added to the 3′ end of the transcript during in vitro transcription. 5′ lowercase letters are the 5′ untranslated region (UTR) from the pSF-T7_CMV plasmid vector. The guanine (g) immediately after the ARCA cap is the +1 ribonucleotide produced by T7 RNA polymerase. Bold indicates ribonucleotides added to make the 5′ NcoI restriction endonuclease site, which is underlined, and an optimal translation initiation sequence. Uppercase letters indicate the coding sequence of emmL. At the 3′ end of the mRNA sequence, bold indicates two additional stop codons. The 3′ XhoI restriction endonuclease site is underlined.
TABLE-US-00026 gggagaagaucuuugucgauccuaccauccacucgacacacccgccagcg gccgcugccaagcuuccgagcucaagcuucgaauucugcagucgacggua ccgcgggcccgggauccauaaggagcauaaaaauagccAUGGCUAAAAAU ACCACGAAUAGACACUAUUCGCUUAGAAAAUUAAAAACAGGAACGGCUUC AGUAGCAGUAGCUUUGACUGUUUUAGGGACAGGACUGGUAGCAGGGCAGA CAGUAAAAGCAAGCCAAACAGAACCAUCUCAGACCAAUAACAGAUUAUAU CAAGAAAGACAACGUUUACAGGAUUUAAAAAGUAAGUUUCAAGACCUGAA AAAUCGUUCAGAGGGAUACAUUCAGCAAUACUACGACGAAGAAAAGAACA GUGGAAGUAACUCUAACUGGUACGCAACCUACUUAAAAGAAUUAAAUGAC GAAUUUGAACAAGCUUAUAAUGAACUUAGUGGUGAUGGUGUAAAAAAAUU AGCUGCAAGUUUGAUGGAAGAAAGAGUCGCUUUAAGAGACGAAAUCGAUC AGAUUAAGAAAAUAUCAGAAGAAUUAAAAAAUAAGCUGAGAGCAAAAGAA GAAGAAUUAAAAAAUAAAAAAGAGGAACGUGAGCUUGAGCAUGCUGCCUA UGCAGCAGAUGCAAAGAAACAUGAAGAAUAUGUCAAAUCCAUGUCUCUCG UACUAAUGGAUAAAGAAGAGGAGCGUCAUAAACUAGAGCAAUCAUUAGAC ACGGCUAAAGCUGAGCUUGUUAAAAAAGAGCAAGAGUUACAGUUAGUCAA AGGCAAUCUAGAUCAAAAAGAAAAAGAACUAGAAAAUGAAGAGCUAGCGA AAGAAAGUGCUAUUAGUGAUUUGACUGAGCAGAUUACUGCUAAGAAGGCU GAAGUAGAAAAAUUAACUCAAGAUUUAGCUGCUAAGUCUGCUGAAAUUCA GGAAAAAGAAGCUGAAAAAGAUCGCCAACAGCAUAUGUACGAAGCGUUUA UGAGCCAGUACAAAGAAAAAGUUGAGAAACAAGAGCAAGAGCUUGCUAAG CUAAAACAACUUGAAACCAUCAACAACAAUCUAUUAGGUAAUGCUAAGGA UAUGAUAGCUAAGUUGUCUGCUGAAAAUGAACAAUUAGCAAGCGACAAAG CAAAACUUGAAGAACAAAACAAGAUUUCAGAAGCGAGCCGUAAAGGUCUU CGUCGUGACUUGGACGCAUCACGUGAAGCUAAGAAACAAGUUGAAAAAGA UUUAGCAAACUUGACUGCUGAACUUGAUAAGGUUAAAGAAGAUAAACAAA UUUCAGACGCAAGCCGUAAAGGUCUUCGUCGUGACUUGGACGCAUCACGU GAAGCUAAGAAACAAGUUGAAAAAGCUUUAGAAGAAGCAAACAGCAAAUU AGCGGCUCUUGAAAAACUUAACAAAGAGCUUGAAGAAAGCAAGAAAUUAA CAGAAAAAGAAAAAGCUGAGCUACAAGCGAAACUUGAAGCAGAAGCAAAA GCACUCAAAGAACAAUUAGCGAAACAAGCUGAAGAACUUGCAAAACUAAG AGCUGGAAAAGCAUCAGACUCACAAACCCCUGAUGCAAAACCAGGAAACA AAGUUGUUCCAGGUACAGGUCAAGCACCACAAGCAGGCACAAAACCUAAC CAAAACAAAGCACCAAUGAAGGAAACUAAGAGACAGUUACCAUCAACAGG UGAAGCAGCUAAUCCAUUCUUUACAGCGGCAGCCCUUACUGUUAUGGCAA CAGCUGGAGUAGCAGCAGUUGUAAAACGCAAAGAAGAAAACGAAGCUGAA UUCUGCAGAUAUCCAUCACACUGGCGGCCGCGACUCUAGuaaugacucga g (a.sup.50-200)
[0192] SEQ ID NO: 14 (Predicted protein sequence of examples 23-25). One letter predicted amino acid sequence of emmL transcripts produced in examples 2-4. * indicates stop codon.
TABLE-US-00027 MAKNTTNRHYSLRKLKTGTASVAVALTVLGTGLVAGQTVKASQTEPSQTN NRLYQERQRLQDLKSKFQDLKNRSEGYIQQYYDEEKNSGSNSNWYATYLK ELNDEFEQAYNELSGDGVKKLAASLMEERVALRDEIDQIKKISEELKNKL RAKEEELKNKKEERELEHAAYAADAKKHEEYVKSMSLVLMDKEEERHKLE QSLDTAKAELVKKEQELQLVKGNLDQKEKELENEELAKESAISDLTEQIT AKKAEVEKLTQDLAAKSAEIQEKEAEKDRQQHMYEAFMSQYKEKVEKQEQ ELAKLKQLETINNNLLGNAKDMIAKLSAENEQLASDKAKLEEQNKISEAS RKGLRRDLDASREAKKQVEKDLANLTAELDKVKEDKQISDASRKGLRRDL DASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLE AEAKALKEQLAKQAEELAKLRAGKASDSQTPDAKPGNKVVPGTGQAPQAG TKPNQNKAPMKETKRQLPSTGEAANPFFTAAALTVMATAGVAAVVKRKEE NEAEFCRYPSHWRPRL*
[0193] SEQ ID NO: 15 (RNA sequence of example 24). Synthetic mRNA sequence following in vitro mRNA synthesis of emmL from the pT7XLURT plasmid template linearized with restriction endonuclease BamHI, written from 5′ to 3′ with respect to the mRNA molecule. An anti-reverse cap analog (ARCA) is added to the 5′ end of the transcript and approximately 50-200 adenosine monophosphates)(a.sup.50-200) are added to the 3′ end of the transcript during in vitro transcription. The guanine (g) immediately after the ARCA cap is the +1 ribonucleotide produced by T7 RNA polymerase. 5′ lowercase letters are from the 5′ untranslated region of the Xenopus laevis beta globin gene. Bold indicates ribonucleotides added to make an optimal translation initiation sequence. A SacI restriction endonuclease site 5′ of the emmL coding region is underlined. Uppercase letters indicate the coding sequence of emmL. Lowercase letters 3′ of the coding region are the 3′ untranslated region of the Xenopus laevis beta globin gene. At the 3′ end of the mRNA sequence, bold indicates two additional stop codons. SpeI and BamHI restriction endonuclease sites are underlined.
TABLE-US-00028 gaagcuucuuguucuuuuugcagaagcucagaauaaacgcucaacuuugg cgagcucauagccAUGGCUAAAAAUACCACGAAUAGACACUAUUCGCUUA GAAAAUUAAAAACAGGAACGGCUUCAGUAGCAGUAGCUUUGACUGUUUUA GGGACAGGACUGGUAGCAGGGCAGACAGUAAAAGCAAGCCAAACAGAACC AUCUCAGACCAAUAACAGAUUAUAUCAAGAAAGACAACGUUUACAGGAUU UAAAAAGUAAGUUUCAAGACCUGAAAAAUCGUUCAGAGGGAUACAUUCAG CAAUACUACGACGAAGAAAAGAACAGUGGAAGUAACUCUAACUGGUACGC AACCUACUUAAAAGAAUUAAAUGACGAAUUUGAACAAGCUUAUAAUGAAC UUAGUGGUGAUGGUGUAAAAAAAUUAGCUGCAAGUUUGAUGGAAGAAAGA GUCGCUUUAAGAGACGAAAUCGAUCAGAUUAAGAAAAUAUCAGAAGAAUU AAAAAAUAAGCUGAGAGCAAAAGAAGAAGAAUUAAAAAAUAAAAAAGAGG AACGUGAGCUUGAGCAUGCUGCCUAUGCAGCAGAUGCAAAGAAACAUGAA GAAUAUGUCAAAUCCAUGUCUCUCGUACUAAUGGAUAAAGAAGAGGAGCG UCAUAAACUAGAGCAAUCAUUAGACACGGCUAAAGCUGAGCUUGUUAAAA AAGAGCAAGAGUUACAGUUAGUCAAAGGCAAUCUAGAUCAAAAAGAAAAA GAACUAGAAAAUGAAGAGCUAGCGAAAGAAAGUGCUAUUAGUGAUUUGAC UGAGCAGAUUACUGCUAAGAAGGCUGAAGUAGAAAAAUUAACUCAAGAUU UAGCUGCUAAGUCUGCUGAAAUUCAGGAAAAAGAAGCUGAAAAAGAUCGC CAACAGCAUAUGUACGAAGCGUUUAUGAGCCAGUACAAAGAAAAAGUUGA GAAACAAGAGCAAGAGCUUGCUAAGCUAAAACAACUUGAAACCAUCAACA ACAAUCUAUUAGGUAAUGCUAAGGAUAUGAUAGCUAAGUUGUCUGCUGAA AAUGAACAAUUAGCAAGCGACAAAGCAAAACUUGAAGAACAAAACAAGAU UUCAGAAGCGAGCCGUAAAGGUCUUCGUCGUGACUUGGACGCAUCACGUG AAGCUAAGAAACAAGUUGAAAAAGAUUUAGCAAACUUGACUGCUGAACUU GAUAAGGUUAAAGAAGAUAAACAAAUUUCAGACGCAAGCCGUAAAGGUCU UCGUCGUGACUUGGACGCAUCACGUGAAGCUAAGAAACAAGUUGAAAAAG CUUUAGAAGAAGCAAACAGCAAAUUAGCGGCUCUUGAAAAACUUAACAAA GAGCUUGAAGAAAGCAAGAAAUUAACAGAAAAAGAAAAAGCUGAGCUACA AGCGAAACUUGAAGCAGAAGCAAAAGCACUCAAAGAACAAUUAGCGAAAC AAGCUGAAGAACUUGCAAAACUAAGAGCUGGAAAAGCAUCAGACUCACAA ACCCCUGAUGCAAAACCAGGAAACAAAGUUGUUCCAGGUACAGGUCAAGC ACCACAAGCAGGCACAAAACCUAACCAAAACAAAGCACCAAUGAAGGAAA CUAAGAGACAGUUACCAUCAACAGGUGAAGCAGCUAAUCCAUUCUUUACA GCGGCAGCCCUUACUGUUAUGGCAACAGCUGGAGUAGCAGCAGUUGUAAA ACGCAAAGAAGAAAACGAAGCUGAAUUCUGCAGAUAUCCAUCACACUGGC GGCCGCGACUCUAGuaaugaacuagucuuuuugaugccauugccgacgcc cuuggcaaggguuaccacuaaaccagccucaagaacacccgaauggaguc ggaucc (a.sup.50-200)
[0194] SEQ ID NO: 16 (RNA sequence of example 24). Synthetic mRNA sequence following in vitro mRNA synthesis of emmL from a plasmid template, written from 5′ to 3′ with respect to the mRNA molecule. An anti-reverse cap analog (ARCA) is added to the 5′ end of the transcript and approximately 50-200 adenosine monophosphates)(a.sup.50-200) are added to the 3′ end of the transcript during in vitro transcription. The guanine (g) immediately after the ARCA cap is the +1 ribonucleotide produced by T7 RNA polymerase. Bold indicates ribonucleotides added to make an optimal translation initiation sequence. Uppercase letters indicate the coding sequence of emmL. At the 3′ end of the mRNA sequence, bold indicates two additional stop codons. The 3′ XhoI site is underlined.
TABLE-US-00029 gauagccAUGGCUAAAAAUACCACGAAUAGACACUAUUCGCUUAGAAAAU UAAAAACAGGAACGGCUUCAGUAGCAGUAGCUUUGACUGUUUUAGGGACA GGACUGGUAGCAGGGCAGACAGUAAAAGCAAGCCAAACAGAACCAUCUCA GACCAAUAACAGAUUAUAUCAAGAAAGACAACGUUUACAGGAUUUAAAAA GUAAGUUUCAAGACCUGAAAAAUCGUUCAGAGGGAUACAUUCAGCAAUAC UACGACGAAGAAAAGAACAGUGGAAGUAACUCUAACUGGUACGCAACCUA CUUAAAAGAAUUAAAUGACGAAUUUGAACAAGCUUAUAAUGAACUUAGUG GUGAUGGUGUAAAAAAAUUAGCUGCAAGUUUGAUGGAAGAAAGAGUCGCU UUAAGAGACGAAAUCGAUCAGAUUAAGAAAAUAUCAGAAGAAUUAAAAAA UAAGCUGAGAGCAAAAGAAGAAGAAUUAAAAAAUAAAAAAGAGGAACGUG AGCUUGAGCAUGCUGCCUAUGCAGCAGAUGCAAAGAAACAUGAAGAAUAU GUCAAAUCCAUGUCUCUCGUACUAAUGGAUAAAGAAGAGGAGCGUCAUAA ACUAGAGCAAUCAUUAGACACGGCUAAAGCUGAGCUUGUUAAAAAAGAGC AAGAGUUACAGUUAGUCAAAGGCAAUCUAGAUCAAAAAGAAAAAGAACUA GAAAAUGAAGAGCUAGCGAAAGAAAGUGCUAUUAGUGAUUUGACUGAGCA GAUUACUGCUAAGAAGGCUGAAGUAGAAAAAUUAACUCAAGAUUUAGCUG CUAAGUCUGCUGAAAUUCAGGAAAAAGAAGCUGAAAAAGAUCGCCAACAG CAUAUGUACGAAGCGUUUAUGAGCCAGUACAAAGAAAAAGUUGAGAAACA AGAGCAAGAGCUUGCUAAGCUAAAACAACUUGAAACCAUCAACAACAAUC UAUUAGGUAAUGCUAAGGAUAUGAUAGCUAAGUUGUCUGCUGAAAAUGAA CAAUUAGCAAGCGACAAAGCAAAACUUGAAGAACAAAACAAGAUUUCAGA AGCGAGCCGUAAAGGUCUUCGUCGUGACUUGGACGCAUCACGUGAAGCUA AGAAACAAGUUGAAAAAGAUUUAGCAAACUUGACUGCUGAACUUGAUAAG GUUAAAGAAGAUAAACAAAUUUCAGACGCAAGCCGUAAAGGUCUUCGUCG UGACUUGGACGCAUCACGUGAAGCUAAGAAACAAGUUGAAAAAGCUUUAG AAGAAGCAAACAGCAAAUUAGCGGCUCUUGAAAAACUUAACAAAGAGCUU GAAGAAAGCAAGAAAUUAACAGAAAAAGAAAAAGCUGAGCUACAAGCGAA ACUUGAAGCAGAAGCAAAAGCACUCAAAGAACAAUUAGCGAAACAAGCUG AAGAACUUGCAAAACUAAGAGCUGGAAAAGCAUCAGACUCACAAACCCCU GAUGCAAAACCAGGAAACAAAGUUGUUCCAGGUACAGGUCAAGCACCACA AGCAGGCACAAAACCUAACCAAAACAAAGCACCAAUGAAGGAAACUAAGA GACAGUUACCAUCAACAGGUGAAGCAGCUAAUCCAUUCUUUACAGCGGCA GCCCUUACUGUUAUGGCAACAGCUGGAGUAGCAGCAGUUGUAAAACGCAA AGAAGAAAACGAAGCUGAAUUCUGCAGAUAUCCAUCACACUGGCGGCCGC GACUCUAGuaaugacucgag (a.sup.50-200).
Example 26
[0195] Codons in the emm55 gene encoding an immunogenic polypeptide were optimized to improve expression in transfected human cells. Three synthetic human codon optimized DNAs (SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19) were used as templates to transcribe human codon optimized RNAs which expressed the EmmL polypeptide (SEQ ID NO:14) in transfected human and mouse cancer cells.
[0196] Codon optimization is a synonymous codon exchange in an encoded gene which does not change the amino acid identity or sequence of the expressed protein. Exchanging codons preferred in human cells with codons for the same amino acid in bacterial genes can lead to increased production and stability of the expressed protein in transfected human cells. In this example, codon optimization was carried out with pAc/emmL (
[0197] The nucleic acid sequence of the DNA encoding bacterial polypeptide EmmL was optimized for expression in human cells. Substitution of human preferred codons was carried out using algorithms that substituted codons preferred for expression in human cells but were different from codons for the same amino acid encoded in the bacterial emmL gene. Each of the three human codon optimized RNAs expressed the EmmL polypeptide SEQ ID NO:14 in transfected cells. The maximally optimized (0.95) codon adapted mRNA for expression in human cells expressed the EmmL protein most efficiently and in greater amounts compared to the 0.82 and 0.28 codon adapted mRNAs. The expressed polynucleotide was the same as expressed from the corresponding non codon humanized emmL DNA.
[0198] The polypeptide expressed in transfected cells by the human codon optimized RNAs had better stability and expression in human cancer cells compared to mouse cancer cells. As shown in
[0199] Codon optimization algorithms were also used to synthesize emm55 mRNAs. Emm55 expression was measured and compared to determine relative increase protein synthesis and stability in mammalian cells. Each mRNA was synthesized in vitro using wild type uridine (WT) and N1-methylpseudouridine (N1) was shown to improve protein expression.
[0200] Three different algorithms were used to optimize the nucleotide sequence of emm55 from expression in Streptococcus pyogenes to expression in humans. Codon optimization was carried out using the JCat algorithm (Grote 2005) and two proprietary algorithms run by the Karolinska Institute (FreqDist and MostFreq). mRNAs designed by these three algorithms were synthesized by TriLink® Biotechnologies in vitro using both wild type (WT) uridine and chemically modified N1-methyl pseudouridine (N1), which can increase mRNA stability and protein expression levels in vitro (Svitkin 2017) and in vivo (Pardi 2015). The final nucleotide sequence for each mRNA is shown as SEQ ID NO: 17, SEQ ID NO: 18 and SEQ ID NO: 19. As a part of the design, BbsI and BspQI restriction endonuclease sites were removed by base substitution from emm55JCat and emm55MostFreq to facilitate cloning into the TriLink® plasmid vector used to synthesize mRNA in vitro.
[0201] mRNAs were received with each tube of mRNA supplied by TriLink® Biotechnologies and added as a stock item so that each tube could be tracked independently. mRNAs were stored at −80° C. Quality control testing was carried out to verify purity and intactness using RD 3-75.1, except that mRNAs were aliquoted by TriLink® Biotechnologies rather than as specified in the SOP (standard operating procedure).
[0202] mRNAs were transiently transfected into the attachment enhanced HEK subline HEK293T-AE and B16-F10 cells using RD 3-79.1 (2.5 μg mRNA/well). Cells were transfected with pAc/emm55 using RD 3-34.2 (4 μg pDNA/well). Two to 48 hours post transfection, cells were lysed in RIPA buffer using RD 3-83.1 and the protein concentrations of the lysates was determined by BCA assay using RD 3-14.2.
[0203] EGFP mRNA and pDNA were used as transfection positive controls and Emm55 expression negative controls. Initially, lysates were resolved using denaturing SDS-PAGE, western blotted, stained with chicken anti-Emm55 and detected using chemiluminescence using RD 3-74.1. The band corresponding in size to Emm55 consistently overwhelmed the peroxidase detection reaction, resulting in bands that could not be quantified. No suitable dilution of chicken anti-Emm55 or goat anti-chicken-horseradish peroxidase could be identified to increase the high end of the detection range. For this reason, Emm55 protein detection was carried out using the ProteinSimple Wes™ capillary electrophoresis system using chicken anti-Emm55. This system resolves protein and protein/antibody complexes in a reducing SDS-PAGE capillary tube to provide antibody binding quantification like western blot data. These assays were carried out using manufacturer-supplied protocol.
[0204] The Wes™ assay measured the level of Emm55 in cell lysate normalized to the level of ERK1, a serine/threonine kinase that is regulated by phosphorylation rather than protein level, and thus makes a suitable protein for data normalization within a cell or tissue type. This approach has an advantage over internal total protein normalization, as it can be multiplexed with Emm55 detection, providing a sample loading control and cutting in half the number of sample assays that need to be performed. To establish the linearity of this assay, a standard curve was constructed with 10 ng to 30 pg rEmm55 in 1.5 μg untransfected HEK293T-AE lysate. Antibody dilutions for the Wes™ assay were; chicken anti-Emm55 at 1:100 and goat anti-chicken-HRP at 1:100.
[0205] The Wes™ assay assembly instructions refer to input protein concentration rather than mass. Experiments using the Wes™ were carried out using cell lysates at 0.1, 0.25 and 0.5 μg/μL. While 0.5 μg/μL gave results within the Wes™ dynamic range with B16-F10 cell lysates, 0.25 and 0.5 HEK293T lysates generated expression levels that exceeded the detection capacity at peak expression time points. A concentration of 0.1 μg/μL lysate was found to be optimal throughout the time course, although lower concentrations could be used to provide additional dynamic range when high level expression is anticipated. However, this lower input concentration may miss low but biologically meaningful levels of expression, especially at early and late time points.
[0206] Data normalization was carried out by dividing the Wes™ numerical output value for Emm55 by the output value for ERK1. In experiments with data replication, normalization was carried out on individual samples then mean±standard deviation values (n=3) were calculated. At one timepoint (0.1 μg/μL emm55JCat-WT 12 hrs post transfection), an anomalously low ERK1 level resulted in a single dropped normalized datapoint based on Grubbs' Extreme Studentized Deviate test. In this case the mean was calculated from the remaining two replica data points. A one-way ANOVA with both Bonferroni post-hoc test was performed using GraphPad Prism software to determine significant differences between means. Significant findings were confirmed using the Tukey post-hoc test.
[0207] A codon adaptiveness index (CAI) was calculated using the JCat algorithm for each codon of emm55. This algorithm returns a score of 1.0 if the mRNA sequence is perfectly optimized for translation in human cells.
[0208] Results showed that codon modified emm55 mRNA drives robust expression of Emm55 polypeptide following transient transfection of human HE293T cells and murine B16-F10 melanoma cells in vitro. A comparison of protein levels to levels of transfection with pAc/emm55 (the DNA) is not quantitative since a single copy of pDNA gives rise to many copies of mRNA but did show that WT and N1-modified emm55JCat expressed significantly higher levels of Emm55 in HEK293 cells between 4- and 12-hours post transfection. Peak Emm55 expression from emm55JCat mRNA was approximately 12 hours post-transfection and was detected at 48 hours.