Compounds

Abstract

A compound of formula (I), or a pharmaceutical salt thereof:

##STR00001##

Claims

1-20. (canceled)

21. A compound of formula (I), or a pharmaceutically acceptable salt thereof: ##STR00384## wherein: R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are independently selected from the group consisting of: (i) H; (ii) C.sub.1-3 alkyl, optionally substituted by: hydroxy, C.sub.1-2 alkoxy, optionally substituted by one or more fluoro groups, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4 alkyl carbamoyl, acylamido, or one or more fluoro groups; (iii) C.sub.1-3 alkoxy, optionally substituted by C.sub.3-6 cycloalkyl or by one or more fluoro groups; (iv) C.sub.3-6 cycloalkyl; (v) halo; (vi) COR.sup.C, where R.sup.C is selected from NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and methyl; (vii) cyano, NH.sub.2, or NO.sub.2; and (viii) phenyl or C.sub.5-6 heteroaryl, optionally substituted by methyl, cyano, hydroxy or methoxy; and Ar is a phenyl, napthyl or C.sub.5-10 heteroaryl group, optionally substituted by one or more groups selected from the group consisting of: (i) C.sub.1-4 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, C.sub.1-4 alkyl carbamoyl, or by one or more fluoro groups; (ii) C.sub.3-6 cycloalkyl; (iii) hydroxy; cyano; NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl; or acylamido; (iv) halo; (v) C.sub.1-3 alkoxy, optionally substituted by hydroxy, C(O)NH.sub.2, C.sub.3-6 cycloalkyl, phenyl, C.sub.5-6 heteroaryl, or by one or more fluoro groups; (vi) phenoxy, optionally substituted by fluoro; (vii) phenyl or C.sub.5-6 heteroaryl; (viii) SF.sub.5 or SO.sub.2CH.sub.3; (ix) —(CH.sub.2).sub.n—Y—, where Y is O or CH.sub.2, and n is 2 or 3; and (x) C.sub.1-4 alkyl ester.

22. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is not H.

23. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.1-3 alkyl, optionally substituted by: hydroxy, C.sub.1-2 alkoxy, optionally substituted by one or more fluoro groups, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4 alkyl carbamoyl, acylamido, or one or more fluoro groups.

24. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.1-3 alkoxy, optionally substituted by C.sub.3-6 cycloalkyl or one of more fluoro groups.

25. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.3-6 cycloalkyl.

26. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is halo.

27. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is COR.sup.C, where R.sup.C is selected from NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and methyl.

28. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is cyano, NH.sub.2 or NO.sub.2.

29. The compound or salt of claim 21, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is phenyl or C.sub.5-6 heteroaryl, optionally substituted by methyl, cyano, hydroxy or methoxy.

30. The compound or salt of claim 21, wherein: (a) R.sup.4 is methoxy, R.sup.2 is CH.sub.2OCH.sub.3 or CH.sub.2OCH.sub.2CH.sub.3, and R.sup.1 and R.sup.3 are H; (b) R.sup.4 is methoxy, R.sup.2 is phenyl, optionally substituted by methyl or methoxy, and R.sup.1 and R.sup.3 are H; (c) R.sup.4 is methoxy, R.sup.2 is C.sub.5-6 heteroaryl, optionally substituted by methyl; (d) R.sup.4 is methoxy and R.sup.1, R.sup.2 and R.sup.3 are H; (e) R.sup.4 is chloro, R.sup.2 is C.sub.1-3 alkyl or bromo, and R.sup.1 and R.sup.3 are H; (f) R.sup.4 is chloro and R.sup.1, R.sup.2 and R.sup.4 are H; or (g) R.sup.3 is C.sub.1-3 alkyl and R.sup.1, R.sup.2 and R.sup.4 are H.

31. The compound or salt of claim 21, wherein Ar is: (a) phenyl, which may be optionally substituted; (b) napthyl, which may be optionally substituted; or (c) a C.sub.5-10 heteroaryl group, which may be optionally substituted.

32. The compound or salt of claim 31, wherein: (a) Ar is substituted by C.sub.1-4 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, C.sub.1-4 alkyl carbamoyl, or one or more fluoro groups; (b) Ar is substituted by C.sub.3-6 cycloalkyl; (c) Ar is substituted by hydroxy; cyano; NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl; or acylamido; or (d) Ar is substituted by halo.

33. The compound or salt of claim 31, wherein Ar is substituted by C.sub.1-3 alkoxy, optionally substituted by hydroxy, C(O)NH.sub.2, C.sub.3-6 cycloalkyl, phenyl, C.sub.5-6 heteroaryl, or one of more fluoro groups.

34. The compound or salt of claim 31, wherein: (a) Ar is substituted by phenoxy, optionally substituted by fluoro; (b) Ar is substituted by phenyl or C.sub.5-6 heteroaryl; (c) Ar is substituted by SF.sub.5 or SO.sub.2CH.sub.3, (d) Ar is substituted by —(CH.sub.2).sub.n—Y—, where Y is O or CH.sub.2, and n is 2 or 3; or (e) Ar is substituted by C.sub.1-4 alkyl ester.

35. The compound or salt of claim 21, wherein Ar is represented by the formula (Ar-1): ##STR00385## where Y is either N or C—R.sup.A4, and Z is either N or C—R.sup.A5; and R.sup.A1, R.sup.A2, R.sup.A3, R.sup.A4 (if present) and R.sup.A5 (if present) are independently selected from H and the optional substituents for Ar.

36. The compound or salt of claim 35, wherein: (a) R.sup.A2 is ethyl; or (b) R.sup.A3 is selected from cycloalkyl; phenoxy; phenyl; C.sub.5-6 heteroaryl; SF.sub.5; and SO.sub.2CH.sub.3.

37. The compound or salt of claim 21, wherein Ar is: (a) 5-ethyl-2-methoxyphenyl; (b) 5-CF.sub.3-2-methoxyphenyl; or (c) 2,6-dimethoxyphenyl.

38. The compound or salt of claim 21, with the proviso that when: R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, Ar is not 4-aminophenyl.

39. The compound or salt of claim 21, wherein: (a) at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is not H; (b) R.sup.3 is not CF.sub.3; (c) R.sup.3 is not substituted C.sub.1-3 alkyl; (d) R.sup.3 is ethyl or propyl; (e) R.sup.3 is not C.sub.1-3 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4 alkyl carbamoyl, acylamido or by one or more fluoro groups; (f) R.sup.4 is methoxy; (g) R.sup.4 is Cl, and R.sup.1, R.sup.2 and R.sup.3 are H; (h) R.sup.4 is Cl, and R.sup.2 is C.sub.1-3 alkyl or bromo, and R.sup.1 and R.sup.3 are H; or (i) R.sup.3 is C.sub.1-3 alkyl and R.sup.1, R.sup.2 and R.sup.4 are H.

40. A compound according to claim 21, with the proviso that when: (a) R.sup.1, R.sup.2 and R.sup.3 are H, and R.sup.4 is methoxy, Ar is not unsubstituted napthyl; (b) R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, Ar is not 2,4,6-trimethylphenyl; (c) R.sup.1, R.sup.2 and R.sup.4 are H, and R.sup.3 is CF.sub.3, Ar is not 2-(difluromethoxy)phenyl; (d) R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, Ar is not 4-fluoro-3-methyl-phenyl; or (e) R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, Ar is not 4-aminophenyl.

Description

EXAMPLES

[0270] The following examples are provided solely to illustrate the present invention and are not intended to limit the scope of the invention, as described herein.

Acronyms

[0271] For convenience, many chemical moieties are represented using well known abbreviations, including but not limited to, methyl (Me), ethyl (Et), N-propyl (nPr), isopropyl (iPr), N-butyl (nBu), tert-butyl (tBu), phenyl (Ph), benzyl (Bn), methoxy (MeO), ethoxy (EtO), trimethylsilyl (TMS), and acetyl (Ac).

[0272] For convenience, many chemical compounds are represented using well known abbreviations, including but not limited to, methanol (MeOH), deuterated methanol (methanol-d.sub.4) ethanol (EtOH), isopropanol (i-PrOH), ethyl acetate (EtOAc), acetic acid (AcOH), acetonitrile (MeCN or ACN), dichloromethane (methylene chloride, DCM), trifluoroacetic acid (TFA), N,N-dimethylformamide (DMF), tetrahydrofuran (THF), dimethylsulfoxide (DMSO), N-methyl-2-pyrrolidone (NMP), deuterated acetone (acetone-d.sub.6), deuterated chloroform (CDCl), deuterated dimethylsulfoxide (DMSO-d.sub.6), 1,1bis(diphenylphosphino)ferrocene (dppf), triethylamine (Et.sub.3N or TEA), N,N-diisopropylethylamine (DIPEA or DIEA), 1,1bis(diphenylphosphino)ferrocene dichloropalladium (II) (PdCl.sub.2(dppf)), trans-dichlorobis(triphenylphosphine)palladium(II) (PdCl.sub.2(PPh.sub.3).sub.2), tris(dibenzylideneacetone) dipalladium(0) (Pd.sub.2(dba).sub.3), tetrakis(triphenylphosphine)palladium(0) (Pd(PPh.sub.3).sub.4), 2,4-dimethoxybenzyl (DMB), petroleum ether (Pet. ether), lithium bis(trimethylsilyl)amide (LHMDS or LiHMDS), potassium bis(trimethylsilyl)amide (KHMDS), sodium bis(trimethylsilyl)amide (NaHMDS), n-butyllithium (n-BuLi), N-bromosuccinimide (NBS), N-chlorosuccinimide (NCS), pyridinium p-toluenesulfonate (PPTS), azobisisobutyronitrile (AIBN), tetramethylethylenediamine (TMEDA), tert-butyldimethylsilyl chloride (TBSCl), tetra-n-butylammonium fluoride (TBAF), and diisopropyl azodicarboxylate (DIAD).

[0273] In addition, TLC refers to thin layer chromatography.

[0274] Other abbreviations: retention time (rt or R.sub.t), minute(s) (min), hour(s) (h), room temperature (RT), concentrated (conc.), atmosphere (atm), aqueous (aq.), saturated (sat.), eq. (equivalent(s)).

General Experimental Details

[0275] Unless otherwise stated the following generalisations apply. .sup.1H NMR spectra were recorded on a Bruker Ultrashield Plus (400 MHz) or a Bruker AVANCE III (400 MHz). The multiplicity of a signal is designated by the following abbreviations: s, singlet; d, doublet; t, triplet; q, quartet; p, pentet; dd, doublet of doublets; dt, doublet of triplets; tt, triplet of triplets; br, broad; m, multiplet. All observed coupling constants, J, are reported in Hertz (Hz). Exchangeble protons are not always observed.

[0276] LCMS data was generated using either an Agilent 6100 Series Single Quad (LCMS-A), an Agilent 1260 Infinity Series UPLC/MS (LCMS-B), an Agilent 1200 (LCMS-C and LCMS-D), a Waters 2695 alliance (LCMS-E), an Agilent 6120 Single Quad (LCMS-F) or mass-directed HPLC-MS. Chlorine isotopes are reported as .sup.3Cl, Bromine isotopes are reported as either .sup.79Br or .sup.81Br or both .sup.79Br/.sup.81Br.

LCMS Method A (LCMS-A):

Instrument: Agilent 6100 Series Single Quad LC/MS

Agilent 1200 Series HPLC

[0277] Pump: 1200 Series G1311A Quaternary pump

Autosampler: 1200 Series G1329A Thermostatted Autosampler

Detector: 1200 Series G1314B Variable Wavelength Detector

LC Conditions:

[0278] Reverse Phase HPLC analysis

Column: Luna C8 (2) 5 μm 50×4.6 mm 100 Å

[0279] Column temperature: 30° C.

Injection Volume: 5 μL

Solvent A: Water 0.1% Formic Acid

Solvent B: MeCN 0.1% Formic Acid

[0280] Gradient: 5-100% solvent B over 10 min

Detection: 254 nm or 214 nm

Ms Conditions:

Ion Source: Quadrupole

Ion Mode: Multimode-ES

[0281] Drying gas temp: 300° C.
Vaporizer temperature: 200° C.
Capillary voltage (V): 2000 (positive)
Capillary voltage (V): 4000 (negative)

Scan Range: 100-1000

[0282] Step size: 0.1 sec
Acquisition time: 10 min

LCMS Method B (LCMS-B):

Instrument: Agilent 1260 Infinity Series UPLC/MS

[0283] Pump: 1260 Infinity G1312B Binary pump

Autosampler: 1260 Infinity G1367E 1260 HiP ALS

Detector: 1290 Infinity G4212A 1290 DAD

LC Conditions:

[0284] Reverse Phase HPLC analysis

Column: Poroshell 120 EC-C18 2.7 μm 50×3.0 mm

[0285] Column temperature: 35° C.

Injection Volume: 1 μL

Solvent A: Water 0.1% Formic Acid

Solvent B: MeCN 0.1% Formic Acid

[0286] Gradient: 5-100% solvent B over 3.8 min
Detection: monitored at 254 nm and 214 nm

MS Conditions:

Ion Source: Quadrupole

Ion Mode: API-ES

[0287] Drying gas temp: 350° C.
Capillary voltage (V): 3000 (positive)
Capillary voltage (V): 3000 (negative)

Scan Range: 100-1000

[0288] Step size: 0.1 sec
Acquisition time: 5 min

LCMS Method C (LCMS-C):

[0289] LC model: Agilent 1200
(Pump type: Binary Pump, Detector type: DAD)
MS model: Agilent G6110A Quadrupole

LC Conditions:

Column: Xbridge-C18, 2.5 μm, 2.1×30 mm

[0290] Column temperature: 30° C.
Acquisition of wavelength: 214 nm, 254 nm
Mobile phase: A: 0.07% HCOOH aqueous solution, B: MeOH

MS Conditions:

[0291] MS: Ion source: ES+ (or ES−) MS range: 50-900 m/z
Fragmentor: 60 Drying gas flow: 10 L/min
Nebulizer pressure: 35 psi Drying gas temperature: 350° C.

Vcap: 3.5 kV

[0292]

TABLE-US-00002 Gradient Table: Flow (mL/min) T (min) A (%) B (%) 0.5 0.0 70 30 0.5 0.2 70 30 0.5 1.8 5 95 0.5 2.4 5 95 0.5 2.6 70 30 0.5 3.5 70 30

Sample Preparation:

[0293] The sample was dissolved in methanol, the concentration about 0.11-1 mg/mL, then filtered through syringe filter with 0.22 μm. (Injection volume: 1-10 μL)

LCMS Method D (LCMS-D):

[0294] LC model: Agilent 1200
(Pump type: Binary Pump, Detector type: DAD)
MS model: Agilent G6110A Quadrupole

LCMS Conditions:

LC: Column: Xbridge-C18, 2.5 μm, 2.1×30 mm

[0295] Column temperature: 30° C.
Acquisition of wavelength: 214 nm, 254 nm
Mobile phase: A: 0.07% HCOOH aqueous solution, B: MeOH

MS Conditions:

[0296] MS: Ion source: ES+(or ES−) MS range: 50-900 m/z
Fragmentor: 60 Drying gas flow: 10 L/min
Nebulizer pressure: 35 psi Drying gas temperature: 350° C.

Vcap: 3.5 kV

[0297]

TABLE-US-00003 Gradient Table: Flow (mL/min) T (min) A (%) B (%) 0.5 0.0 70 30 0.5 0.3 70 30 0.5 0.6 50 50 0.5 0.9 40 60 0.5 1.2 30 70 0.5 3.2 5 95 0.5 3.5 5 95 0.5 4.0 70 30 0.5 5.0 70 30

Sample Preparation:

[0298] The sample was dissolved in methanol, the concentration about 0.11-1 mg/mL, then filtered through the syringe filter with 0.22 μm. (Injection volume: 1-10 μL)

LCMS Method E (LCMS-E):

Equipment Information:

[0299] LC model: Waters 2695 alliance

(Pumptype: Quaternary Pump, Detector: 2996 Photodiode Array Detector)

[0300] MS model: Micromass ZQ

LC Conditions:

LC: Column: Xbridge-C18, 3.5 μm, 2.1×50 mm

[0301] Column temperature: 30° C.
Acquisition of wavelength: 214 nm, 254 nm
Mobile phase: A: 0.07% HCOOH aqueous solution, B: MeOH

MS Conditions:

[0302] MS: Ion source: ES+(or ES−) MS range: 50-900 m/z

Capillary: 3 kV Cone: 3 V Extractor: 3 V

[0303] Drying gas flow: 600 L/hr Cone: 50 L/hr
Desolvation temperature: 300° C.
Source temperature: 100° C.

TABLE-US-00004 Gradient Table: Flow (mL/min) T (min) A (%) B (%) 0.3 0.0 80 20 0.3 0.5 80 20 0.3 0.8 50 50 0.3 1.2 35 65 0.3 2.0 20 80 0.3 4.0 5 95 0.3 5.0 5 95 0.3 5.8 15 85 0.3 6.2 80 20 0.3 8.0 80 20

Sample Preparation:

[0304] The sample was dissolved in methanol, the concentration about 0.11-1 mg/mL, then filtered through the syringe filter with 0.22 μm. (Injection volume: 1-10 μL)

LCMS Method F (LCMS-F)

Instrument: Agilent 6120 Series Single Quad LC/MS

Agilent 1200 Series HPLC

[0305] Pump: 1200 Series G1311A Quaternary pump

Autosampler: 1200 Series G1329A Thermostatted Autosampler

Detector: 1200 Series G1314B Variable Wavelength Detector

LC Conditions:

[0306] Reverse Phase HPLC analysis

Column: Luna C8 (2) 5 μm 50×4.6 mm 100 Å

[0307] Column temperature: 30° C.

Injection Volume: 1-10 μL

Solvent A: Water 0.1% Formic Acid

Solvent B: MeCN 0.1% Formic Acid

[0308] Gradient: 0-95% solvent B over 10 min

Detection: 254 nm or 214 nm

MS Conditions:

Ion Source: Quadrupole

Ion Mode: Multimode-ES & APCI

[0309] Drying gas temp: 250° C.
Vaporizer temperature: 200° C.
Capillary voltage (V): 4000 (positive)
Capillary voltage (V): 4000 (negative)

Scan Range: 100-1000

[0310] Step size: 0.1 sec
Acquisition time: 10 min

Preparative Mass-Directed HPLC

Instrument:

Waters ZQ 3100-Mass Detector

Waters 2545-Pump

Waters SFO System Fluidics Organizer

Waters 2996 Diode Array Detector

Waters 2767 Sample Manager

LC Conditions:

[0311] Reverse Phase HPLC analysis

Column: XBridge TM C18 5 μm 19×50 mm

Injection Volume 500 μL

Solvent A: Water 0.1% Formic Acid

Solvent B: Acetonitrile 0.1% Formic Acid

[0312] Gradient: 25-100% B over 10 min
Flow rate: 19 mL/min

Detection: 100-600 nm

MS Conditions:

Ion Source: Single-quadrupole

[0313] Ion Mode: ES positive

Source Temp: 150° C.

Desolvation Temp: 350° C.

[0314] Detection: Ion counting

Capillary (KV)-3.00

Cone (V): 30

Extractor (V):3

RF Lens (V): 0.1

Scan Range: 100-1000 Amu

Scan Time: 0.5 sec

[0315] Acquisition time: 10 min

Gas Flow

Desolvation L/hour-650

Cone L/hour-100

[0316] Preparative HPLC (Prep. HPLC):
Instrument type: Varian 940-LC series;
Pump type: Quaternary Pump;
Detector type: Diode Array Detector

HPLC Conditions:

[0317] Waters Sunfire prep C18 OBD, 5 μm 19×100 mm column, eluting with a gradient of MeOH in water with 0.07% TFA at a flow rate of 15 mL/min. Acquisition wavelength 214 nm, 254 nm.

[0318] Analytical thin-layer chromatography was performed on Merck silica gel 60 F254 aluminium-backed plates which were visualised using fluorescence quenching under UV light or a basic KMnO.sub.4 dip or Ninhydrin dip.

[0319] Preparative thin-layer chromatography (preparative TLC or prep. TLC) was performed using Tklst (China), grand grade: (HPTLC): 8±2 μm>80%; (TLC): 10-40 μm. Type: GF254. Compounds were visualised by UV (254 nm).

[0320] Column chromatography was performed using a Biotage Isolera purification system using either Grace or RediSep® silica cartridges or with Tklst (China), grand grade, 100-200 meshes silica gel.

[0321] Microwave irradiation was achieved using a CEM Explorer SP Microwave Reactor. Where necessary, anhydrous solvents were purchased from Sigma-Aldrich or dried using conventional methods.

[0322] Unless stated otherwise, acidification was done with concentrated or aqueous solution of HCl.

Additional cartridges used are as follows:

Phase Separator:

Manufacturer: Biotage

[0323] Product: ISOLUTE® Phase Separator (3 mL unless otherwise stated)

Si-Amine Cartridges:

Manufacturer: Biotage

Product: Isolute® NH2, 1 g/6 mL

Or

Manufacturer: Silicycle

Product: Si-amine 500 mg or 1 g

Synthesis of Intermediates

i) 6-(Methoxymethyl)-5-methylbenzo[d]isoxazol-3-amine I4

[0324] ##STR00028##

a) Methyl 4-cyano-5-fluoro-2-methylbenzoate I1

[0325] A mixture of 4-bromo-2-fluoro-5-methylbenzonitrile (3.5 g, 16.4 mmol), Pd(dppf)Cl.sub.2.DCM (668 mg, 0.82 mmol) and Et.sub.3N (5.0 g, 49.1 mmol) in MeOH (80 mL) was heated at 100° C. under a CO atmosphere (0.2 MPa) overnight. Additional Pd(dppf)Cl.sub.2.DCM (340 mg, 0.4 mmol) was added and heating was continued under a CO atmosphere (0.2 MPa) overnight. The catalyst was removed by filtration, washed with MeOH and the filtrate was concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=20/1 to 10/1 to 5/1) to give the title compound (2.4 g, 74%) as a yellow solid. LCMS-D: R.sub.t 2.48 min; m/z 216.1 [M+Na].sup.+.

b) 2-Fluoro-4-(hydroxymethyl)-5-methylbenzonitrile I2

[0326] To a solution of methyl 4-cyano-5-fluoro-2-methylbenzoate I1 (2.4 g, 12.4 mmol) in anhydrous THF (20 mL) at RT under N.sub.2 was added LiBH.sub.4 (2.0 M solution in THF, 12.4 mL, 24.8 mmol) dropwise and the mixture was heated at reflux for 2 h. The reaction was quenched with water (80 mL) and the mixture was extracted with EtOAc (90 mL×3). The combined organic extracts were washed with water (100 mL×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=20/1 to 10/1 to 5/1) to give the title compound (1.6 g, 79%) as a yellow solid. LCMS-D: R.sub.t 1.43 min; m/z 166.1 [M+H].sup.+, 188.1 [M+Na].sup.+.

c) 2-Fluoro-4-(methoxymethyl)-5-methylbenzonitrile I3

[0327] To a solution of 2-fluoro-4-(hydroxymethyl)-5-methylbenzonitrile I2 (800 mg, 8.8 mmol) and iodomethane (3.4 g, 24.2 mmol) in DMF (12 mL) at 0° C. was added NaH (60% w/w dispersion in oil, 379 mg, 9.7 mmol) and the mixture was stirred at 0° C. for 30 min. Water was added and the mixture was extracted with EtOAc (50 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=20/1 to 10/1 to 5/1) to give the title compound (660 mg, 76%) as a yellow solid. LCMS-D: R.sub.t 2.44 min; m/z 180.1 [M+H].sup.+, 202.1.1 [M+Na].sup.+.

d) 6-(Methoxymethyl)-5-methylbenzo[d]isoxazol-3-amine I4

[0328] To a solution of acetohydroxamic acid (792 mg, 10.6 mmol) in anhydrous DMF (20 mL) at 0° C. was added potassium tert-butoxide (1.2 g, 10.6 mmol) and the mixture was stirred at RT for 2 h. 2-Fluoro-4-(methoxymethyl)-5-methylbenzonitrile I3 (630 mg, 3.5 mmol) was then added and the mixture was heated at 60° C. overnight. Water was added and the mixture was extracted with EtOAc (80 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=20/1 to 10/1) to give the title compound (1.0 g, 77%) as a yellow solid. LCMS-D: R.sub.t 1.75 min; m/z 193.1 [M+H].sup.+.

ii) 4-Methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9

[0329] ##STR00029##

a) 4-Bromo-2-fluoro-6-methoxybenzonitrile I5

[0330] To a solution of 4-bromo-2,6-difluorobenzonitrile (6.0 g, 27.5 mmol) in THF (100 mL) was added sodium methanolate (1.5 g, 55.0 mmol) and the mixture was stirred at RT for 48 h. Water was added and the mixture was extracted with EtOAc (150 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=300/1 to 200/1) to give the title compound (4.3 g, 68%) as a white solid. LCMS-D: R.sub.t 2.53 min; m/z 251.8/253.8 [M+Na].sup.+.

b) Methyl 4-cyano-3-fluoro-5-methoxybenzoate I6

[0331] A mixture of 4-bromo-2-fluoro-6-methoxybenzonitrile I5 (4.3 g, 18.7 mmol), Pd(dppf)Cl.sub.2.DCM (768 mg, 0.94 mmol) and Et.sub.3N (5.7 g, 56.1 mmol) in MeOH (50 mL) was heated at 100° C. under a CO atmosphere (0.2 MPa) overnight. The catalyst was removed by filtration, washed with MeOH and the filtrate was concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=200/1 to 50/1) to give the title compound (2.9 g, 74%) as a white solid. LCMS-D: R.sub.t 2.41 min; m/z 210.0 [M+H].sup.+, 232.0 [M+Na].sup.+.

c) 2-Fluoro-4-(hydroxymethyl)-6-methoxybenzonitrile I7

[0332] To a solution of LiBH.sub.4 (2.0 M solution in THF, 13.9 mL, 27.8 mmol) in anhydrous THF (60 mL) at RT under N.sub.2 was added a solution of methyl 4-cyano-3-fluoro-5-methoxybenzoate I1 (2.9 g, 13.9 mmol) in anhydrous THF (10 mL) dropwise and the mixture was heated at reflux for 1 h. The reaction was quenched with 1 M aq. HCl and extracted with EtOAc (100 mL×3). The combined organic extracts were washed with water (100 mL×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated to give the title compound (2.5 g, 100%) as a white solid. LCMS-D: R.sub.t 2.31 min; m/z 182.1 [M+H].sup.+, 204.1 [M+Na].sup.+.

d) 2-Fluoro-6-methoxy-4-(methoxymethyl)benzonitrile I8

[0333] To a solution of 2-fluoro-4-(hydroxymethyl)-6-methoxybenzonitrile I7 (2.7 g, 14.9 mmol) and iodomethane (10.6 g, 74.5 mmol) in DMF (100 mL) at 0° C. was added NaH (60% w/w dispersion in oil, 1.2 g, 29.8 mmol) in small portions and the mixture was stirred at RT for 30 min. Water was added and the mixture was extracted with EtOAc (100 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (2.2 g, 76%) as a yellow solid. LCMS-D: R.sub.t 2.22 min; m/z 218.0 [M+Na].sup.+.

e) 4-Methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9

[0334] To a solution of acetohydroxamic acid (2.3 g, 30.8 mmol) in anhydrous DMF (1500 mL) at RT was added potassium tert-butoxide (3.5 g, 30.8 mmol) and the mixture was stirred at RT for 1 h. 2-Fluoro-6-methoxy-4-(methoxymethyl)benzonitrile I8 (2.0 g, 10.3 mmol) was then added and stirring was continued at RT overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=20/1 to 10/1 to 3/1) to give the title compound (580 mg, 27%) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 6.92 (d, J=0.8 Hz, 1H), 6.65 (s, 1H), 5.91 (s, 2H), 4.48 (s, 2H), 3.90 (s, 3H), 3.32 (s, 3H, obscured by water peak). LCMS-D: R.sub.t 1.33 min; m/z 209.0 [M+H].sup.+.

iii) 4-Nitrobenzo[d]isoxazol-3-amine I10

[0335] ##STR00030##

[0336] To a solution of 2-fluoro-6-nitrobenzonitrile (1.0 g, 6.17 mmol) in DMF/H.sub.2O (32 mL/32 mL) was added acetohydroxamic acid (2.78 g, 37.0 mmol) and K.sub.2CO.sub.3 (10.23 g, 74.0 mmol) and the mixture was heated at 70° C. for 19 h. Water (200 mL) was added and the mixture was extracted with EtOAc (100 mL×3). The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=30/1 to 1/1) to give the title compound (380 mg, 35%) as a yellow solid. LCMS-D: R.sub.t 2.82 min; m/z 180.1 [M+H].sup.+.

iv) 4-Methoxy-6-(1-methoxyethyl)benzo[d]isoxazol-3-amine I15

[0337] ##STR00031##

a) 4-(1-Ethoxyvinyl)-2-fluoro-6-methoxybenzonitrile I11

[0338] To a solution of 4-bromo-2-fluoro-6-methoxybenzonitrile I5 (2.0 g, 8.7 mmol) in THF (40 mL) was added tributyl(1-ethoxyvinyl)stannane (3.4 g, 9.6 mmol), Pd(PPh.sub.3).sub.4 (201 mg, 0.174 mmol) and LiCl (1.15 g, 27.0 mmol) and the mixture was heated at reflux under N.sub.2 for 48 h. The mixture was diluted with EtOAc and washed consecutively with water, 5% aqueous ammonium hydroxide solution and brine. The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=200/1) to give the title compound (1.6 g, 84%) as a light yellow solid. LCMS-C: Rt 2.41 min; m/z 222.0 [M+H].sup.+.

b) 4-Acetyl-2-fluoro-6-methoxybenzonitrile I12

[0339] To a solution of 4-(1-ethoxyvinyl)-2-fluoro-6-methoxybenzonitrile I11 (1.0 g, 4.5 mmol) in THF (10 mL) was added 2 M aq. HCl (6.0 mL) and the mixture was stirred at RT for 3 h. The mixture was diluted with diethyl ether and washed with a saturated aqueous NaHCO.sub.3 solution and water. The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (710 mg, 81%) as a white solid. LCMS-C: R.sub.t 1.42 min; m/z 194.0 [M+H].sup.+.

c) 2-Fluoro-4-(1-hydroxyethyl)-6-methoxybenzonitrile I13

[0340] To a solution of 4-acetyl-2-fluoro-6-methoxybenzonitrile I12 (700 mg, 3.6 mmol) in THF (30 mL) was added sodium borohydride (206 mg, 5.4 mmol) and the mixture was stirred at RT overnight. Water was added and the mixture was extracted with EtOAc (30 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (675 mg, 95%) as a colorless oil. LCMS-C: R.sub.t 0.98 min; m/z 196.0 [M+H].sup.+.

d) 2-Fluoro-6-methoxy-4-(1-methoxyethyl)benzonitrile I14

[0341] To a solution of 2-fluoro-4-(1-hydroxyethyl)-6-methoxybenzonitrile I13 (670 mg, 3.4 mmol) and iodomethane (1.5 g, 10.3 mmol) in DMF (20 mL) at 0° C. was added NaH (60% w/w dispersion in oil, 274 mg, 6.8 mmol) in small portions and the mixture was stirred at 0° C. for 2 h. Water was added and the mixture was extracted with EtOAc (40 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (650 mg, 90%) as a light yellow solid. LCMS-C: R.sub.t 1.95 min; m/z 210.0 [M+H].sup.+.

e) 4-Methoxy-6-(1-methoxyethyl)benzo[d]isoxazol-3-amine I15

[0342] To a solution of acetohydroxamic acid (698 mg, 9.3 mmol) in anhydrous DMF (20 mL) at 0° C. was added potassium tert-butoxide (1.04 g, 9.3 mmol) and the mixture was stirred at RT for 1 h. A solution of 2-fluoro-6-methoxy-4-(1-methoxyethyl)benzonitrile I14 (650 mg, 3.1 mmol) in anhydrous DMF (10 mL) was then added dropwise and the mixture was stirred at RT overnight. Water was added and the mixture was extracted with EtOAc (50 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=300/1 to 200/1) to give the title compound (130 mg, 19%) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 6.90 (s, 1H), 6.64 (s, 1H), 5.92 (s, 2H), 4.39 (q, J=6.4 Hz, 1H), 3.90 (s, 3H), 3.15 (s, 3H), 1.36 (d, J=6.4 Hz, 3H). LCMS-C: R.sub.t 0.73 min; m/z 223.0 [M+H].sup.+.

v) 4-Methoxy-6-phenylbenzo[d]isoxazol-3-amine I17

[0343] ##STR00032##

a) 3-Fluoro-5-methoxy-[1,1biphenyl]-4-carbonitrile I16

[0344] To a solution of 4-bromo-2-fluoro-6-methoxybenzonitrile I5 (6.0 g, 26.1 mmol) and phenylboronic acid (6.36 g, 52.2 mmol) in 1,4-dioxane (200 mL) and water (50 mL) under N.sub.2 was added Pd(PPh.sub.3).sub.4 (2.99 g, 2.66 mmol) and Na.sub.2CO.sub.3 (8.29 g, 78.2 mmol) and the mixture was heated at 100° C. overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 50/1) to give the title compound (5.45 g, 93%) as a yellow solid. LCMS-C: R.sub.t 2.48 min; m/z 228.0 [M+H].sup.+.

b) 4-Methoxy-6-phenylbenzo[d]isoxazol-3-amine I17

[0345] To a solution of acetohydroxamic acid (8.15 g, 23.98 mmol) in anhydrous DMF (200 mL) at 0° C. was added potassium tert-butoxide (5.5 g, 24.0 mmol) and the mixture was stirred at RT for 1 h. 3-Fluoro-5-methoxy-[1,1biphenyl]-4-carbonitrile I16 (5.45 g, 7.99 mmol) was then added and the mixture was heated at 60° C. for 4 h. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1 to 8/1 to 6/1) to give the title compound (2.2 g, 38%) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.79-7.74 (m, 2H), 7.52-7.46 (m, 2H), 7.45-7.39 (m, 1H), 7.26 (d, J=1.1 Hz, 1H), 6.95 (s, 1H), 5.97 (s, 2H), 4.00 (s, 3H). LCMS-C: R.sub.t 2.15 min; m/z 241.0 [M+H].sup.+

vi) 3-(3-Amino-4-methoxybenzo[d]isoxazol-6-yl)phenol I19

[0346] ##STR00033##

a) 3-Fluoro-3hydroxy-5-methoxy-[1, 1biphenyl]-4-carbonitrile I18

[0347] To a solution of 4-bromo-2-fluoro-6-methoxybenzonitrile I5 (650 mg, 2.8 mmol) and (3-hydroxyphenyl)boronic acid (1.2 g, 5.6 mmol) in 1,4-dioxane (40 mL) and water (10 mL) under N.sub.2 was added Pd(PPh.sub.3).sub.4 (327 mg, 0.28 mmol) and Na.sub.2CO.sub.3 (899 mg, 8.5 mmol) and the mixture was heated at 100° C. overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=3/1) to give the title compound (687 mg, 94%) as a yellow solid. LCMS-C: R.sub.t 2.07 min; m/z 244.0 [M+H].sup.+.

b) 3-(3-Amino-4-methoxybenzo[d]isoxazol-6-yl)phenol I19

[0348] To a solution of acetohydroxamic acid (636 mg, 8.5 mmol) in anhydrous DMF (60 mL) at 0° C. was added potassium tert-butoxide (952 mg, 8.5 mmol) and the mixture was stirred at RT for 1 h. 3-Fluoro-3hydroxy-5-methoxy-[1,1biphenyl]-4-carbonitrile I18 (687 mg, 2.8 mmol) was then added and the mixture was heated at 60° C. for 4 h. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=1/1) to give the title compound (282 mg, 39%) as a yellow solid. LCMS-C: R.sub.t 2.3 min; m/z 257.0 [M+H].sup.+.

vii) 6-(Ethoxymethyl)-4-methoxybenzo[d]isoxazol-3-amine I21

[0349] ##STR00034##

a) 4-(Ethoxymethyl)-2-fluoro-6-methoxybenzonitrile I20

[0350] To a solution of 2-fluoro-4-(hydroxymethyl)-6-methoxybenzonitrile I7 (1.15 g, 6.4 mmol) and iodoethane (5.0 g, 31.7 mmol) in DMF (40 mL) at 0° C. was added NaH (60% w/w dispersion in oil, 508 mg, 12.7 mmol) in small portions and the mixture was stirred at RT for 30 min. Water was added and the mixture was extracted with EtOAc (100 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=2/1) to give the title compound (1.0 g, 79%) as a yellow solid. LCMS-C: R.sub.t 2.15 min; m/z 210.0 [M+H].sup.+.

b) 6-(Ethoxymethyl)-4-methoxybenzo[d]isoxazol-3-amine I21

[0351] To a solution of acetohydroxamic acid (1.1 g, 14.3 mmol) in anhydrous DMF (50 mL) at RT was added potassium tert-butoxide (1.6 g, 14.3 mmol) and the mixture was stirred at RT for 1 h. 4-(Ethoxymethyl)-2-fluoro-6-methoxybenzonitrile I20 (1.0 g, 4.8 mmol) was then added and the mixture was stirred at RT overnight. Water was added and the mixture was extracted with EtOAc. The organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=20/1 to 10/1 to 3/1) to give the title compound (650 mg, 61%) as a yellow oil. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 6.92 (s, 1H), 6.65 (s, 1H), 5.91 (s, 2H), 4.53 (s, 2H), 3.89 (s, 3H), 3.51 (q, J=7.0 Hz, 2H), 1.17 (t, J=7.0 Hz, 3H). LCMS-C: R.sub.t 0.82 min; m/z 223.0 [M+H].sup.+.

viii) 6-Bromo-4-methoxybenzo[d]isoxazol-3-amine I22

[0352] ##STR00035##

[0353] To a solution of acetohydroxamic acid (2.0 g, 26.1 mmol) in anhydrous DMF (100 mL) at RT was added potassium tert-butoxide (2.9 g, 26.1 mmol) and the mixture was stirred at RT for 1 h. 4-Bromo-2-fluoro-6-methoxybenzonitrile I5 (2.0 g, 8.7 mmol) was then added and the mixture was stirred at RT overnight. Water was added and the mixture was extracted with EtOAc. The organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=2/1) to give the title compound (296 mg, 14%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.32 (d, J=1.2 Hz, 1H), 6.90 (d, J=1.2 Hz, 1H), 6.04 (s, 2H), 3.92 (s, 3H). LCMS-C: R.sub.t 1.4 min; m/z 244.0 [M+H].sup.+.

ix) 7-Ethoxybenzo[d]isoxazol-3-amine I26

[0354] ##STR00036##

a) 2-Fluoro-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I23

[0355] A mixture of 3-bromo-2-fluorobenzonitrile (3.0 g, 15.0 mmol), 4,4,445,5,55octamethyl-2,2bi(1,3,2-dioxaborolane) (11.4 g, 45 mmol), potassium acetate (5.9 g, 60.0 mmol) and Pd(dppf)Cl.sub.2 (2.2 g, 3.0 mmol) in DMSO (45 mL) and 1,4-dioxane (15 mL) was heated at 105° C. under N.sub.2 for 3 h. The mixture was diluted with EtOAc (30 mL) and washed with water (30 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=20/1) to give the title compound (3.9 g, >100%) as a white solid, which was used directly in the next step.

b) 2-Fluoro-3-hydroxybenzonitrile I24

[0356] To a solution of 2-fluoro-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I23 (1.9 g, 7.6 mol) in AcOH (19 mL) under N.sub.2 was added H.sub.2O.sub.2 (30% aqueous solution, 1.9 mL) dropwise and the mixture was stirred at RT for 2 h then poured into a mixture of EtOAc and excess aqueous Na.sub.2SO.sub.3. The layers were then separated and the organic layer was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure to give the title compound (650 mg, 62%) as an off-white waxy solid. LCMS-D: R.sub.t 0.93 min; m/z 138.1 [M+H].sup.+.

c) 3-Ethoxy-2-fluorobenzonitrile I25

[0357] To a solution of 2-fluoro-3-hydroxybenzonitrile I24 (360 mg, 2.6 mmol) in DMF (30 mL) was added Cs.sub.2CO.sub.3 (4.3 g, 13.1 mmol) and iodoethane (1.0 g, 6.6 mmol) and the mixture was stirred at RT overnight. The mixture was diluted with EtOAc (80 mL) and washed with water (50 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure to give the title compound (220 mg, 51%) as a yellow solid. LCMS-D: R.sub.t 2.31 min; m/z 166.1 [M+H].sup.+.

d) 7-Ethoxybenzo[d]isoxazol-3-amine I26

[0358] To a solution of acetohydroxamic acid (300 mg, 4.0 mmol) in DMF (15 mL) at 0° C. under N.sub.2 was added potassium tert-butoxide (450 mg, 4.0 mmol) and the mixture was heated at 30° C. for 1 h. A solution of 3-ethoxy-2-fluorobenzonitrile I25 (220 mg, 1.3 mmol) in DMF (10 mL) was added and the mixture was heated at 30° C. overnight. EtOAc (80 mL) was added and the mixture was washed with water (50 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure to give the title compound (170 mg, 70%) as a yellow solid. LCMS-D: R.sub.t 1.68 min; m/z 179.1 [M+H].sup.+.

x) 7-(Cyclopropylmethoxy)benzo[d]isoxazol-3-amine I28

[0359] ##STR00037##

a) 3-(Cyclopropylmethoxy)-2-fluorobenzonitrile I27

[0360] To a solution of 2-fluoro-3-hydroxybenzonitrile I24 (360 mg, 2.6 mmol) in DMF (30 mL) was added Cs.sub.2CO.sub.3 (4.3 g, 13.1 mmol), KI (87 mg, 0.5 mmol) and (bromomethyl)cyclopropane (880 mg, 6.6 mmol) and the mixture was stirred at RT overnight. EtOAc (80 mL) was added and the mixture was washed with water (50 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure to give the title compound (150 mg, 30%) as a red solid. LCMS-D: R.sub.t 2.54 min; m/z 192.1 [M+H].sup.+.

b) 7-(Cyclopropylmethoxy)benzo[d]isoxazol-3-amine I28

[0361] Prepared from 3-(cyclopropylmethoxy)-2-fluorobenzonitrile I27 according to the procedure described for 7-ethoxybenzo[d]isoxazol-3-amine I26, step d. LCMS-D: R.sub.t 2.23 min; m/z 205.1 [M+H].sup.+.

xi) 6-Ethoxybenzo[d]isoxazol-3-amine I32

[0362] ##STR00038##

a) 2-Fluoro-4-((tetrahydro-2H-pyran-2-yl)oxy)benzonitrile I29

[0363] To a solution of 2-fluoro-4-hydroxybenzonitrile (20 g, 145.9 mmol) and PPTS (733 mg, 2.9 mmol) in DCM (500 mL) under N.sub.2 was added 3,4-dihydro-2H-pyran (24.5 g, 292 mmol) and the mixture was stirred at RT overnight. The solvent was removed under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=100/0 to 100/2) to give the title compound (27 g, 83%) as a white solid, which was used directly in the next step.

b) 6-((Tetrahydro-2H-pyran-2-yl)oxy)benzo[d]isoxazol-3-amine I30

[0364] To a solution of acetohydroxamic acid (13.7 g, 182.3 mmol) in DMF (60 mL) at 0° C. under N.sub.2 was added potassium tert-butoxide (20.4 g, 182.3 mmol) and the mixture was stirred at RT for 1 h. 2-Fluoro-4-((tetrahydro-2H-pyran-2-yl)oxy)benzonitrile I29 (13.4 g, 60.8 mmol) was then added and the mixture was stirred at RT overnight. EtOAc (500 mL) was added and the mixture was washed with water (100 mL×5). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (12.1 g, 85%) as a white solid. LCMS-D: R.sub.t 2.31 min; m/z 235.1 [M+H].sup.+.

c) 3-Aminobenzo[d]isoxazol-6-ol I31

[0365] To a solution of 6-((tetrahydro-2H-pyran-2-yl)oxy)benzo[d]isoxazol-3-amine I30 (3.5 g, 15 mmol) in THF (50 mL) was added 2 M aq. HCl (20 mL) and the mixture was stirred at RT for 3 h. The mixture was diluted with EtOAc (300 mL) and washed with water (×2). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure to give the title compound (2.1 g, 94%) as a white solid, which was used directly in the next step.

d) 6-Ethoxybenzo[d]isoxazol-3-amine I32

[0366] A mixture of 3-aminobenzo[d]isoxazol-6-ol I31 (300 mg, 2 mmol), Cs.sub.2CO.sub.3 (2.0 g, 6 mmol), KI (66 mg, 0.4 mmol) and bromoethane (436 mg, 4 mmol) in DMF (30 mL) was heated at 50° C. under N.sub.2 overnight. The mixture was diluted with EtOAc (300 mL) and washed with water (100 mL×5). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (270 mg, 76%) as a white solid. LCMS-D: R.sub.t 0.37 min; m/z 179.0 [M+H].sup.+.

xii) 6-(Cyclopropylmethoxy)benzo[d]isoxazol-3-amine I33

[0367] ##STR00039##

[0368] Prepared from 3-aminobenzo[d]isoxazol-6-ol I31 according to the procedure described for 6-ethoxybenzo[d]isoxazol-3-amine I32, step d (395 mg, 97%). LCMS-D: R.sub.t 2.27 min; m/z 205.1 [M+H].sup.+.

xiii) 6-(1H-1,2,3-Triazol-1-yl)benzo[d]isoxazol-3-amine I36

[0369] ##STR00040##

a) 4-Azido-2-fluorobenzonitrile I34

[0370] A mixture of 4-amino-2-fluorobenzonitrile (2.0 g, 14.7 mmol) in water (4 mL), ACN (32 mL), and concentrated HCl (10 mL) was stirred at RT under N.sub.2 overnight. NaNO.sub.2 (2.0 g, 29.4 mmol) was then added portion-wise and stirring was continued at RT for 2 h. The mixture was cooled to 0° C., NaN.sub.3 (1.9 g, 29.4 mmol) was added portion-wise and stirring was continued at RT for 2 h. Water (50 mL) was added and most of the organic solvent was removed under reduced pressure. The remaining aqueous mixture was then extracted with DCM (50 mL×4) and the combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/0 to 20/1) to give the title compound (1.5 g, 62%) as a yellow solid, which was used directly in the next step.

b) 2-Fluoro-4-(1H-1,2,3-triazol-1-yl)benzonitrile I35

[0371] A mixture of 4-azido-2-fluorobenzonitrile I34 (500 mg, 3.1 mmol), ethynyltrimethylsilane (454 mg, 4.6 mmol) and CuI (704 mg, 3.7 mmol) in THF (50 mL) was heated at 50° C. under N.sub.2 for 24 h. Additional ethynyltrimethylsilane (454 mg, 4.6 mmol) was added and the mixture was heated at 50° C. for a further 24 h, then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 10/1) to give 2-fluoro-4-(5-(trimethylsilyl)-1H-1,2,3-triazol-1-yl)benzonitrile (410 mg), which was dissolved in a 1 M solution of TBAF in THF (50 mL) and heated at 45° C. under N.sub.2 overnight. The solvent was removed under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 2/1) to give the title compound (200 mg, 34%) as a white solid, which was used directly in the next step.

c) 6-(1H-1,2,3-Triazol-1-yl)benzo[d]isoxazol-3-amine I36

[0372] To a solution of acetohydroxamic acid (239 mg, 3.16 mmol) in DMF (25 mL) at 0° C. under N.sub.2 was added potassium tert-butoxide (357 mg, 3.18 mmol) and the mixture was stirred at RT for 2 h. A solution of 2-fluoro-4-(1H-1,2,3-triazol-1-yl)benzonitrile I35 (200 mg, 1.06 mmol) in DMF (15 mL) was then added and stirring was continued at RT overnight. EtOAc (100 mL) was added and the mixture was washed with water (x 5). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 2/1) to give the title compound (150 mg, 70%) as a white solid. LCMS-D: R.sub.t 0.47 min; m/z 202.1 [M+H].sup.+.

xiv) 6-(Pyrimidin-2-yl)benzo[d]isoxazol-3-amine I39

[0373] ##STR00041##

a) 2-Fluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I37

[0374] A mixture of 4-bromo-2-fluorobenzonitrile (1.0 g, 5.0 mmol), 4,4,445,5,55octamethyl-2,2bi(1,3,2-dioxaborolane) (1.3 g, 5.0 mmol), potassium acetate (5.9 g, 20.0 mmol) and Pd(dppf)Cl.sub.2 (2.0 g, 1.0 mmol) in DMSO (50 mL) and 1,4-dioxane (10 mL) was heated at 105° C. under N.sub.2 for 3 h. The mixture was diluted with EtOAc (200 mL) and washed with water (100 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=100/0 to 50/1) to give the title compound (1.1 g, 89%) as a white solid, which was used directly in the next step.

b) 2-Fluoro-4-(pyrimidin-2-yl)benzonitrile I38

[0375] To a solution of 2-fluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I37 (464 mg, 2 mmol) and 2-bromopyrimidine (736 mg, 4 mmol) in water (40 mL), toluene (40 mL) and i-PrOH (10 mL) under N.sub.2 was added Pd(dppf)Cl.sub.2 (146 mg, 0.2 mmol) and K.sub.3PO.sub.4.3H.sub.2O (1.33 g, 5.0 mmol) and the mixture was heated at 85° C. for 4 h. The mixture was diluted with EtOAc (200 mL) and washed with water (50 mL). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 2/1) to give the title compound (270 mg, 68%) as a white solid. LCMS-D: R.sub.t 2.38 min; m/z 200.1 [M+H].sup.+.

c) 6-(Pyrimidin-2-yl)benzo[d]isoxazol-3-amine I39

[0376] To a solution of acetohydroxamic acid (306 mg, 4.07 mmol) in DMF (20 mL) at 0° C. under N.sub.2 was added potassium tert-butoxide (457 mg, 4.07 mmol) and the mixture was heated at 30° C. for 1 h. A solution of 2-fluoro-4-(pyrimidin-2-yl)benzonitrile I38 (270 mg, 1.36 mmol) in DMF (10 mL) was then added and heating was continued at 30° C. overnight. The mixture was diluted with EtOAc (100 mL) and washed with water (50 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 2/1) to give the title compound (200 mg, 69%) as a white solid. LCMS-D: R.sub.t 0.38 min; m/z 213.1 [M+H].sup.+, 235.1 [M+Na].sup.+.

xv) 5-Bromobenzo[d]isoxazol-3-amine I40

[0377] ##STR00042##

[0378] To a solution of acetohydroxamic acid (23.7 g, 0.315 mol) in DMF (800 mL) at 0° C. under N.sub.2 was added t-BuOK (35.4 g, 0.315 mol) and the mixture was stirred at 15° C. for 2 h. 5-Bromo-2-fluorobenzonitrile (21.0 g, 0.105 mol) was then added and the mixture was stirred at RT overnight. The mixture was diluted with EtOAc (1.5 L) and washed with water (400 mL×4). The organic layer was washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 3/1) to give the title compound (19 g, 86%) as a white solid. LCMS-D: R.sub.t 2.13 min; m/z 212.9/214.9 [M+H].sup.+.

xvi) 4-Bromobenzo[d]isoxazol-3-amine I41

[0379] ##STR00043##

[0380] To a solution of acetohydroxamic acid (11.25 g, 0.15 mol) in DMF (220 mL) at 0° C. under N.sub.2 was added t-BuOK (16.8 g, 0.15 mol) and the mixture was stirred at 25° C. for 1 h. A solution of 2-bromo-6-fluorobenzonitrile (10.0 g, 0.05 mol) in DMF (80 mL) was then added dropwise and stirring was continued at 25° C. overnight. The mixture was diluted with water (200 mL) and extracted with EtOAc (400 mL). The organic extract was washed with water (400 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (7.0 g, 66%) as a light red solid. LCMS-D: R.sub.t 2.05 min; m/z 212.9/214.9 [M+H].sup.+.

xvii) 4-(Trifluoromethyl)benzo[d]isoxazol-3-amine I42

[0381] ##STR00044##

[0382] To a solution of acetohydroxamic acid (2.25 g, 30 mmol) in DMF (80 mL) at 0° C. under N.sub.2 was added t-BuOK (3.37 g, 30 mmol) and the mixture was heated at 30° C. for 1 h. A solution of 2-fluoro-6-(trifluoromethyl)benzonitrile (1.89 g, 10 mmol) in DMF (20 mL) was then added and heating was continued at 30° C. overnight. The mixture was partitioned between EtOAc (300 mL) and water (100 mL), the layers were separated and the organic layer was washed with water (100 mL×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 1/1) to give the title compound (1.3 g, 64%) as a white solid LCMS-D: R.sub.t 2.19 min; m/z 203.0 [M+H].sup.+.

xviii) 5-Bromo-4-chlorobenzo[d]isoxazol-3-amine I44

[0383] ##STR00045##

a) 3-Bromo-2-chloro-6-fluorobenzonitrile I43

[0384] To a solution of 2-chloro-6-fluorobenzonitrile (1.0 g, 6.4 mmol) in trifluoromethanesulfonic acid (10 mL) at 0° C. under N.sub.2 was added NBS (1.1 g, 6.4 mmol) and the mixture was stirred at RT overnight. The mixture was poured onto ice and extracted with EtOAc (30 mL×2). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=200/1 to 100/1) to give the title compound (705 mg, 47%) as a white solid, which was used directly in the next step.

b) 5-Bromo-4-chlorobenzo[d]isoxazol-3-amine I44

[0385] To a solution of acetohydroxamic acid (5.1 g, 67.8 mmol) in DMF (150 mL) at 0° C. under N.sub.2 was added t-BuOK (7.6 g, 6.4 mmol) and the mixture was stirred at RT for 2 h. 3-Bromo-2-chloro-6-fluorobenzonitrile I43 (5.3 g, 22.6 mmol) was then added and the mixture was stirred at RT overnight. The mixture was diluted with EtOAc (500 mL) and washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 2/1) to give the title compound (3.1 g, 52%) as a white solid, which was used directly in the next step.

xix) 5-Bromo-4-methoxybenzo[d]isoxazol-3-amine I48

[0386] ##STR00046##

a) 3-Bromo-6-fluoro-2-methoxybenzoic acid I45

[0387] To a solution of diisopropylamine (5.4 g, 53.7 mmol) in THF (150 mL) at −78° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexanes, 23.4 mL, 58.5 mmol) dropwise and the mixture was stirred at −78° C. for 1 h. The resulting mixture was added dropwise to a solution of 1-bromo-4-fluoro-2-methoxybenzene (10.0 g, 48.8 mmol) in THF (50 mL) at −78° C. and stirring was continued for 90 min. CO.sub.2 was bubbled through the mixture for 20 min with stirring at −78° C., then allowed to warm to RT and stirred for 15 min. The reaction mixture was adjusted to pH=1 with HCl and the mixture was diluted with water and extracted with DCM (500 mL). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/1 to 30/1) to give the title compound (8.0 g, 66%) as a colorless oil. LCMS-D: R.sub.t 2.12 min; m/z 248.9/250.9 [M+H].sup.+.

b) 3-Bromo-6-fluoro-2-methoxybenzamide I46

[0388] A mixture of 3-bromo-6-fluoro-2-methoxybenzoic acid I45 (8.0 g, 32.1 mmol) and SOCl.sub.2 (30 mL) was heated at 85° C. for 3 h. The mixture was concentrated under reduced pressure and the residue was dissolved in DCM (5 mL) and added to conc. NH.sub.4OH (20 mL) at 0° C. dropwise. The mixture was allowed to warm to RT, stirred for 20 min then extracted with DCM (50 mL×3). The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 1/1) to give the title compound (6.8 g, 80%) as a white solid. LCMS-E: R.sub.t 2.24 min; m/z 247.8/249.8 [M+H].sup.+

c) 3-Bromo-6-fluoro-2-methoxybenzonitrile I147

[0389] A mixture of 3-bromo-6-fluoro-2-methoxybenzamide I46 (6.8 g, 25.6 mmol) and SOCl.sub.2 (30 mL) was heated at 80° C. overnight, then concentrated under reduced pressure. The residue was partitioned between water and EtOAc, the phases were separated and the organic layer was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 20/1) to give the title compound (3.5 g, 55%) as a colorless oil, which was used directly in the next step.

d) 5-Bromo-4-methoxybenzo[d]isoxazol-3-amine I48

[0390] To a solution of acetohydroxamic acid (3.4 g, 45.7 mmol) in DMF (150 mL) at 0° C. under N.sub.2 was added t-BuOK (5.1 g, 45.7 mmol) and the mixture was stirred at RT for 90 min. A solution of 3-bromo-6-fluoro-2-methoxybenzonitrile I47 (3.5 g, 15.2 mmol) in DMF (30 mL) was then added and the mixture was heated at 70° C. overnight. The mixture was diluted with EtOAc (1000 mL) and washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 3/1) to give the title compound (3.2 g, 86%) as a white solid. LCMS-D: R.sub.t 2.24 min; m/z 243.0/244.9 [M+H].sup.+.

xx) 4-(Methoxymethyl)benzo[d]isoxazol-3-amine I51

[0391] ##STR00047##

a) 2-(Bromomethyl)-6-chlorobenzonitrile I49

[0392] A mixture of 2-chloro-6-methylbenzonitrile (2.0 g, 13.2 mmol), NBS (2.5 g, 13.8 mmol) and AIBN (660 mg, 4.0 mmol) in CCl.sub.4 (60 mL) was heated at 85° C. under N.sub.2 overnight. The mixture was concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 50/1) to give the title compound (1.7 g, 37%) as a white solid, which was used directly in the next step.

b) 2-Chloro-6-(methoxymethyl)benzonitrile I50

[0393] Sodium metal (115 mg, 4.8 mmol) was dissolved in MeOH (5 mL) and THF (5 mL) and the mixture was stirred at RT for 20 min. 2-(Bromomethyl)-6-chlorobenzonitrile I49 (560 mg, 2.4 mmol) was then added and the mixture was stirred at RT for 5 h. The solvent was removed under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=50/1) to give the title compound (340 mg, 77%) as a colorless oil. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.75-7.70 (m, 3H), 4.82 (s, 2H), 3.35 (s, 3H).

c) 4-(Methoxymethyl)benzo[d]isoxazol-3-amine I51

[0394] To a solution of acetohydroxamic acid (422 mg, 5.6 mmol) in DMF (25 mL) at −78° C. under N.sub.2 was added t-BuOK (630 mg, 5.6 mmol) and the mixture was stirred at 0° C. for 1 h. 2-Chloro-6-(methoxymethyl)benzonitrile I50 (340 mg, 1.9 mmol) was then added and the mixture was stirred at RT overnight, then heated at 85° C. overnight. The mixture was diluted with water (70 mL) and extracted with EtOAc (100 mL×2). The combined organic extracts were washed with water (200 mL×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOA=5/1 to 3/1) to give the title compound (105 mg, 31%) as a light yellow oil. LCMS-D: R.sub.t 1.57 min; m/z 179.1 [M+H].sup.+.

xxi) 4-Ethoxybenzo[d]isoxazol-3-amine I53

[0395] ##STR00048##

a) 2-Ethoxy-6-fluorobenzonitrile I52

[0396] A mixture of 2-fluoro-6-hydroxybenzonitrile (2.0 g, 14.6 mmol), K.sub.2CO.sub.3 (6.04 g, 43.8 mmol) and bromoethane (2.38 g, 21.9 mmol) in DMF (4 mL) was stirred at RT under N.sub.2 overnight. The mixture was diluted with EtOAc (300 mL), washed with water (100 mL×5), brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (1.6 g, 67%) as a white solid. LCMS-E: R.sub.t 5.24 min; m/z 166.1 [M+H].sup.+.

b) 4-Ethoxybenzo[d]isoxazol-3-amine I53

[0397] To a solution of acetohydroxamic acid (2.18 g, 29 mmol) in DMF (40 mL) at 0° C. under N.sub.2 was added t-BuOK (3.26 g, 29 mmol) and the mixture was stirred at RT for 1 h. 2-Ethoxy-6-fluorobenzonitrile I52 (1.6 g, 9.7 mmol) was then added and the mixture was stirred at RT overnight. The mixture was diluted with DCM (80 mL), washed with water (60 mL×4), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=5/1) to give the title compound (240 mg, 15%) as a white solid. LCMS-E: R.sub.t 5.05 min; m/z 179.0 [M+H].sup.+.

xxii) 5-Methoxybenzo[d]isoxazol-3-amine I54

[0398] ##STR00049##

[0399] To a solution of acetohydroxamic acid (1.49 mg, 19.8 mmol) in DMF (35 mL) at 0° C. under N.sub.2 was added t-BuOK (2.23 mg, 19.8 mmol) and the mixture was heated at 30° C. for 1 h. A solution of 2-fluoro-5-methoxybenzonitrile (1.0 g, 6.6 mmol) in DMF (5 mL) was then added and the mixture was heated at 30° C. overnight. The mixture was diluted with water (70 mL) and extracted with EtOAc (100 mL×3). The combined organic extracts were washed with water (200 mL×3) then dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (110 mg, 11%) as a yellow solid, which was used directly in the next step.

xxiii) 5-Ethoxybenzo[d]isoxazol-3-amine I57

[0400] ##STR00050##

a) 2-Fluoro-5-hydroxybenzonitrile I55

[0401] A mixture of 2-fluoro-5-methoxybenzonitrile (1.7 g, 1.2 mmol) and pyridine.HCl (17 g) was heated at 80° C. under N.sub.2 for 5 h, then diluted with DCM (40 mL) and washed with 2 M aq. HCl (8 mL) and water (2×40 mL). The organic layer was extracted with an aqueous K.sub.2CO.sub.3 solution (50 mL×2) and the combined aqueous extracts were washed with DCM (70 mL×2), then adjusted to pH 3-4 with 2 M aq. HCl and extracted with DCM (80 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (430 mg, 28%) as an off-white solid, which was used directly in the next step.

b) 5-Ethoxy-2-fluorobenzonitrile I56

[0402] To a solution of 2-fluoro-5-hydroxybenzonitrile I55 (430 mg, 3.1 mmol) in DMF (15 mL) was added K.sub.2CO.sub.3 (1.3 g, 9.4 mmol) and the mixture was stirred at RT under N.sub.2 for 30 min. Bromoethane (512 mg, 4.7 mmol) was then added and stirring was continued at RT overnight. The mixture was diluted with water (70 mL) and extracted with EtOAc (100 mL×2). The combined organic extracts were washed with water (200 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=30/1 to 20/1) to give the title compound (480 mg, 92%) as a white solid. LCMS-D: R.sub.t 2.44 min; m/z 166.0 [M+H].sup.+188.0 [M+Na].sup.+.

c) 5-Ethoxybenzo[d]isoxazol-3-amine I57

[0403] To a solution of acetohydroxamic acid (645 mg, 8.7 mmol) in DMF (35 mL) at 0° C. under N.sub.2 was added t-BuOK (978 mg, 8.7 mmol) and the mixture was heated at 30° C. for 1 h. A solution of 5-ethoxy-2-fluorobenzonitrile I56 (480 mg, 2.9 mmol) in DMF (5 mL) was then added and the mixture was heated at 30° C. overnight. The mixture was diluted with water (60 mL) and extracted with EtOAc (80 mL×2). The combined organic extracts were washed with water (150 mL×2), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (400 mg, 77%) as a light yellow solid. LCMS-D: R.sub.t 2.02 min; m/z 179.1 [M+H].sup.+.

xxiv) 6-(3,5-Dimethyl-1H-pyrazol-1-yl)benzo[d]isoxazol-3-amine I59

[0404] ##STR00051##

a) 2-Chloro-4-(3,5-dimethyl-1H-pyrazol-1-yl) benzonitrile I58

[0405] A mixture of 3,5-dimethyl-1H-pyrazole (5 g, 0.052 mol), NaH (60% dispersion in oil, 2.6 g, 0.065 mol) in DMF (50 mL) was stirred at RT for 1 h. A solution of 2-chloro-4-fluorobenzonitrile (6.74 g, 0.043 mol) in DMF (50 mL) was then added and stirring was continued at RT for 1 h. The reaction was quenched with water and the mixture was extracted with EtOAc. The organic extract was concentrated under reduced pressure to give the title compound (11.0 g, 92%) as a yellow solid. LCMS-D: R.sub.t 2.58 min; m/z 232.1 [M+H].sup.+.

b) 6-(3,5-Dimethyl-1H-pyrazol-1-yl)benzo[d]isoxazol-3-amine I59

[0406] To a solution of acetohydroxamic acid (972 mg, 12.9 mmol) in DMF (20 mL) at 0° C. under N.sub.2 was added t-BuOK (1.45 g, 12.9 mmol) and the mixture was heated at 30° C. for 1 h. 2-Chloro-4-(3,5-dimethyl-1H-pyrazol-1-yl) benzonitrile I58 (1 g, 4.3 mmol) was then added and the mixture was heated at 60° C. for 5 h. The mixture was diluted with water and extracted with EtOAc. The organic extract was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC (MeOH/DCM=1/20) to give the title compound (150 mg, 15%) as a white solid. LCMS-D: R.sub.t 2.22 min; m/z 229.1 [M+H].sup.+.

xxv) 5-Methylbenzo[d]isoxazol-3-amine I60

[0407] ##STR00052##

[0408] To a solution of acetohydroxamic acid (8.33 g, 0.11 mol) in DMF (200 mL) was added t-BuOK (12.5 g, 0.11 mol) and the mixture was stirred at RT for 1 hour. 2-Fluoro-5-methylbenzonitrile (5 g, 0.37 mol) was then added and the mixture was heated at 60° C. overnight. The mixture was diluted with water and extracted with EtOAc. The organic extract was concentrated under reduced pressure and the residue was purified by a silica gel chromatography (DCM/MeOH=200/1 to 50/1) to give the title compound (3.0 g, 55%) as a white solid. LCMS-D: R.sub.t 1.75 min, m/z 149.0 [M+H].sup.+.

xxvi) 6-(Methoxymethyl)benzo[d]isoxazol-3-amine I62

[0409] ##STR00053##

a) 2-Fluoro-4-(methoxymethyl)benzonitrile I61

[0410] A mixture of Mel (2.0 g, 13.2 mmol) and NaH (60% suspension in oil, 790 mg, 19.8 mmol) in THF (50 mL) was stirred at 0° C. for 10 min, then 2-fluoro-4-(hydroxymethyl)benzonitrile (2.0 g, 13.2 mmol) was added and the mixture was stirred at RT for 2 h. The reaction was quenched with water and the mixture was extracted with EtOAc. The organic extract was concentrated under reduced pressure and the residue was purified by silica gel chromatography (Pet. ether/EtOAc=100/1 to 20/1) to give the title compound (1.7 g, 78%) as a white solid. LCMS-D: R.sub.t 2.01 min; m/z 166.0 [M+H].sup.+ 187.9 [M+Na].sup.+.

b) 6-(Methoxymethyl)benzo[d]isoxazol-3-amine I62

[0411] To a solution of acetohydroxamic acid (1.5 g, 9.1 mmol) in DMF (50 mL) was added t-BuOK (3.06 g, 27.2 mmol) and the mixture was stirred at RT for 1 h. 2-Fluoro-4-(methoxymethyl)benzonitrile I61 (1.5 g, 9.1 mmol) was then added and the mixture was heated at 40° C. overnight. The mixture was diluted with water and extracted with EtOAc. The organic extract was concentrated under reduced pressure and the residue was purified by silica gel chromatography (Pet. ether/EtOAc=100/1 to 10/1) to give the title compound (1 g, 62%) as a yellow solid. LCMS-D: R.sub.t 0.95 min, m/z 179.0 [M+H].sup.+.

xxvii) 5-(Trifluoromethoxy)benzo[d]isoxazol-3-amine I63

[0412] ##STR00054##

[0413] To a solution of acetohydroxamic acid (2.2 g, 0.029 mol) in DMF (50 mL) was added t-BuOK (3.28 g, 0.029 mol) and the mixture was stirred RT for 1 hour. 2-Fluoro-5-(trifluoromethoxy)benzonitrile (2 g, 9.75 mmol) was then added and the mixture was heated at 60° C. overnight. The mixture was diluted with water and extracted with EtOAc. The organic extract was concentrated under reduced pressure to give the title compound (1.6 g, 75%) as a yellow solid. LCMS-D: R.sub.t 2.43 min; m/z 219.0 [M+H].sup.+.

xxviii) 5-Methyl-6-(oxazol-2-yl)benzo[d]isoxazol-3-amine I65

[0414] ##STR00055##

a) 2-Fluoro-5-methyl-4-(oxazol-2-yl)benzonitrile I64

[0415] To a solution of oxazole (90 mg, 1.31 mmol) in THF (10 mL) at −70° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexane, 1.1 mL, 2.66 mmol) and the mixture was stirred for 10 min. Solid ZnCl.sub.2 (380 mg, 2.79 mmol) was added and the mixture was allowed to warm to RT. 4-Bromo-2-fluoro-5-methylbenzonitrile (200 mg, 0.93 mmol) was added and the mixture was heated at 60° C. overnight. The solvent was removed under reduced pressure and the residue was purified by silica gel chromatography (Pet. ether/EtOAc 10/1) to give the title compound (50 mg, 27%) as a white solid. LCMS-D: R.sub.t 2.51 min; m/z 203.0 [M+H].sup.+.

b) 5-Methyl-6-(oxazol-2-yl)benzo[d]isoxazol-3-amine I65

[0416] To a solution of acetohydroxamic acid (189 mg, 2.52 mmol) in DMF (10 mL) at 0° C. under N.sub.2 was added t-BuOK (377 mg, 3.26 mmol) and the mixture was stirred at 0° C. for 1 h. 2-Fluoro-5-methyl-4-(oxazol-2-yl)benzonitrile I64 (170 mg, 0.84 mmol) was then added and the mixture was heated at 50° C. overnight. The mixture was diluted with water and extracted with EtOAc. The organic extract was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC (DCM/MeOH=10/1) to give the title compound (90 mg, 50%) as a white solid. LCMS-D: R.sub.t 2.10 min; m/z 216.0 [M+H].sup.+.

xxix) 7-Bromobenzo[d]isoxazol-3-amine I66

[0417] ##STR00056##

[0418] To a solution of acetohydroxamic acid (3.75 g, 0.05 mol) in DMF (60 mL) at 0° C. was added t-BuOK (5.6 g, 0.05 mol) and the mixture was stirred at RT for 1 h. A solution of 3-bromo-2-fluorobenzonitrile (5.0 g, 0.025 mol) in DMF (90 mL) was then added dropwise and stirred was continued at RT overnight. The mixture was diluted with DCM (300 mL), washed with water (250 mL×4), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (4.0 g, 63%) as a white solid. LCMS-D: R.sub.t 2.09 min, m/z 213.0/215.0 [M+H].sup.+.

xxx) 7-(Pyrimidin-2-yl)benzo[d]isoxazol-3-amine I68

[0419] ##STR00057##

a) 2-Fluoro-3-(pyrimidin-2-yl)benzonitrile I67

[0420] A mixture of 2-fluoro-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I23 (1.5 g, 6.1 mmol), 2-bromopyrimidine (1.9 g, 12.0 mmol), Pd(dppf)Cl.sub.2 (1.3 g, 1.8 mmol) and K.sub.3PO.sub.4 (6.5 g, 24.2 mmol) in water (60 mL), toluene (60 mL) and i-PrOH (15 mL) was heated at 85° C. under N.sub.2 for 4 h. The mixture was diluted with EtOAc (50 mL) and washed with water (80 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=4/1) to give the title compound (450 mg, 38%) as a light yellow solid. LCMS-E: R.sub.t 4.82 min; m/z 199.9 [M+H].sup.+.

b) 7-(Pyrimidin-2-yl)benzo[d]isoxazol-3-amine I68

[0421] To a solution of acetohydroxamic acid (243 mg, 3.2 mmol) in DMF (15 mL) at 0° C. under N.sub.2 was added t-BuOK (363 mg, 3.2 mmol) and the mixture was stirred for 1 h. A solution of 2-fluoro-3-(pyrimidin-2-yl)benzonitrile I67 (400 mg, 1.6 mmol) in DMF (5 mL) was then added dropwise and the mixture was stirred at RT overnight. The mixture was diluted with EtOAc (80 mL) and washed with water (60 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (230 mg, 67%) as a yellow solid. LCMS-D: R.sub.t 0.80 min. m/z 213.1 [M+H].sup.+.

xxxi) 6-(1H-Pyrazol-1-yl)benzo[d]isoxazol-3-amine I70

[0422] ##STR00058##

a) 2-Fluoro-4-(1H-pyrazol-1-yl)benzonitrile I69

[0423] A mixture of 4-bromo-2-fluorobenzonitrile (400 mg, 2.0 mmol), 1H-pyrazole (177 mg, 2.6 mmol), CuI (381 mg, 2.0 mmol), K.sub.3PO.sub.4 (849 mg, 4.0 mmol) and (1S,2S)—N.sup.1,N.sup.2-dimethylcyclohexane-1,2-diamine (28 mg, 0.2 mmol) in DMF (20 mL) was heated at 100° C. in a microwave for 1 h. The mixture was partitioned between EtOAc (200 mL) and water (100 mL), the layers were separated and the organic layer was washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 20/1) to give the title compound (120 mg, 32%) as a white solid. LCMS-D: R.sub.t 2.20 min, m/z 188.1 [M+H].sup.+.

b) 6-(1H-Pyrazol-1-yl)benzo[d]isoxazol-3-amine I70

[0424] To a solution of acetohydroxamic acid (215 mg, 2.9 mmol) in DMF (25 mL) at 0° C. was added t-BuOK (322 mg, 2.9 mmol) and the mixture was heated 30° C. for 2 h. 2-Fluoro-4-(1H-pyrazol-1-yl)benzonitrile I69 (120 mg, 0.64 mmol) was then added and the mixture was heated at 30° C. overnight. The mixture was partitioned between EtOAc (100 mL) and water (50 mL), the layers were separated and the organic layer was washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 2/1) to give the title compound (72 mg, 57%) as a white solid, which was used directly in the next step.

xxxii) 6-(2H-1,2,3-Triazol-2-yl)benzo[d]isoxazol-3-amine I72

[0425] ##STR00059##

a) 2-Chloro-4-(2H-1,2,3-triazol-2-yl)benzonitrile I71

[0426] A mixture of 2H-1,2,3-triazole (553 mg, 8.0 mmol) and NaH (60% dispersion in oil, 192 mg, 4.8 mmol) in DMF (20 mL) was stirred at 0° C. for 30 min, then a solution of 2-chloro-4-fluorobenzonitrile (622 mg, 4.0 mmol) in DMF (10 mL) was added. The mixture was stirred at 0° C. for 2 h then allowed to warm to RT and stirred for 2 h. The mixture was partitioned between EtOAc (300 mL) and water (100 mL), the layers were separated and the organic layer was washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 20/1) to give the title compound (200 mg, 24%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.31-8.28 (m, 3H), 8.19-8.14 (m 2H).

b) 6-(2H-1,2,3-Triazol-2-yl)benzo[d]isoxazol-3-amine I72

[0427] To a solution of acetohydroxamic acid (221 mg, 2.9 mmol) in DMF (25 mL) at 0° C. was added t-BuOK (330 mg, 2.9 mmol) and the mixture was heated at 30° C. for 2 h. 2-Chloro-4-(2H-1,2,3-triazol-2-yl)benzonitrile I71 (200 mg, 0.98 mmol) was then added and the mixture was heated at 30° C. overnight. The mixture was partitioned between EtOAc (100 mL) and water (50 mL), the layers were separated and the organic layer was washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 2/1) to give the title compound (90 mg, 46%) as a white solid. LCMS-D: R.sub.t 1.93 min, m/z 202.1 [M+H].sup.+.

xxxiii) 6-(Pyridin-2-yl)benzo[d]isoxazol-3-amine I74

[0428] ##STR00060##

a) 2-Fluoro-4-(pyridin-2-yl)benzonitrile I73

[0429] A mixture of 2-fluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I37 (494 mg, 2.0 mmol), 2-bromopyridine (948 mg, 6.0 mmol), Pd(dppf)Cl.sub.2 (293 mg, 0.4 mmol) and K.sub.3PO.sub.4.3H.sub.2O (2.66 g, 10.0 mmol) in H.sub.2O (40 mL), toluene (40 mL) and i-PrOH (10 mL) was heated at 85° C. under N.sub.2 for 4 h. The mixture was partitioned between EtOAc (200 mL) and water (30 mL), the layers were separated and the organic layer was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=30/1 to 10/1) to give the title compound (190 mg, 48%) as a white solid. LCMS-D: R.sub.t 2.32 min, m/z 199.1 [M+H].sup.+.

b) 6-(Pyridin-2-yl)benzo[d]isoxazol-3-amine I74

[0430] To a solution of acetohydroxamic acid (216 mg, 2.88 mmol) in DMF (50 mL) at 0° C. was added t-BuOK (323 mg, 2.88 mmol) and the mixture was stirred at RT for 1 h. A solution of 2-fluoro-4-(pyridin-2-yl)benzonitrile I73 (190 mg, 0.96 mmol) in DMF (10 mL) was then added and the mixture was stirred at RT overnight. The mixture was partitioned between EtOAc (200 mL) and water (50 mL), the layers were separated and the organic layer was washed with water (50 mL×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/0 to 100/1) to give the title compound (105 mg, 52%) as a white solid. LCMS-D: R.sub.t 0.83 min, m/z 212.1 [M+H].sup.+.

xxxiv) 6-Bromobenzo[d]isoxazol-3-amine I75

[0431] ##STR00061##

[0432] To a solution of acetohydroxamic acid (13.7 g, 182 mmol) in DMF (60 mL) at 0° C. was added t-BuOK (20.5 g, 182 mmol) and the mixture was stirred at 0° C. for 1 h. A solution of 4-bromo-2-fluorobenzonitrile (12.2 g, 60.8 mmol) in DMF (30 mL) was then added and the mixture was stirred at RT overnight. The mixture was partitioned between EtOAc (500 mL) and water (200 mL), the layers were separated and the organic layer was washed with water (×2), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 30/1) to give the title compound (8.1 g, 63%) as a white solid. LCMS-D: R.sub.t 2.34 min; m/z 213.0/215.0 [M+H].sup.+.

xxxv) 4-Methoxy-6-(pyridin-2-yl)benzo[d]isoxazol-3-amine I77

[0433] ##STR00062##

a) 2-Fluoro-6-methoxy-4-(pyridin-2-yl)benzonitrile I76

[0434] A mixture of 4-bromo-2-fluoro-6-methoxybenzonitrile I5 (244 mg, 1.06 mmol), pyridin-2-ylboronic acid (195 mg, 1.59 mmol), CuCl (105 mg, 1.06 mmol), Pd(OAc).sub.2 (24 mg, 0.106 mmol), XPhos (100 mg, 0.212 mmol) and Cs.sub.2CO.sub.3 (1.38 g, 4.24 mmol) in DMF (10.6 mL) was heated under a nitrogen atmosphere in a 20 mL sealed tube at 100° C. for 16 h. The reaction was repeated a further three times on the same scale and the four reactions were quenched with a saturated aqueous NH.sub.4Cl, combined and extracted with EtOAc (80 mL×3). The combined organic extracts were washed with water, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1 to 5/1) to give the title compound (190 mg, 20%) as a yellow solid. LCMS-C: R.sub.t 2.13 min; m/z 229.0 [M+H].sup.+.

b) 4-Methoxy-6-(pyridin-2-yl)benzo[d]isoxazol-3-amine I77

[0435] To a solution of acetohydroxamic acid (178 mg, 2.37 mmol) in anhydrous DMF (20 mL) at 0° C. was added potassium tert-butoxide (266 mg, 2.37 mmol) and the mixture was stirred at 0° C. for 1 h. 2-Fluoro-6-methoxy-4-(pyridin-2-yl)benzonitrile I76 (180 mg, 0.79 mmol) was then added and the mixture was heated at 40° C. overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=200/1 to 100/1 to 60/1) to give the title compound (70 mg, 37%) as a yellow solid. LCMS-C: R.sub.t 0.52 min; m/z 242.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.73-8.68 (m, 1H), 8.14-8.09 (m, 1H), 7.95-7.88 (m, 1H), 7.70 (d, J=1.0 Hz, 1H), 7.46 (s, 1H), 7.44-7.38 (m, 1H), 6.01 (s, 2H), 4.01 (s, 3H).

xxxvi) 4-Methoxy-7-phenylbenzo[d]isoxazol-3-amine I80

[0436] ##STR00063##

a) 3-Bromo-2-fluoro-6-methoxybenzonitrile I78

[0437] A solution of Br.sub.2 (507 mg, 3.2 mmol) in CCl.sub.4 (4.0 mL) was added to a solution of 2-fluoro-6-methoxybenzonitrile (480 mg, 3.2 mmol) and Fe (8.0 mg, 0.1 mmol) in CCl.sub.4 (4.0 mL) at −10° C. over a period of 30 min and the mixture was then allowed to warm to RT and stirred overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was washed with a saturated aqueous Na.sub.2SO.sub.3 solution (×2), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated to give the title compound (580 mg, 80%) as a white solid. LCMS-C: R.sub.t 2.12 min; m/z 229.9 [M+H].sup.+.

b) 2-Fluoro-4-methoxy-[1,1biphenyl]-3-carbonitrile I79

[0438] To a solution of 3-bromo-2-fluoro-6-methoxybenzonitrile I78 (600 mg, 2.6 mmol), phenylboronic acid (636 mg, 5.2 mmol) and Na.sub.2CO.sub.3 (829 mg, 7.8 mmol) in 1,4-dioxane (40 mL) and water (10 mL) under N.sub.2 was added Pd(PPh.sub.3).sub.4 (300 mg, 0.26 mmol) and the mixture was heated at 100° C. overnight. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1 to 3/1) to give the title compound (538 mg, 90%) as a white solid. LCMS-C: R.sub.t 2.43 min; m/z 228.0 [M+H].sup.+.

c) 4-Methoxy-7-phenylbenzo[d]isoxazol-3-amine I80

[0439] To a solution of acetohydroxamic acid (533 mg, 7.11 mmol) in anhydrous DMF (30 mL) at RT was added potassium tert-butoxide (797 mg, 7.11 mmol) and the mixture was stirred at RT for 1 h. 2-Fluoro-4-methoxy-[1,1biphenyl]-3-carbonitrile I79 (538 mg, 2.37 mmol) was then added and the mixture was heated at 60° C. overnight. Water was added and the mixture was extracted with EtOAc (30 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1 to 5/1) to give the title compound (413 mg, 72%) as an orange solid. LCMS-C: R.sub.t 1.33 min; m/z 209.0 [M+H].sup.+. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.84-7.79 (m, 2H), 7.61 (d, J=8.1 Hz, 1H), 7.46 (t, J=7.7 Hz, 2H), 7.38-7.32 (m, 1H), 6.67 (d, J=8.2 Hz, 1H), 4.00 (s, 3H).

xxxvii) 4-Methoxy-7-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-amine I82

[0440] ##STR00064##

a) 2-Fluoro-6-methoxy-3-(1-methyl-1H-pyrazol-4-yl)benzonitrile I81

[0441] To a solution of 3-bromo-2-fluoro-6-methoxybenzonitrile I78 (720 mg, 3.31 mmol), 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (1.30 g, 6.26 mmol) and Na.sub.2CO.sub.3 (995 mg, 9.39 mmol) in 1,4-dioxane (50 mL) and water (10 mL) under N.sub.2 was added Pd(PPh.sub.3).sub.4 (358 mg, 0.30 mmol) and the mixture was heated at 100° C. overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/1) to give the title compound (485 mg, 63%) as a white solid. LCMS-C: R.sub.t 1.26 min; m/z 232.0 [M+H].sup.+.

b) 4-Methoxy-7-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-amine I82

[0442] To a solution of acetohydroxamic acid (474 mg, 6.24 mmol) in anhydrous DMF (20 mL) at RT was added potassium tert-butoxide (700 mg, 6.24 mmol) and the mixture was stirred at RT for 1 h. 2-Fluoro-6-methoxy-3-(1-methyl-1H-pyrazol-4-yl)benzonitrile I81 (485 mg, 2.04 mmol) was then added and the mixture was heated at 60° C. overnight. Water was added and the mixture was extracted with EtOAc (30 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=50/1) to give the title compound (225 mg, 45%) as a yellow solid. LCMS-C: R.sub.t 0.46 min; m/z 245.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.19 (s, 1H), 7.95 (s, 1H), 7.69 (d, J=8.2 Hz, 1H), 6.74 (d, J=8.2 Hz, 1H), 6.00 (s, 2H), 3.91 (s, 3H), 3.90 (s, 3H).

xxxviii) 5-Chloro-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I83

[0443] ##STR00065##

[0444] To a solution of 4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (300 mg, 1.4 mmol) in DMF (10 mL) was added NCS (192 mg, 1.4 mmol) and the mixture was heated at 50° C. for 2 h. The mixture was diluted with EtOAc (100 mL) and washed with H.sub.2O (40 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=7/1 to 5/1) to give the title compound (190 mg, 54%) as a white solid. LCMS-C: R.sub.t 1.21 min; m/z 242.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.32 (s, 1H), 6.19 (s, 2H), 4.55 (s, 2H), 3.93 (s, 3H), 3.41 (s, 3H).

xxxix) 4-Methoxy-6-(oxazol-2-yl)benzo[d]isoxazol-3-amine I86

[0445] ##STR00066##

a) 2-(Tributylstannyl)oxazole I84

[0446] To a solution of oxazole (500 mg, 7.25 mmol) in THF (15 mL) at −78° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexanes, 2.9 mL, 7.32 mmol) dropwise and the mixture was stirred at −78° C. for 30 min. Tributylchlorostannane (1.96 mL, 7.25 mmol) was then added and the mixture was allowed to warm to RT and stirred for 1 h. The solvent was removed under reduced pressure and residue was taken up in hexanes (50 mL). The resulting precipitate was removed by filtration and the filtrate was concentrated under reduced pressure to give the title compound (2.0 g, 77%) as colorless oil. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.20 (s, 1H), 7.20 (s, 1H), 1.59-1.49 (m, 6H), 1.31-1.26 (m, 6H), 1.16-1.10 (m, 6H), 0.83 (t, J=7.3 Hz, 9H).

b) 2-Fluoro-6-methoxy-4-(oxazol-2-yl)benzonitrile I85

[0447] To a solution of 4-bromo-2-fluoro-6-methoxybenzonitrile I5 (305 mg, 1.33 mmol) in 1,4-dioxane (25 mL) was added 2-(tributylstannyl)oxazole 184 (1.43 g, 3.98 mmol) and Pd(PPh.sub.3).sub.4 (154 mg, 0.133 mmol) and the mixture was heated at 90° C. overnight. The mixture was diluted with water and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by column chromatography (Pet. ether/EtOAc=8/1) to give the title compound (370 mg, 96%) as a white solid. LCMS-C: R.sub.t 1.86 min; m/z 218.9 [M+H].sup.+.

c) 4-Methoxy-6-(oxazol-2-yl)benzo[d]isoxazol-3-amine I86

[0448] To a solution of acetohydroxamic acid (382 mg, 5.09 mmol) in DMF (25 mL) at 0° C. was added potassium tert-butoxide (570 mg, 5.09 mmol) and the mixture was stirred at RT for 1 h. 2-Fluoro-6-methoxy-4-(oxazol-2-yl)benzonitrile I85 (370 mg, 1.7 mmol) was then added and the mixture was heated at 60° C. for 2 h. The mixture was diluted with EtOAc and washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated to give the title compound (100 mg, 26%) as a yellow solid. LCMS-C: R.sub.t 0.57 min; m/z 232.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.29 (s, 1H), 7.56 (s, 1H), 7.47-7.42 (m, 1H), 7.27 (s, 1H), 6.09 (s, 2H), 4.00 (s, 3H).

xl) 6-(Oxazol-2-yl)benzo[d]isoxazol-3-amine I90

[0449] ##STR00067##

a) 4-Cyano-3-fluorobenzoyl chloride I87

[0450] To a solution of 4-cyano-3-fluorobenzoic acid (1.0 g, 6.1 mmol) in DCM (20 mL) at 0° C. was added DMF (0.1 mL) and oxalyl chloride (1.86 g, 12.1 mmol) dropwise and the mixture was stirred at RT overnight. The solvent was removed under reduced pressure to give the title compound (1.2 g) as a white solid, which was used directly in the next step without further purification.

b) 4-Cyano-N-(2,2-dimethoxyethyl)-3-fluorobenzamide I88

[0451] To a solution of 4-cyano-3-fluorobenzoyl chloride I87 (1.1 g, 6.06 mmol) and Et.sub.3N (1.84 g, 18 mmol) in DCM (20 mL) at 0° C. was added 2,2-dimethoxyethanamine (955 mg, 9.1 mmol) and the mixture was stirred for 2 h. The mixture was poured into water and extracted with EtOAc. The organic extract was washed with water and brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=1/1, v/v) to give the title compound (1.2 g, 78%) as a white solid. LCMS-D: R.sub.t 1.55 min, m/z 274.9 [M+Na].sup.+.

c) 3-Amino-N-(2,2-dimethoxyethyl)benzo[d]isoxazole-6-carboxamide I89

[0452] To a solution of acetohydroxamic acid (448 mg, 5.95 mmol) in DMF (30 mL) at 0° C. was added t-BuOK (889 mg, 7.92 mmol) portion-wise and the mixture was stirred for 1 h. 4-Cyano-N-(2,2-dimethoxyethyl)-3-fluorobenzamide I88 (500 mg, 1.98 mmol) was then added and the mixture was heated at 40° C. overnight. The mixture was poured into water and extracted with EtOAc. The organic layer was washed with water and brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=1/1, v/v) to give the title compound (380 mg, 72%) as a yellow solid. LCMS-D: R.sub.t 0.59 min, m/z 287.9 [M+Na].sup.+.

d) 6-(Oxazol-2-yl)benzo[d]isoxazol-3-amine I90

[0453] A mixture of 3-amino-N-(2,2-dimethoxyethyl)benzo[d]isoxazole-6-carboxamide I89 (240 mg, 0.9 mmol) and P.sub.2O.sub.5 (193 mg, 1.36 mmol) in methanesulfonic acid (10 mL) was heated at 150° C. under microwave irradiation for 30 min. The mixture was poured into water, made basic with aqueous KOH and extracted with EtOAc. The organic extract was washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1, v/v) to give the title compound (50 mg, 28%) as a solid. LCMS-D: R.sub.t 1.57 min, m/z 201.9 [M+H].sup.+.

xli) 5-Ethyl-1-methyl-2-oxo-1,2-dihydropyridine-3-sulfonyl chloride I94

[0454] ##STR00068##

a) 5-Ethyl-2-methoxypyridine I91

[0455] To a solution of 5-bromo-2-methoxypyridine (10.2 g, 54.25 mmol) in THF (200 mL) at −78° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexane, 24.0 mL, 60.0 mmol) dropwise and the mixture was stirred at −78° C. for 1.5 h. Iodoethane (12.7 g, 81.4 mmol) was then added dropwise and the mixture was stirred at −78° C. for 20 min, then warmed to RT and stirred for 30 min. The reaction was quenched with water (5 mL) and the solvent was removed under reduced pressure. The residue was dissolved in DCM, washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (2.8 g, 38%) as a colorless oil. LCMS-D: R.sub.t 1.80 min; m/z 138.1 [M+H].sup.+.

b) 5-Ethylpyridin-2(1H)-one I92

[0456] A solution of 5-ethyl-2-methoxypyridine I91 (1.6 g, 11.66 mmol) in conc. HCl (30 mL) was heated at 100° C. overnight. The mixture was concentrated under reduced pressure and the residue was purified by column chromatography (DCM/MeOH=20/1) to give the title compound (800 mg, 56%) as a white solid, which was used directly in the next step.

c) 5-Ethyl-1-methylpyridin-2(1H)-one I93

[0457] A mixture of 5-ethylpyridin-2(1H)-one I92 (800 mg, 6.5 mmol), K.sub.2CO.sub.3 (1.8 g, 13 mmol) and iodomethane (1.85 g, 13 mmol) in MeOH (20 mL) was heated at 50° C. under N.sub.2 overnight. The solvent was removed under reduced pressure and the residue was dissolved in DCM (100 mL), washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=40/1) to give the title compound (500 mg, 56%) as a colorless oil. LCMS-D: R.sub.t 0.68 min; m/z 138.1 [M+H].sup.+.

d) 5-Ethyl-1-methyl-2-oxo-1,2-dihydropyridine-3-sulfonyl chloride I94

[0458] A mixture of chlorosulfonic acid (6 mL) and 5-ethyl-1-methylpyridin-2(1H)-one I93 (0.6 g, 4.37 mmol) was heated at 150° C. under N.sub.2 for 3 h, then allowed to cool to RT and poured onto ice (100 g). The mixture was extracted with DCM (50 mL×3) and the combined organic extracts were washed twice with ice-cold water, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/1 to 20/1) to give the title compound (200 mg, 12%) as a yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.87-7.84 (m, 1H), 7.71 (s, 1H), 3.47 (s, 3H), 2.39 (q, J=7.6 Hz, 2H), 1.09 (t, J=7.5 Hz, 3H). LCMS-D: R.sub.t 1.58 min; m/z 236.0 [M+H].sup.+.

xlii) 5-Bromo-2,3-dihydrobenzofuran-7-sulfonyl chloride I95

[0459] ##STR00069##

[0460] 5-Bromo-2,3-dihydrobenzofuran (2.0 g, 10 mmol) was added slowly to chlorosulfonic acid (6 mL) at −5° C. and the mixture was stirred at −5° C. for 30 min. The mixture was poured into ice-cold water (100 mL) and extracted with EtOAc (180 mL×2). The combined organic extracts were washed with water (250 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=15/1) to give the title compound (1.45 g, 48%) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.80-7.76 (m, 1H), 7.63-7.58 (m, 1H), 4.91 (m, 2H), 3.35 (m, 2H). LCMS-D: R.sub.t 2.74 min; m/z 318.8/320.8 [M+Na].sup.+.

xliii) 4,6-Dimethoxy-2,3-dihydro-1H-indene-5-sulfonyl chloride I98

[0461] ##STR00070##

a) 5,7-Dimethoxy-2,3-dihydro-1H-inden-1-one I96

[0462] A mixture of 3-(3,5-dimethoxyphenyl)propanoic acid (5 g, 23.8 mmol) and methanesulfonic acid (24 mL) was heated at 90° C. for 10 min then allowed to cool to RT and poured into water. The mixture was adjusted to pH 9 with 10 M aq. KOH and extracted with EtOAc (×5). The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (3.5 g, 76%) as a white solid. LCMS-D: R.sub.t 1.76 min; m/z 193.1 [M+H].sup.+.

b) 4,6-Dimethoxy-2,3-dihydro-1H-indene I97

[0463] A mixture of 5,7-dimethoxy-2,3-dihydro-1H-inden-1-one I96 (3.0 g, 15.6 mmol) and triethylsilane (7.3 g, 62.4 mmol) in TFA (20 mL) was stirred at RT under N.sub.2 for 11 h. The mixture was concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=20/1) to give the title compound (2.0 g, 72%) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 6.42 (s, 1H), 6.29 (d, J=2.0 Hz, 1H), 3.81 (s, 3H), 3.80 (s, 3H), 2.89 (t, J=7.5 Hz, 2H), 2.80 (t, J=7.3 Hz, 2H), 2.13-2.02 (m, 2H).

c) 4,6-Dimethoxy-2,3-dihydro-1H-indene-5-sulfonyl chloride I98

[0464] To a solution of 4,6-dimethoxy-2,3-dihydro-1H-indene I97 (1 g, 5.6 mmol) and TMEDA (0.72 g, 6.17 mmol) in n-hexane (20 mL) at −70° C. was added n-BuLi (2.5 M in hexane, 2.5 mL, 6.17 mmol) dropwise and the mixture was allowed to warm to 0° C. and stirred for 2 h. The mixture was then re-cooled to −65° C., bubbled with SO.sub.2 gas for 20 min, then allowed to warm slowly to 10° C. The resulting precipitate was collected by filtration and washed with dry diethyl ether. The solid was suspended in n-hexane (20 mL), cooled to 0° C. and SO.sub.2Cl.sub.2 (0.83 g, 6.2 mmol) was added dropwise. The mixture was stirred at 0° C. under N.sub.2 for 1 h, then filtered. The filter cake was dissolved in diethyl ether and washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (550 mg, 35%) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 6.72 (s, 1H), 3.95 (s, 3H), 3.94 (s, 3H), 2.96 (q, J=7.6 Hz, 4H), 2.18-2.08 (m, 2H).

xliv) 2-Methoxy-5-phenoxybenzenesulfonyl chloride I100

[0465] ##STR00071##

a) 2-Methoxy-5-phenoxybenzenesulfonic acid I99

[0466] To a solution of 1-methoxy-4-phenoxybenzene (2 g, 10 mmol) in DCM (15 mL) at 0° C. was added a solution of chlorosulfonic acid (0.35 mL) in DCM (10 mL) dropwise and the mixture was stirred at 0° C. for 15 min. The mixture was poured slowly into ice-cold water (100 mL) and then concentrated under reduced pressure. The residue was rinsed with DCM (100 mL×2) and dried to give the title compound (560 mg, 40%) as an off-white solid. LCMS-D: R.sub.t 0.62 min; m/z 281.0 [M+H].sup.+.

b) 2-Methoxy-5-phenoxybenzenesulfonyl chloride I100

[0467] A mixture of 2-methoxy-5-phenoxybenzenesulfonic acid I99 (250 mg, 0.9 mmol) and PCl.sub.5 (284 mg, 1.3 mmol) in POCl.sub.3 (3 mL) was heated at 90° C. under N.sub.2 for 1 h. The mixture was then added slowly to ice-cold water (20 mL) and extracted with DCM (15 mL×2). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (51 mg, 18%) as a yellow oil. LCMS-D: R.sub.t 2.72 min; m/z 295.0 [M−Cl+OCH.sub.3].sup.+, 317.0 [M−Cl+OCH.sub.3+Na].sup.+.

xlv) 2,6-Dimethoxy-3-(trifluoromethyl)benzenesulfonyl chloride I102

[0468] ##STR00072##

a) 2,4-Dimethoxy-1-(trifluoromethyl)benzene I101

[0469] To a mixture of (2,4-dimethoxyphenyl)boronic acid (3.0 g, 16.5 mmol), CF.sub.3SO.sub.2Na (18.0 g, 115.4 mmol), Cu(OAc).sub.2 (748 mg, 4.1 mmol), imidazole (281 mg, 4.1 mmol), 2,4,6-collidine (3.0 g, 33.0 mmol) and NH.sub.4Cl (11.3 g, 206.0 mmol) in water (16.5 mL) and DCM (100 mL) at 0° C. was added t-BuOOH (3.6 mL, 4.1 mmol) dropwise and the mixture was stirred at RT for 16 h. The layers were then separated and the aqueous layer was extracted with DCM. The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether) to give the title compound (900 mg, 27%) as an oil. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.42-7.36 (m, 1H), 6.45-6.37 (m, 2H), 3.79 (s, 3H), 3.76 (s, 3H).

b) 2,6-Dimethoxy-3-(trifluoromethyl)benzenesulfonyl chloride I102

[0470] To a solution of 2,4-dimethoxy-1-(trifluoromethyl)benzene I101 (1.5 g, 7.3 mmol) and TMEDA (0.93 g, 8.0 mmol) in n-hexane (30 mL) at −78° C. under N.sub.2 was added n-BuLi (2.5 M in hexane, 3.2 mL, 8.0 mmol) dropwise and the mixture was stirred at 0° C. for 1 h. SO.sub.2 gas was then bubbled through the mixture at −78° C. for 20 minutes and then allowed to warm to 0° C. and stirred for 1 h. The resulting precipitate was collected by filtration and washed with hexane. The filter cake was suspended in n-hexane (30 mL), cooled to 0° C. and SO.sub.2Cl.sub.2 (1.1 g, 8.0 mmol) was added dropwise. The mixture was stirred at 0° C. for 1 h and the solids were collected by filtration and washed with cold n-hexane. The filter cake was dissolved in ether and washed with water. The aqueous phase was extracted with ether and the combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=5/1) to give the title compound (1.5 g, 68%) as a yellow solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.90-7.84 (m, 1H), 6.98-6.92 (m, 1H), 4.09 (s, 3H), 4.04 (s, 3H).

xlvi) 3-Ethyl-2,6-dimethoxybenzenesulfonyl chloride I106

[0471] ##STR00073##

a) 2,4-Dimethoxy-1-vinylbenzene I103

[0472] A suspension of 1-bromo-2,4-dimethoxybenzene (4.0 g, 18.4 mmol), 4,4,5,5-tetramethyl-2-vinyl-1,3,2-dioxaborolane (3.4 g, 22.1 mmol), Pd(dppf)Cl.sub.2.DCM (753 mg, 0.92 mmol) and K.sub.2CO.sub.3 (7.6 g, 55.2 mmol) in 1,4-dioxane (40 mL) and water (10 mL) was heated at 90° C. under N.sub.2 overnight. The mixture was filtered through a pad of Celite and rinsed with EtOAc. The filtrate was diluted with water and extracted with EtOAc (60 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether) to give the title compound (2.6 g, 86%) as a yellow oil. LCMS-D: R.sub.t 2.28 min; m/z 165.0 [M+H].sup.+.

b) Ethyl-2,4-dimethoxybenzene I104

[0473] To a solution of 2,4-dimethoxy-1-vinylbenzene I103 (2.6 g, 15.8 mmol) in EtOAc (50 mL) was added 10% Pd/C (300 mg) and the mixture was stirred at RT under a H.sub.2 atmosphere overnight. The catalyst was removed by filtration through Celite and rinsed with EtOAc. The filtrate was concentrated under reduced pressure to give the title compound (2.0 g, 83%) as a yellow oil. LCMS-D: R.sub.t 2.39 min; m/z 167.1 [M+H].sup.+.

c) 3-Ethyl-2,6-dimethoxybenzenesulfonic acid I105

[0474] Prepared from ethyl-2,4-dimethoxybenzene I104 according to the procedure described for 2,6-dimethoxybenzenesulfonyl chloride I111. The product obtained was found to be mostly 3-ethyl-2,6-dimethoxybenzenesulfonic acid. LCMS-D: R.sub.t 2.36 min; m/z 247.0 [M+H].sup.+.

d) 3-Ethyl-2,6-dimethoxybenzenesulfonyl chloride I106

[0475] A mixture of 3-ethyl-2,6-dimethoxybenzenesulfonic acid I105 (300 mg, 1.22 mmol) and thionyl chloride (6 mL) was heated at 95° C. for 3 h then concentrated under reduced pressure to give the title compound (322 mg, 100%) as a brown oil, which was used directly in the next step.

xlvii) 7-Methoxyquinoline-8-sulfonyl chloride I107

[0476] ##STR00074##

[0477] Chlorosulfonic acid (1.8 g, 15.7 mmol) was added dropwise to 7-methoxyquinoline (500 mg, 3.14 mmol) at 0° C. and the mixture was heated at 100° C. for 1 h. The mixture allowed to cool to RT, poured onto ice and then neutralised with a saturated aqueous NaHCO.sub.3 solution. The mixture was extracted with EtOAc (30 mL×3) and the combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (280 mg, 34%) as a yellow solid. LCMS-D: R.sub.t 0.27 min; m/z 239.9 [M-C.sub.1+H.sub.2O].sup.+

xlviii) 6-Methoxy-2,3-dihydro-1H-indene-5-sulfonyl chloride I108

[0478] ##STR00075##

[0479] To a solution of 5-methoxy-2,3-dihydro-1H-indene (3.1 g, 20.9 mmol) in DCM (40 mL) at −5° C. under N.sub.2 was added chlorosulfonic acid (6.5 g, 62.8 mmol) dropwise and the mixture was stirred at −5° C. for 40 min. The reaction was quenched with ice water (20 mL) and the mixture was extracted with EtOAc (30 mL×2). The combined organic extracts were washed with water (50 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=20/1) to give the title compound (3.1 g, 60%) as a white solid, which was used directly in the next step. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.77 (d, J=1.1 Hz, 1H), 6.98 (s, 1H), 4.02 (s, 3H), 2.99 (t, J=7.5 Hz, 2H), 2.91 (t, J=7.4 Hz, 2H), 2.19-2.10 (m, 2H).

xlix) 3-Methoxy-5,6,7,8-tetrahydronaphthalene-2-sulfonyl chloride I109

[0480] ##STR00076##

[0481] Prepared from 6-methoxy-1,2,3,4-tetrahydronaphthalene and chlorosulfonic according to the procedure described for 6-methoxy-2,3-dihydro-1H-indene-5-sulfonyl chloride I108 and used directly in the next step without purification.

1) 4-Bromo-2-methoxybenzenesulfonyl chloride I110

[0482] ##STR00077##

[0483] 1-Bromo-3-methoxybenzene (15.0 g, 80 mmol) was added slowly to chlorosulfonic acid (16 mL) at −5° C. and the mixture was stirred at −5° C. for 5 min. The mixture was poured into ice-cold water (50 mL) and extracted with EtOAc (80 mL×2). The combined organic extracts were washed with water (150 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1) to give the title compound (2.6 g, 17%) as yellow solid, which was used directly in the next step.

li) 2,6-Dimethoxybenzenesulfonyl chloride I111

[0484] ##STR00078##

[0485] To a solution of 1,3-dimethoxybenzene (5.0 g, 36 mmol) and TMEDA (4.6 g, 39.8 mmol) in n-hexane (100 mL) at 0° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexanes, 16.0 mL, 39.8 mmol) dropwise while keeping the internal reaction temperature below 5° C. The mixture was stirred at 0° C. for 20 min then cooled to −78° C. and bubbled with SO.sub.2 gas for 20 min. The mixture was then allowed to warm slowly to 10° C. and the resulting precipitate was collected by filtration and washed with dry diethyl ether. The solid was suspended in n-hexane (100 mL), cooled to 0° C. and a solution of SO.sub.2Cl.sub.2 (4.9 g, 36 mmol) in n-hexane (20 mL) was added dropwise while keeping the internal temperature below 3° C. The mixture was then stirred at 0° C. for 1 h and the solids were collected by filtration and washed with cold n-hexane. The solids were then partitioned between diethyl ether and water, the layers were separated and the aqueous layer was further extracted with diethyl ether. The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (4.0 g, 47%) as a white solid. 1H NMR (400 MHz, CDCl.sub.3) δ 7.54 (t, J=8.4 Hz, 1H), 6.66 (d, J=8.4 Hz, 2H), 3.97 (s, 6H).

lii) 5-Ethyl-2-methoxybenzenesulfonyl chloride I112

[0486] ##STR00079##

[0487] 1-Ethyl-4-methoxybenzene (5.0 g, 37 mmol) was added dropwise to chlorosulfonic acid (20 mL) at 0° C. and the mixture was stirred at RT for 2 h then poured onto ice and extracted with EtOAc (50 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 30/1) to give the title compound (4.6 g, 53%) as a white solid. LCMS-D: R.sub.t 2.70 min; m/z 256.9 [M+Na].sup.+.

liii) 2,4-Dimethoxy-[1,1biphenyl]-3-sulfonyl chloride I114

[0488] ##STR00080##

a) 2,4-Dimethoxy-1,1biphenyl I113

[0489] A suspension of 1-bromo-2,4-dimethoxybenzene (5.0 g, 23.0 mmol), phenylboronic acid (3.4 g, 27.6 mmol), Pd(PPh.sub.3).sub.4 (1.3 g, 1.15 mmol) and potassium carbonate (7.3 g, 69.0 mmol) in 1,4-dioxane (30 mL) and water (6 mL) was heated at 90° C. under N.sub.2 for 16 h. The mixture was filtered through a pad of Celite and washed with EtOAc. The filtrate was diluted with water and extracted with EtOAc (30 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 10/1) to give the title compound (2.8 g, 57%) as a yellow oil. LCMS-D: R.sub.t 2.46 min; m/z 215.0 [M+H].sup.+.

b) 2,4-Dimethoxy-[1,1biphenyl]-3-sulfonyl chloride I114

[0490] To a solution of 2,4-dimethoxy-1,1biphenyl I113 (1.0 g, 4.70 mmol) and TMEDA (601 mg, 5.20 mmol) in n-hexane (40 mL) at 0° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexanes, 2.1 mL, 5.20 mmol) dropwise while keeping the internal reaction temperature below 5° C. The mixture was stirred at 0° C. for 20 min then cooled to −70° C. and bubbled with SO.sub.2 gas for 20 min. The mixture was then allowed to warm slowly to 10° C. and the resulting precipitate was collected by filtration and washed with dry diethyl ether. The solid was suspended in n-hexane (40 mL), cooled to 0° C. and a solution of SO.sub.2Cl.sub.2 (634 mg, 4.7 mmol) in n-hexane (5 mL) was added dropwise while keeping the internal temperature below 3° C. The mixture was then stirred at 0° C. for 1 h and the solids were collected by filtration and washed with cold n-hexane. The solids were then partitioned between diethyl ether and water, the layers were separated and the aqueous layer was further extracted with diethyl ether. The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (590 mg, 40%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.48-7.35 (m, 4H), 7.34-7.21 (m, 2H), 6.87 (m, 1H), 3.76 (s, 3H), 3.29 (s, 3H).

liv) 3,5-Dimethoxy-[1,1biphenyl]-4-sulfonyl chloride I116

[0491] ##STR00081##

a) 3,5-Dimethoxy-1,1biphenyl I115

[0492] A suspension of 1-bromo-3,5-dimethoxybenzene (5.0 g, 23.0 mmol), phenylboronic acid (2.8 g, 23.0 mmol), Pd(dppf)Cl.sub.2 (0.57 g, 0.69 mmol) and potassium carbonate (4.8 g, 34.6 mmol) in 1,4-dioxane (80 mL) and water (20 mL) was heated at 90° C. under N.sub.2 for 4 h. The mixture was diluted with water, extracted with EtOAc and the combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=500/1 to 200/1 to 100/1) to give the title compound (5.2 g, 100%) as a white solid. LCMS-C: R.sub.t 2.47 min; m/z 215.0 [M+H].sup.+.

b) 3,5-Dimethoxy-[1,1biphenyl]-4-sulfonyl chloride I116

[0493] Prepared from 3,5-dimethoxy-1,1biphenyl I115 according to the procedure described for 2,4-dimethoxy-[1,1biphenyl]-3-sulfonyl chloride I114. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.62-7.55 (m, 2H), 7.54-7.44 (m, 3H), 6.81 (s, 2H), 4.04 (s, 6H).

lv) 4-Methoxy-6-((2,2,2-trifluoroethoxy)methyl)benzo[d]isoxazol-3-amine I118

[0494] ##STR00082##

a) 2-Fluoro-6-methoxy-4-((2,2,2-trifluoroethoxy)methyl)benzonitrile I117

[0495] To a solution of 2-fluoro-4-(hydroxymethyl)-6-methoxybenzonitrile I7 (500 mg, 2.76 mmol) in dry THF (50 mL) at 0° C. under N.sub.2 was added NaH (60% w/w dispersion in oil, 331 mg, 8.28 mmol) followed by 2,2,2-trifluoroethyl trifluoromethanesulfonate (1.9 g, 8.28 mmol) and the mixture was stirred at 0° C. for 1 h, then allowed to warm to RT and stirred overnight. The mixture was diluted with water and extracted with EtOAc. The organic extract was washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The reaction was repeated two times using 2-fluoro-4-(hydroxymethyl)-6-methoxybenzonitrile I7 (100 mg, 0.55 mmol) and the three batches were combined and purified by column chromatography (Pet. ether/EtOAc=5/1 to 2/1) to give the title compound (577 mg, 57%) as a white solid. LCMS-C: R.sub.t 2.43 min; m/z 263.9 [M+H].sup.+.

b) 4-Methoxy-6-((2,2,2-trifluoroethoxy)methyl)benzo[d]isoxazol-3-amine I118

[0496] A suspension of acetohydroxamic acid (86 mg, 1.14 mmol) and t-BuOK (128 mg, 1.14 mmol) in anhydrous DMF (10 mL) was stirred at RT for 1 h. 2-Fluoro-6-methoxy-4-((2,2,2-trifluoroethoxy)methyl)benzonitrile I117 (100 mg, 0.38 mmol) was then added and the mixture was stirred at RT overnight. The mixture was diluted with water and extracted with EtOAc. The organic extract was washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The reaction was scaled up accordingly using 2-fluoro-6-methoxy-4-((2,2,2-trifluoroethoxy)methyl)benzonitrile I117 (400 mg, 1.52 mmol) and the two batches were combined and purified by column chromatography (Pet. ether/EtOAc=20/1 to 5/1) to give the title product (350 mg, 67%) as a yellow solid. LCMS-C: R.sub.t 2.08 min; m/z 277.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 6.96 (s, 1H), 6.68 (s, 1H), 5.94 (s, 2H), 4.74 (s, 2H), 4.13 (q, J=9.4 Hz, 2H), 3.90 (s, 3H).

lvi) 6-(Difluoromethoxy)-4-methoxybenzo[d]isoxazol-3-amine I121

[0497] ##STR00083##

a) 4-(Difluoromethoxy)-2,6-difluorobenzonitrile I119

[0498] To a suspension of KOH (22.0 g, 392 mmol) in acetonitrile (30 mL) and water (30 mL) at −20° C. was added 2,6-difluoro-4-hydroxybenzonitrile (3.1 g, 20.0 mmol) portion-wise followed by diethyl (bromodifluoromethyl)phosphonate (10.0 g, 37.4 mmol) and the mixture was stirred at RT overnight. Water was added and the mixture was extracted with EtOAc (50 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (4.0 g, 97%) as a colorless oil. LCMS-C: R.sub.t 2.11 min; m/z 205.9 [M+H].sup.+.

b) 4-(Difluoromethoxy)-2-fluoro-6-methoxybenzonitrile I120

[0499] To a solution of 4-(difluoromethoxy)-2,6-difluorobenzonitrile I119 (2.52 g, 12.3 mmol) in dry THF (30 mL) was added NaOMe (1.32 g, 24.57 mmol) portion-wise and the mixture was warmed at 40° C. overnight. Water was added and the mixture was extracted with EtOAc (30 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1 to 5/1) to give the title compound (663 mg, 25%) as a white solid. LCMS-C: R.sub.t 2.11 min; m/z 217.9 [M+H].sup.+.

c) 6-(Difluoromethoxy)-4-methoxybenzo[d]isoxazol-3-amine I121

[0500] A suspension of acetohydroxamic acid (680 mg, 9.15 mmol) and t-BuOK (1.03 g, 9.15 mmol) in anhydrous DMF (50 mL) was stirred at RT for 1 h. 5-(Difluoromethoxy)-1-fluoro-2-isocyano-3-methoxybenzene I120 (663 mg, 3.05 mmol) was then added and the mixture was stirred at RT overnight. The mixture was diluted with water and extracted with EtOAc (30 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1 to 8/1) to give the title compound (186 mg, 26%) as light orange solid. LCMS-C: R.sub.t 1.14 min; m/z 231.0 [M+H].sup.+.

lviii) 5-Methyl-6-(pyridin-2-yl)benzo[d]isoxazol-3-amine I124

[0501] ##STR00084##

a).SUB.2.-Fluoro-5-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I122

[0502] A mixture of 4-bromo-2-fluoro-5-methylbenzonitrile (500 mg, 2.34 mmol), 4,4,445,5,55octamethyl-2,2bi(1,3,2-dioxaborolane) (1.78 g, 2.34 mmol), potassium acetate (918 mg, 9.36 mmol) and Pd(dppf)Cl.sub.2 (188 mg, 0.23 mmol) in 1,4-dioxane (20 mL) was heated at reflux under N.sub.2 for 3 h. The mixture was diluted with water, extracted with EtOAc (300 mL) and the organic layer was washed with water (50 mL×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.56 g, 88%), which was used in the next step without further purification. LCMS-C: R.sub.t 2.75 min; m/z 262.0 [M+H].sup.+.

b) 2-Fluoro-5-methyl-4-(pyridin-2-yl)benzonitrile I123

[0503] To a solution of 2-fluoro-5-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile I122 (1.32 g, 5.1 mmol) and 2-bromopyridine (1.69 g, 7.65 mmol) in 1,4-dioxane (50 mL) and water (10 mL) under N.sub.2 was added Pd(PPh.sub.3).sub.4 (589 mg, 0.5 mmol) and Na.sub.2CO.sub.3 (2.16 g, 20.4 mmol) and the mixture was heated at 100° C. for 3 h. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=8/1 to 3/1) to give the title compound (440 mg, 88%) as a red solid. LCMS-C: R.sub.t 1.09 min; m/z 213.0 [M+H].sup.+.

c) 5-Methyl-6-(pyridin-2-yl)benzo[d]isoxazol-3-amine I124

[0504] A suspension of acetohydroxamic acid (255 mg, 3.39 mmol) and t-BuOK (381 mg, 3.39 mmol) in anhydrous DMF (30 mL) was stirred at 0° C. for 1 h. 2-Fluoro-5-methyl-4-(pyridin-2-yl)benzonitrile I123 (240 mg, 1.13 mmol) was then added and the mixture was allowed to warm to RT and stirred overnight. Water was added and the mixture was extracted with EtOAc (50 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=8/1 to 3/1) to give the title compound (180 mg, 73%) as a white solid. LCMS-C: R.sub.t 0.50 min; m/z 226.0 [M+H].sup.+.

lix) 7-Bromo-5-methylbenzo[d]isoxazol-3-amine I129

[0505] ##STR00085##

a) 3-Bromo-2-fluoro-5-methylbenzoic acid I125

[0506] To a solution of 2-bromo-1-fluoro-4-methylbenzene (10.0 g, 53 mmol) and diisopropylamine (5.9 g, 58 mmol) in anhydrous THF (200 mL) at −78° C. under N.sub.2 was added n-BuLi (2.5 M solution in hexanes, 25.6 mL, 64.0 mmol) dropwise and the mixture stirred at −78° C. for 1 h. Excess solid CO.sub.2 (dry ice) was added and stirring was continued at −78° C. for 3 h. The mixture was diluted with water (500 mL) and extracted with EtOAc (500 mL). The organic layer was washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (12.3 g, 100%) as a brown solid, which was used in the next step without further purification. LCMS-C: R.sub.t 2.03 min; m/z 232.8 [M+H].sup.+.

b) 3-Bromo-2-fluoro-5-methylbenzoyl chloride I126

[0507] To a solution of 3-bromo-2-fluoro-5-methylbenzoic acid I125 (12.3 g, 53 mmol) and DMF (4 drops) in DCM (100 mL) at RT under N.sub.2 was added oxalyl chloride (13.0 g, 106 mmol) dropwise and the mixture was stirred for 2 h. The mixture was concentrated under reduced pressure to give the title compound (14.0 g, 100%) as a brown solid, which was used in the next step without further purification.

c) 3-Bromo-2-fluoro-5-methylbenzamide I127

[0508] A solution of 3-bromo-2-fluoro-5-methylbenzoyl chloride I126 (14.0 g, 53 mmol) in DCM (100 mL) was added dropwise to a 30% aqueous ammonium hydroxide solution (100 mL) and the mixture was stirred for 2 h. The mixture was diluted with EtOAc (200 mL), washed with water (200 mL×3), brine and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (12.0 g, 97%) as a brown solid, which was used in the next step without further purification. LCMS-C: R.sub.t 1.01 min; m/z 231.9 [M+H].sup.+.

d) 3-bromo-2-fluoro-5-methylbenzonitrile I128

[0509] A solution of 3-bromo-2-fluoro-5-methylbenzamide I127 (10.0 g, 43.0 mmol) and thionyl chloride (15.4 g, 129 mmol) in DMF (100 mL) was heated at 100° C. for 3 h. The mixture was diluted with EtOAc (200 mL) and washed with water (400 mL×5), brine and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (5.0 g, 54%) as a brown solid, which was used in the next step without further purification. LCMS-C: R.sub.t 2.50 min; m/z 213.9 [M+H].sup.+.

e) 7-Bromo-5-methylbenzo[d]isoxazol-3-amine I129

[0510] A suspension of acetohydroxamic acid (5.27 g, 70.2 mmol) and t-BuOK (7.88 g, 70.2 mmol) in anhydrous DMF (200 mL) was stirred at 0° C. for 1 h. 3-Bromo-2-fluoro-5-methylbenzonitrile I128 (5.0 g, 23.4 mmol) was then added and the mixture was allowed to warm to RT and stirred overnight. The mixture was diluted with EtOAc (300 mL), washed with water (600 mL×4), brine and the organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=10/1) to give the title compound (2.8 g, 52%) as a yellow solid. LCMS-C: R.sub.t 0.50 min; m/z 226.9 [M+H].sup.+.

SYNTHESIS OF EXAMPLES

Examples 1-45 (Table A)

[0511] ##STR00086##

Method AA

[0512] LiHMDS (1 M in THF, 445 μL, 0.445 mmol) was added to a solution of 4-chlorobenzo[d]isoxazol-3-amine (50 mg, 0.297 mmol) in THF (3 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (0.445 mmol) was added and the reaction was stirred for 16 hours at room temperature. The volatiles were reduced to approximately 1 mL before DCM (3 mL) and water (3 mL) were added and the mixture was stirred for 10 minutes. The mixture was passed through a phase separator, the organic fraction was then loaded onto a 1 g Si-amine cartridge (Biotage) and the cartridge was washed with MeOH (6 mL), the product was then eluted with a HCl solution (2 M, 1:1 methanol:1,4-dioxane 6 mL). The HCl washings were then evaporated in vacuo to yield the desired product.

Method AB

[0513] LiHMDS (1 M in THF, 445 μL, 0.445 mmol) was added to a solution of 4-chlorobenzo[d]isoxazol-3-amine (50 mg, 0.297 mmol) in THF (3 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (0.445 mmol) was added and the reaction was stirred for 16 hours at room temperature. The volatiles were reduced to approximately 1 mL before DCM (3 mL) and water (3 mL) were added and the mixture was stirred for 10 minutes. The mixture was passed through a phase separator, the organic fraction was then loaded onto a 1 g Si-amine cartridge (Biotage) and the cartridge was washed with MeOH (6 mL), the product was then eluted with a HCl solution (2 M, 1:1 methanol:1,4-dioxane 6 mL). The HCl washings were then evaporated in vacuo to yield the crude product which was loaded onto silica gel and purified by silica gel column chromatography (Biotage Isolera, SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the desired product.

Method AC

[0514] LiHMDS (1 M in THF, 445 μL, 0.445 mmol) was added to a solution of 4-chlorobenzo[d]isoxazol-3-amine (50 mg, 0.297 mmol) in THF (3 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (0.445 mmol) was added and the reaction stirred for 16 hours at room temperature. The volatiles were reduced to approximately 1 mL before DCM (3 mL) and water (3 mL) were added and the mixture was stirred for 10 minutes. The mixture was passed through a phase separator, the organic fraction was then loaded onto a 1 g Si-amine cartridge (Biotage) and the cartridge was washed with MeOH (10 mL), the product was then eluted with a methanolic HCl solution (˜1.25 M, 10 mL). The HCl washings were then evaporated in vacuo to yield the desired product.

Method AD

[0515] A solution of 4-chlorobenzo[d]isoxazol-3-amine (50 mg, 0.298 mmol) and the sulfonyl chloride (2 eq., 0.595 mmol) in pyridine (1.5 mL) was irradiated in the microwave for 2 hours at 100° C. Upon cooling, the reaction mixture was loaded onto silica gel and purified using silica gel column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the desired product.

Method AE

[0516] A suspension of the sulfonyl chloride (2 eq., 1.19 mmol) and 4-chlorobenzo[d]isoxazol-3-amine (100 mg, 0.593 mmol) in pyridine (1.5 mL) was irradiated in the microwave for 2 hours at 100° C. Upon cooling, the mixture was loaded onto silica gel and purified using silica gel column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C. then 0-40% MeOH in EtOAc) to yield the desired product.

Method AF

[0517] A suspension of the sulfonyl chloride (2 eq., 1.19 mmol) and 4-chlorobenzo[d]isoxazol-3-amine (100 mg, 0.593 mmol) in pyridine (1 mL) was irradiated in the microwave for 1 hour at 80° C. Upon cooling, the mixture was loaded onto silica gel and purified using silica gel column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the desired product.

TABLE-US-00005 TABLE A Analytical Structure Name data Method 1 [00087] N-(4-chlorobenzo [d]isoxazol-3-yl)-2- (methoxymethyl) benzenesulfonamide LCMS-A: rt 6.538 min, m/z 352.1 [M − H].sup.− Method AB 2 [00088] N-(4-chlorobenzo [d]isoxazol-3-yl)-3- (methoxymethyl) benzenesulfonamide LCMS-A: rt 6.374 min, m/z 353.1 [M + H].sup.+ Method AA 3 [00089] 3,4-dichloro-N-(4- chlorobenzo[d]isoxazol-3-yl)- 2-methoxy benzenesulfonamide LCMS-A: rt 6.751 min, m/z 409.0 [M + H].sup.+ Method AA 4 [00090] N-(4-chlorobenzo [d]isoxazol-3-yl)-2- phenoxybenzene sulfonamide LCMS-A: rt 6.745 min, m/z 401.1 [M + H].sup.+ Method AA 5 [00091] N-(4-chlorobenzo [d]isoxazol-3-yl)-5-fluoro-2- methoxybenzene sulfonamide LCMS-A: rt 6.360 min, m/z 357.1 [M + H].sup.+ Method AA 6 [00092] N-(4-chlorobenzo [d]isoxazol-3-yl)-2-methyl- 2H-benzo[d][1,2,3]triazole-4- sulfonamide LCMS-A: rt 6.200 min, m/z 364.1 [M + H].sup.+ Method AA 7 [00093] N-(4-chlorobenzo [d]isoxazol-3- yl)benzo[c][1,2,5]thiadiazole- 4-sulfonamide LCMS-A: rt 6.346 min, m/z 367.0 [M + H].sup.+ Method AA 8 [00094] N-(4-chlorobenzo [d]isoxazol-3-yl)-2- hydroxybenzo[d]oxazole-6- sulfonamide LCMS-A: rt 5.856 min, m/z 364.0 [M − H].sup.− Method AA 9 [00095] 4-(benzyloxy)-N-(4- chlorobenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-A: rt 6.764 min, m/z 415.1 [M + H].sup.+ Method AA 10 [00096] N-(4-chlorobenzo [d]isoxazol-3-yl)-2,5- bis(2,2,2-trifluoroethoxy) benzenesulfonamide LCMS-A: rt 6.785 min, m/z 505.0 [M + H].sup.+ Method AA 11 [00097] N-(4-chlorobenzo [d]isoxazol-3-yl)-2-(oxazol-5- yl)benzenesulfonamide LCMS-A: rt 6.322 min, m/z 376.1 [M + H].sup.+ Method AA 12 [00098] methyl 2-(N-(4- chlorobenzo[d]isoxazol-3- yl)sulfamoyl)benzoate LCMS-A: rt 6.484 min, m/z 367.1 [M + H].sup.+ Method AA 13 [00099] N-(4-chlorobenzo [d]isoxazol-3-yl)-3-methyl-2- oxo-2,3- dihydrobenzo[d]oxazole-6- sulfonamide LCMS-A: rt 6.103 min, m/z 378.0 [M − H].sup.− Method AA 14 [00100] N-(4-chlorobenzo [d]isoxazol-3-yl)-3,4-dihydro- 2H-benzo[b][1,4]dioxepine-7- sulfonamide LCMS-A: rt 6.362 min, m/z 381.1 [M + H].sup.+ Method AA 15 [00101] N-(4-chlorobenzo [d]isoxazol-3-yl)benzo [d]thiazole-4-sulfonamide LCMS-A: rt 6.212 min, m/z 366.0 [M + H].sup.+ Method AA 16 [00102] N-(4-chlorobenzo [d]isoxazol-3- yl)benzo[c][1,2,5]oxadiazole- 4-sulfonamide LCMS-A: rt 6.973 min, m/z 351.0 [M + H].sup.+ Method AA 17 [00103] N-(4-chlorobenzo[d]isoxazol- 3-yl)-4-(4-fluorophenoxy) benzenesulfonamide LCMS-A: rt 6.781 min, m/z 419.1 [M + H].sup.+ Method AA 18 [00104] N-(4-chlorobenzo [d]isoxazol-3-yl)-2-methyl-5- (2-methyloxazol-5- yl)benzenesulfonamide LCMS-A: rt 6.410 min, m/z 404.1 [M + H].sup.+ Method AA 19 [00105] N-(4-chlorobenzo [d]isoxazol-3-yl)-5-(isoxazol- 5-yl)-2- methylbenzenesulfonamide LCMS-A: rt 6.542 min, m/z 390.1 [M + H].sup.+ Method AA 20 [00106] N-(4-chlorobenzo [d]isoxazol-3-yl)-2-methyl-5- (1H-pyrazol-1- yl)benzenesulfonamide LCMS-A: rt 6.493 min, m/z 389.1 [M + H].sup.+ Method AA 21 [00107] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- (methylsulfonyl) benzenesulfonamide LCMS-A: rt 6.317 min, m/z 385.0 [M − H].sup.− Method AA 22 [00108] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- isopropylbenzene sulfonamide LCMS-A: rt 6.745 min, m/z 351.1 [M + H].sup.+ Method AA 23 [00109] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- (trifluoromethoxy) benzenesulfonamide LCMS-A: rt 6.763 min, m/z 391.0 [M − H].sup.− Method AA 24 [00110] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- isopropoxybenzene sulfonamide LCMS-A: rt 6.620 min, m/z 367.1 [M + H].sup.+ Method AA 25 [00111] 4-(tert-butyl)-N-(4- chlorobenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-A: rt 6.826 min, m/z 365.1 [M + H].sup.+ Method AA 26 [00112] 4-chloro-N-(4- chlorobenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-A: rt 6.614 min, m/z 343.0, 345.0 [M + H].sup.+ Method AA 27 [00113] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- methylbenzenesulfonamide LCMS-A: rt 6.447 min, m/z 321.0 [M − H].sup.− Method AC 28 [00114] N-(4-chlorobenzo [d]isoxazol-3-yl)-4-(1H- pyrazol-1- yl)benzenesulfonamide LCMS-A: rt 6.321 min, m/z 375.1 [M + H].sup.+ Method AC 29 [00115] N-(4-chlorobenzo [d]isoxazol-3-yl)-2,6- difluorobenzene sulfonamide LCMS-A: rt 6.657 min, m/z 343.0 [M − H].sup.− Method AC 30 [00116] N-(4-chlorobenzo [d]isoxazol-3-yl)-2- fluorobenzenesulfonamide LCMS-A: rt 6.389 min, m/z 327.0 [M + H].sup.+ Method AC 31 [00117] 3-chloro-N-(4- chlorobenzo[d]isoxazol-3-yl)- 4- methylbenzenesulfonamide LCMS-A: rt 6.808 min, m/z 355.0, 357.0 [M − H].sup.− Method AC 32 [00118] 4-bromo-N-(4- chlorobenzo[d]isoxazol-3-yl)- 2-(trifluoromethoxy) benzenesulfonamide LCMS-A: rt 7.440 min, m/z 468.9, 470.9 [M − H].sup.− Method AC 33 [00119] N-(4-chlorobenzo [d]isoxazol-3-yl)-2-methoxy- 4,5- dimethylbenzenesulfonamide LCMS-A: rt 6.538 min, m/z 367.1 [M + H].sup.+ Method AC 34 [00120] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- (difluoromethoxy) benzenesulfonamide LCMS-A: rt 6.487 min, m/z 373.0 [M − H].sup.− Method AC 35 [00121] N-(4-chlorobenzo [d]isoxazol-3-yl)-4- (pentafluoro-λ.sup.6- sulfanyl)benzene sulfonamide LCMS-A: rt 7.021 min; m/z 435.0 [M + H].sup.+ Method AD 36 [00122] N-(4-chlorobenzo [d]isoxazol-3-yl)-3- (pentafluoro-λ.sup.6- sulfanyl)benzene sulfonamide LCMS-A: rt 7.219 min; m/z 435.0 [M + H].sup.+ Method AD 37 [00123] N-(4-chlorobenzo [d]isoxazol-3-yl)-5-isopropyl- 2-methoxy-4- methylbenzenesulfonamide LCMS-A: rt 7.537 min; m/z 395.1 [M + H].sup.+ Method AD 38 [00124] N-(4-chlorobenzo [d]isoxazol-3-yl)-2- (difluoromethoxy) benzenesulfonamide LCMS-A: rt 6.695 min; m/z 375.0 [M + H].sup.+ Method AD 39 [00125] N-(4-chlorobenzo [d]isoxazol-3-yl)-2,3- dihydrobenzo[b][1,4]dioxine- 5-sulfonamide LCMS-A: rt 6.620 min; m/z 367.0 [M + H].sup.+ Method AD 40 [00126] 5-(tert-butyl)-N-(4- chlorobenzo[d]isoxazol-3-yl)- 2-methoxy benzenesulfonamide LCMS-B: rt 3.876 min, m/z 395.2 [M + H].sup.+ Method AD 41 [00127] N-(4-chlorobenzo [d]isoxazol-3-yl)-5-isopropyl- 2-methoxybenzene sulfonamide LCMS-A: rt 6.684 min, m/z 381.1 [M + H].sup.+ Method AD 42 [00128] N-(4-chlorobenzo [d]isoxazol-3-yl)-5,6,7,8- tetrahydronaphthalene-2- sulfonamide LCMS-B: rt 3.859 min, m/z 363.1 [M + H].sup.+ Method AD 43 [00129] N-(4-chlorobenzo [d]isoxazol-3-yl)-[1,1- biphenyl]-3-sulfonamide LCMS-B: rt 3.823 min, m/z 385.1 [M + H].sup.+ Method AD 44 [00130] N-(4-chlorobenzo [d]isoxazol-3-yl)-2,3-dihydro- 1H-indene-5-sulfonamide LCMS-B: rt 3.785 min, m/z 349.1 [M + H].sup.+ Method AE 45 [00131] 5-bromo-N-(4- chlorobenzo[d]isoxazol-3-yl)- 2- methoxybenzenesulfonamide LCMS-B: rt 3.752 min, m/z 417.0, 419.0 [M + H].sup.+ Method AF

Examples 46-71 (Table D)

[0518] ##STR00132##

Method BA

[0519] A mixture of benzo[d]isoxazol-3-amine and a sulfonyl chloride in pyridine (1 mL) was stirred at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration or DCM extraction (2×1 mL) and purified using silica gel column chromatography (EtOAc/petroleum benzine 40-60° C. gradient) or preparative mass-directed HPLC to give the desired product. See Table B for reaction components and amounts used as well as purification conditions.

Method BB

[0520] A mixture of benzo[d]isoxazol-3-amine and a sulfonyl chloride in pyridine (0.5 mL) was stirred at room temperature for 64 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration and a portion of the crude material (50 mg or less) was purified by preparative mass-directed HPLC to give the desired product. See Table B for reaction components and amounts used.

Method BC

[0521] A mixture of benzo[d]isoxazol-3-amine and a sulfonyl chloride in pyridine (0.5 mL) was stirred at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration and a portion of the crude material (50 mg or less) was purified by mass directed preparative HPLC to give the desired product. See Table B for reaction components and amounts used.

TABLE-US-00006 TABLE B Benzo[d] isoxazol-3- Benzenesulfonyl chloride amine Method/Work- Mass Moles Mass Moles up/Purification Product Structure and name (g) (mmol) (g) (mmol) method 46 [00133] 0.143 0.602 0.030 0.23 Method BA/Filtration/ Column chromatography 0-45% gradient 2,5-dimethoxybenzenesulfonyl chloride 47 [00134] 0.150 0.682 0.031 0.23 Method BA/Filtration/ Column chromatography 0-40% gradient 2-methoxy-5- methylbenzenesulfonyl chloride 48 [00135] 0.148 0.563 0.033 0.25 Method BA/Filtration/ Column chromatography 0-40% gradient 5-(tert-butyl)-2- methoxybenzenesulfonyl chloride 49 [00136] 0.140 0.561 0.031 0.23 Method BA/Filtration/ Column chromatography 0-40% gradient 5-isopropyl-2- methoxybenzenesulfonyl chloride 50 [00137] 0.142 0.535 0.030 0.22 Method BA/Filtration/ Column chromatography 0-100% gradient methyl 3-(chlorosulfonyl)-4- methoxybenzoate 51 [00138] 0.156 0.611 0.033 0.24 Method BA/Filtration/ Column chromatography 0-100% gradient 5-chloro-2-methoxy-4- methylbenzenesulfonyl chloride 52 [00139] 0.036 0.180 0.028 0.21 Method BA/DCM extraction/Column chromatography 0-50% gradient 3-ethylbenzenesulfonyl chloride 53 [00140] 0.074 0.360 0.032 0.24 Method BA/DCM extraction/Column chromatography 0-50% gradient 4-ethylbenzenesulfonyl chloride 54 [00141] 0.148 0.54  0.034 0.25 Method BA/Filtration/ Column chromatography 0-100% gradient 2-methoxy-5-(1H-pyrazol-1-yl) benzenesulfonyl chloride 55 [00142] 0.158 0.58  0.030 0.22 Method BA/Filtration/ Column chromatography 0-100% gradient 5-(isoxazol-5-yl)-2- methoxybenzenesulfonyl chloride 56 [00143] 0.063 0.27  0.030 0.22 Method BA/DCM extraction/Column chromatography 0-100% gradient 2,5-diethylbenzenesulfonyl chloride 57 [00144]   2-ethoxy-5-ethylbenzenesulfonyl chloride 0.170 0.68  0.027 0.20 Method BA/Filtration/ Column chromatography 0-40% gradient. Triturated minimal acetone, product contained approx. 10% sulfonic acid by-product 58 [00145] 0.101 0.488 0.029 0.21 Method BA/Filtration/ mass-directed HPLC 2-methoxybenzenesulfonyl chloride 59 [00146] 0.105 0.466 0.033 0.25 Method BB 3-chloro-2- methylbenzenesulfonyl chloride 60 [00147] 0.171 0.698 0.032 0.24 Method BB 2,3-dichlorobenzenesulfonyl chloride 61 [00148] 0.100 0.640 0.032 0.24 Method BB 3,4-dichlorobenzenesulfonyl chloride 62 [00149] 0.170 0.694 0.031 0.23 Method BB 2,4-dichlorobenzenesulfonyl chloride 63 [00150] 0.107 0.454 0.033 0.25 Method BC 5-ethyl-2- methoxybenzenesulfonyl chloride 64 [00151] 0.120 0.553 0.029 0.22 Method BC 2,3-dihydro-1H-indene-5- sulfonyl chloride 65 [00152] 0.103 0.447 0.032 0.24 Method BC 5,6,7,8-tetrahydronaphthalene-2- sulfonyl chloride 66 [00153] 0.111 0.490 0.030 0.23 Method BC naphthalene-2-sulfonyl chloride 67 [00154] 0.102 0.396 0.033 0.25 Method BC 3-(5-methyl-1,3,4-oxediazol-2-yl) benzenesulfonyl chloride 68 [00155] 0.111 0.432 0.033 0.25 Method BB 5-bromopyridine-2-sulfonyl chloride

Method CA

[0522] A mixture of benzo[d]isoxazol-3-amine and a sulfonyl chloride in pyridine (1 mL) was stirred at room temperature for 16 hours when a second portion of benzenesulfonyl chloride was added and stirred for an additional 64 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration and purified either by preparative mass-directed HPLC (up to 50 mg of crude material) or by silica gel column chromatography (0-40% EtOAc/petroleum benzine 40-60° C.) to give the desired product. See Table C for reaction components and amounts used as well as purification conditions.

TABLE-US-00007 TABLE C Benzo[d] Benzenesulfonyl chloride (added in 2 portions) isoxazol-3-amine Method/ Mass Moles Mass Moles Purification Product Structure and name Portion (g) (mmol) (g) (mmol) method 69 [00156] 1.sup.st 2.sup.nd 0.117 0.103 0.463 0.408 0.060 0.45 Method CA/Mass- directed HPLC [1,1′-biphenyl]-4-sulfonyl chloride 70 [00157] 1.sup.st 2.sup.nd 0.092 0.088 0.36  0.35  0.052 0.39 Method CA/column chromatography [1,1′-biphenyl]-3-sulfonyl chloride 71 [00158] 1.sup.st 2.sup.nd 0.103 0.101 0.398 0.390 0.065 0.48 Method CA/column chromatography 4-cyclohexylbenzenesulfonyl chloride

TABLE-US-00008 TABLE D Structure Name Analytical 46 [00159] N- (benzo[d]isoxazol- 3-yl)-2,5- dimethoxybenzene- sulfonamide LCMS-B: rt 3.560 min; m/z 335.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.01 (br s, 1H), 8.14-8.06 (m, 1H), 7.64 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.55 (dt, J = 8.5, 0.8 Hz, 1H), 7.43-7.36 (m, 2H), 7.17 (dd, J = 9.1, 2.9 Hz, 1H), 7.13 (d, J = 8.8 Hz, 1H), 3.82 (s, 3H), 3.77 (s, 3H) 47 [00160] N- (benzo[d]isoxazol- 3-yl)-2-methoxy- 5-methyl benzene sulfonamide LCMS-B: rt 3.585 min; m/z 319.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 9.94 (br s, 1H), 8.14-8.06 (m, 1H), 7.70-7.65 (m, 1H), 7.63 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.54 (dt, J = 8.5, 0.8 Hz, 1H), 7.43- 7.36 (m, 2H), 7.08 (d, J = 8.5 Hz, 1H), 3.84 (s, 3H), 2.28 (s, 3H). 48 [00161] N- (benzo[d]isoxazol- 3-yl)-5-(tert- butyl)-2-methoxy benzene sulfonamide LCMS-B: rt 3.806 min; m/z 361.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.00 (br s, 1H), 8.13-8.08 (m, 1H), 7.91 (d, J = 2.5 Hz, 1H), 7.66-7.60 (m, 2H), 7.55- 7.51 (m, 1H), 7.38 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 7.10 (d, J = 8.7 Hz, 1H), 3.83 (s, 3H), 1.26 (s, 9H) 49 [00162] N- (benzo[d]isoxazol- 3-yl)-5-isopropyl- 2-methoxy benzene sulfonamide LCMS-B: rt 3.744 min; m/z 347.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 9.97 (br s, 1H), 8.12-8.08 (m, 1H), 7.75(d, J = 2.4 Hz, 1H), 7.63 (ddd, J = 8.4, 7.0, 1.2 Hz, 1H), 7.53 (dt, J = 8.5, 0.9 Hz, 1H), 7.48 (ddd, J = 8.5, 2.4, 0.6 Hz, 1H), 7.38 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 7.10 (d, J = 8.6 Hz, 1H), 3.84 (s, 3H), 2.95-2.87 (m, 1H), 1.18 (d, J = 6.9 Hz, 6H) 50 [00163] methyl 3-(N- (benzo[d] isoxazol-3- yl)sulfamoyl)-4- methoxy benzoate LCMS-A: rt 6.024 min; m/z 363.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.24 (br s, 1H), 8.55 (d, J = 2.2 Hz, 1H), 8.24 (dd, J = 8.8, 2.2 Hz, 1H), 8.09 (dt, J = 8.1, 1.0 Hz, 1H), 7.66 (ddd, J = 8.4, 7.0, 1.2 Hz, 1H), 7.57 (dt, J = 8.5, 0.8 Hz, 1H), 7.42 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 7.35 (d, J = 8.8 Hz, 1H), 4.00 (s, 3H), 3.89 (s, 3H) 51 [00164] N- (benzo[d]isoxazol- 3-yl)-5-chloro-2- methoxy-4- methylbenzene sulfonamide LCMS-B: rt 3.738 min; m/z 353.1/355.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.10-8.06 (m, 1H), 7.81 (s, 1H), 7.65 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.58-7.54 (m, 1H), 7.43-7.37 (m, 1H), 7.21 (s, 1H), 3.87 (s, 3H), 2.38 (s, 3H) 52 [00165] N- (benzo[d]isoxazol- 3-yl)-3- ethylbenzene sulfonamide LCMS-B: rt 3.707 min; m/z 303.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.02- 7.97 (m, 1H), 7.85-7.82 (m, 1H), 7.82- 7.78 (m, 1H), 7.68-7.62 (m, 1H), 7.59- 7.55 (m, 1H), 7.54-7.45 (m, 2H), 7.41- 7.35 (m, 1H), 2.70 (q, J = 7.6 Hz, 2H)*, 1.19 (t, J = 7.6 Hz, 3H). * Partially overlapping with water peak 53 [00166] N- (benzo[d]isoxazol- 3-yl)-4- ethylbenzene sulfonamide LCMS-B: rt 3.690 min; m/z 303.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.03- 7.98 (m, 1H), 7.93-7.89 (m, 2H), 7.65 (ddd, J = 8.2, 7.0, 1.1 Hz, 1H), 7.60-7.55 (m, 1H), 7.46-7.41 (m, 2H), 7.41-7.36 (m, 1H), 2.71 (q, J = 7.6 Hz, 2H)*, 1.21 (t, J = 7.6 Hz, 3H). * Partially overlapping with water peak 54 [00167] N- (benzo[d]isoxazol- 3-yl)-2-methoxy- 5-(1H-pyrazol-1- yl)benzene sulfonamide LCMS-B: rt 3.554 min; m/z 371.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.36 (d, J = 2.8 Hz, 1H), 8.33-8.31 (m, 1H), 8.13- 8.07 (m, 1H), 8.05 (dd, J = 9.0, 2.8 Hz, 1H), 7.68-7.61 (m, 2H), 7.56-7.52 (m, 1H), 7.40 (ddd, J = 8.0, 7.1, 0.8 Hz, 1H), 7.33 (d, J = 9.0 Hz, 1H), 6.49 (dd, J = 2.5, 1.7 Hz, 1H), 3.93 (s, 3H). 55 [00168] N- (benzo[d]isoxazol- 3-yl)-5-(isoxazol- 5-yl)-2- methoxybenzene sulfonamide LCMS-B: rt 3.516 min; m/z 372.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.46 (d, J = 1.9 Hz, 1H), 8.36 (d, J = 2.3 Hz, 1H), 8.13-8.07 (m, 2H), 7.63 (ddd, J = 8.3, 7.1, 1.2 Hz, 1H), 7.56-7.52 (m, 1H), 7.43- 7.36 (m, 2H), 6.90 (d, J = 1.9 Hz, 1H), 3.97 (s, 3H) 56 [00169] N- (benzo[d]isoxazol- 3-yl)-2,5- diethylbenzene sulfonamide LCMS-B: rt 3.801 min; m/z 331.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.01- 7.97 (m, 1H), 7.95-7.92 (m, 1H), 7.66- 7.61 (m, 1H), 7.57-7.52 (m, 1H), 7.45- 7.41 (m, 1H), 7.40-7.34 (m, 2H), 3.10 (q, J = 7.5 Hz, 2H)*, 2.66 (q, J = 7.5 Hz, 2H)*, 1.22 (t, J = 7.5 Hz, 3H), 1.17 (t, J = 7.6 Hz, 3H). * Partially overlapping with water peak 57 [00170] N- (benzo[d]isoxazol- 3-yl)-2-ethoxy-5- ethylbenzene sulfonamide LCMS-B: rt 3.763 min; m/z 347.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 9.78 (br s, 1H), 8.13-8.08 (m, 1H), 7.74 (d, J = 2.3 Hz, 1H), 7.63 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.56-7.52 (m, 1H), 7.44-7.41 (m, 1H), 7.38 (ddd, J = 8.0, 7.1, 0.8 Hz, 1H), 7.09 (d, J = 8.5 Hz, 1H), 4.16 (q, J = 7.0 Hz, 2H), 1.29 (t, J = 7.0 Hz, 3H), 1.16 (t, J = 7.6 Hz, 3H). NB approx. 10% sulfonic acid impurity 58 [00171] N- (benzo[d]isoxazol- 3-yl)-2- methoxybenzene sulfonamide HPLC-MS: rt 5.11 min; m/z 305.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.35- 9.70 (br s, 1H), 8.12-8.08 (m, 1H), 7.90- 7.86 (dd, J = 7.9, 1.7 Hz, 1H), 7.66-7.58 (m, 2H), 7.56-7.52 (m, 1H), 7.41-7.36 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 7.21-7.17 (dd, J = 8.4, 0.8 Hz, 1H), 7.09-7.03 (m, 1H), 3.90-3.87 (s, 3H). 59 [00172] N- (benzo[d]isoxazol- 3-yl)-3-chloro-2- methylbenzene- sulfonamide HPLC-MS: rt 6.38 min; m/z 323.22/325.17 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 11.10-10.01 (br s, 1H), 8.15-8.10 (dd, J = 8.0, 1.0 Hz, 1H), 8.02-7.97 (m, 1H), 7.74-7.69 (m, 1H), 7.68-7.62 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.59-7.54 (m, 1H), 7.46-7.41 (m, 1H), 7.41-7.37 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 2.77-2.74 (s, 3H) 60 [00173] N- (benzo[d]isoxazol- 3-yl)-2,3- dichlorobenzene- sulfonamide HPLC-MS: rt 6.27 min; m/z 343.13/345.15/347.10 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.25-8.22 (dd, J = 8.0, 1.5 Hz, 1H), 8.06-8.02 (m, 1H), 7.93-7.90 (dd, J = 8.1, 1.5 Hz, 1H), 7.69- 7.64 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.64- 7.59 (m, 1H), 7.59-7.55 (m, 1H), 7.44- 7.38 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H) 61 [00174] N- (benzo[d]isoxazol- 3-yl)-3,4- dichlorobenzene- sulfonamide HPLC-MS: rt 6.62 min; m/z 343.13/345.15/347.10 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.19-8.17 (d, J = 2.1 Hz, 1H), 7.99-7.94 (m, 2H), 7.85- 7.82 (d, J = 8.5 Hz, 1H), 7.70-7.65 (ddd, J = 8.2, 7.0, 1.2 Hz, 1H), 7.62-7.58 (m, 1H), 7.43-7.37 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H) 62 [00175] N- (benzo[d]isoxazol- 3-yl)-2,4- dichlorobenzene- sulfonamide HPLC-MS: rt 6.42 min; m/z 343.13/345.15/347.16 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.26-8.22 (d, J = 8.6 Hz, 1H), 8.06-8.02 (m, 1H), 7.75- 7.72 (d, J = 2.0 Hz, 1H), 7.70-7.63 (m, 2H), 7.60-7.56 (m, 1H), 7.44-7.38 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H) 63 [00176] N- (benzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxy benzene- sulfonamide HPLC-MS: rt 5.39 min; m/z 333.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.19-9.73 (br s, 1H), 8.13-8.08 (ddd, J = 8.1, 1.0, 1.0 Hz, 1H), 7.73-7.69 (d, J = 2.3 Hz, 1H), 7.66-7.60 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.56-7.52 (ddd, J = 8.5, 0.8, 0.8 Hz, 1H), 7.47-7.42 (dd, J = 8.5, 2.3 Hz, 1H), 7.42-7.36 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 7.13-7.07 (d, J = 8.5 Hz, 1H), 3.86-3.82 (s, 3H), 2.65-2.56 (q, J = 7.6 Hz, 2H), 1.18-1.12 (t, J = 7.6 Hz, 3H) 64 [00177] N- (benzo[d]isoxazol- 3-yl)-2,3-dihydro- 1H-indene-5- sulfonamide HPLC-MS: rt 5.45 min; m/z 315.2 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.80-9.43 (br s, 1H), 8.04-7.99 (ddd, J = 8.1, 1.0, 1.0 Hz, 1H), 7.84-7.80 (m, 1H), 7.78-7.73 (m, 1H), 7.68-7.62 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.60-7.54 (ddd, J = 8.5, 0.8, 0.8 Hz, 1H), 7.42-7.35 (m, 2H), 2.97-2.88 (t, J = 7.5 Hz, 4H), 2.12- 2.05 (dd, J = 15.0, 7.6 Hz, 2H). 65 [00178] N- (benzo[d]isoxazol- 3-yl)-5,6,7,8- tetrahydro- naphthalene-2- sulfonamide HPLC-MS: rt 5.57 min; m/z 329.5 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 10.44-9.90 (br s, 1H), 8.03-7.98 (ddd, J = 8.1, 1.1, 1.1 Hz, 1H), 7.69-7.63 (m, 3H), 7.60-7.55 (ddd, J = 8.5, 0.8, 0.8 Hz, 1H), 7.42-7.36 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 7.25-7.20 (d, J = 8.3 Hz, 1H), 2.81- 2.76 (m, 4H), 1.83-1.73 (m, 4H). 66 [00179] N- (benzo[d]isoxazol- 3- yl)naphthalene-2- sulfonamide HPLC-MS: rt 5.46 min; m/z 325.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 11.03-9.58 (br s, 1H), 8.66-8.62 (m, 1 H), 8.15-8.11 (m, 1H), 8.11-8.08 (d, J = 8.9 Hz, 1H), 8.04-7.98 (m, 3H), 7.73- 7.60 (m, 3H), 7.56-7.52 (ddd, J = 8.5, 0.8, 0.8 Hz, 1H), 7.41-7.35 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H). 67 [00180] N- (benzo[d]isoxazol- 3-yl)-3-(5-methyl- 1,3,4-oxadiazol-2- yl)benzene sulfonamide HPLC-MS: rt 5.00 min; m/z 357.7 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.62-8.61 (dd, J = 1.6, 1.6 Hz, 1H), 8.29- 8.26 (ddd, J = 7.8, 1.4, 1.4 Hz, 1H), 8.23- 8.19 (ddd, J = 8.0, 1.8, 1.1 Hz, 1H), 7.99- 7.96 (ddd, J = 8.1, 0.9, 0.9 Hz, 1H), 7.85- 7.80 (dd, J = 7.9, 7.9 Hz, 1H), 7.67- 7.63 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.58- 7.55 (m, 1H), 7.41-7.36 (ddd, J = 7.9, 7.0, 0.8 Hz, 1H), 2.63-2.60 (s, 3H). 68 [00181] N- (benzo[d]isoxazol- -3-yl)-5- bromopyridine-2- sulfonamide LCMS-B: rt 3.583 min; m/z 354/356 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 11.19-10.23 (br s, 1H), 8.81-8.78 (dd, J = 2.3, 0.7 Hz, 1H), 8.38-8.34 (dd, J = 8.4, 2.3 Hz, 1H), 8.15-8.10 (dd, J = 8.4, 0.7 Hz, 1H), 8.06-8.01 (ddd, J = 8.1, 1.0, 1.0 Hz, 1H), 7.69-7.64 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.59-7.56 (ddd, J = 8.5, 0.8, 0.8 Hz, 1H), 7.43-7.38 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H). 69 [00182] N- (benzo[d]isoxazol- 3-yl)-[1,1- biphenyl]-4- sulfonamide HPLC-MS: rt 6.62 min; m/z 351.19 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.11-8.06 (m, 2H), 8.04-8.00 (m, 1H), 7.90-7.85 (m, 2H), 7.76-7.68 (m, 2H), 7.66 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.58 (dt, J = 8.5, 0.8 Hz, 1H), 7.53-7.47 (m, 2H), 7.46-7.37 (m, 2H). 70 [00183] N- (benzo[d]isoxazol- 3-yl)-[1,1- biphenyl]-3- sulfonamide LCMS-B: rt 3.754 min; m/z 351.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.29-8.26 (m, 1H), 8.03-8.00 (m, 1H), 7.97 (dddd, J = 9.0, 7.8, 1.8, 0.9 Hz, 2H), 7.72-7.63 (m, 4H), 7.58 (dt, J = 8.5, 0.8 Hz, 1H), 7.54-7.48 (m, 2H), 7.46-7.37 (m, 2H) 71 [00184] N- (benzo[d]isoxazol- 3-yl)-4- cyclohexyl benzene- sulfonamide LCMS-B: rt 3.999 min m/z 357.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.02-7.98 (m, 1H), 7.93-7.89 (m, 2H), 7.65 (ddd, J = 8.3, 7.0, 1.2 Hz, 1H), 7.59- 7.55 (m, 1H), 7.47-7.43 (m, 2H), 7.38 (ddd, J = 8.0, 7.0, 0.9 Hz, 1H), 2.66-2.58 (m, 2H), 1.85-1.78 (m, 4H), 1.76-1.69 (m, 1H), 1.50-1.34 (m, 4H), 1.32-1.24 (m, 1H).

Examples 72-88 (Table E)

[0523] ##STR00185##

Method EA

[0524] NaH (60% in mineral oil, 49 mg, 1.22 mmol) was added to a solution of 4-methoxybenzo[d]isoxazol-3-amine (50 mg, 0.305 mmol) in THF (3.0 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (1 eq., 0.305 mmol) was added and the reaction was stirred for 16 hours. The volatiles were reduced to approximately 1 mL before DCM (3 mL) and water (3 mL) were added and the mixture was stirred for 10 minutes. The mixture was passed through a phase separator, the organic fraction was then loaded onto a 1 g Si-amine cartridge (Biotage) and the cartridge was washed with MeOH (6 mL), the product was then eluted with a HCl solution (1.25 M in methanol, 6 mL). The HCl washings were evaporated in vacuo to yield the desired product.

Method EB

[0525] NaH (60% in mineral oil, 61 mg, 1.52 mmol) was added to a solution of 4-methoxybenzo[d]isoxazol-3-amine (50 mg, 0.305 mmol) in DMF (3.0 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (1 eq., 0.305 mmol) was added and the reaction was stirred for 16 hours. The resultant mixture was loaded onto silica gel and purified by column chromatography (0-100% petroleum benzine 40-60° C. then 0-60% MeOH in EtOAc) to yield the desired product.

Method EC

[0526] NaH (60% in mineral oil, 22 mg, 0.914 mmol) was added to a solution of 4-methoxybenzo[d]isoxazol-3-amine (50 mg, 0.305 mmol) in DMF (5 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (1 eq., 0.305 mmol) was added and the reaction was stirred for 16 hours. The resultant mixture was quenched with water (3 mL), stirred for 10 minutes at room temperature then loaded onto silica gel and purified by column chromatography (0-100% petroleum benzine 40-60° C. then 0-60% MeOH in EtOAc) to yield the desired product.

Method ED

[0527] NaH (60% in mineral oil, 5 or 10 eq.) was added to a solution of 4-methoxybenzo[d]isoxazol-3-amine (100 mg, 0.609 mmol) in THF (5.0 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (1 eq., 0.609 mmol) was added and the reaction was stirred for 16 hours. The resultant mixture was loaded onto silica gel and purified by column chromatography (0-100% petroleum benzine 40-60° C. then 0-60% MeOH in EtOAc) to yield the desired product.

Method EF

[0528] NaH (60% in mineral oil, 122 mg, 3.05 mmol) was added to a solution of 4-methoxybenzo[d]isoxazol-3-amine (100 mg, 0.609 mmol) in THF (5.0 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (1 eq., 0.609 mmol) was added and the reaction was stirred for 16 hours. The resultant mixture was loaded onto silica gel and purified by column chromatography (0-100% petroleum benzine 40-60° C. then 0-60% MeOH in EtOAc) and the isolated solid was sonicated in MeOH (1 mL) and collected by filtration to yield the desired product.

Method EG

[0529] NaH (60% in mineral oil, 122 mg, 3.05 mmol) was added to a solution of 4-methoxybenzo[d]isoxazol-3-amine (100 mg, 0.609 mmol) in THF (5.0 mL) and stirred at room temperature for 10 minutes. The sulfonyl chloride (1 eq., 0.609 mmol) was added and the reaction was stirred for 16 hours at room temperature. The volatiles were reduced to approximately 1 mL before DCM (3 mL) and water (3 mL) were cautiously added and stirred for 10 minutes. The mixture was passed through a phase separator, the organic fraction was then loaded onto a 1 g Si-amine cartridge (Biotage) and the cartridge was washed with MeOH (6 mL), the product was then eluted with a HCl solution (2 M, 1:1 methanol:1,4-dioxane, 6 mL). The HCl washings were then evaporated in vacuo to yield the desired product.

Method EH

[0530] A suspension of 4-methoxybenzo[d]isoxazol-3-amine (48 mg, 0.29 mmol) and NaH (60% in mineral oil, 0.117 mg, 2.93 mmol) in DMF (10 mL) was stirred at room temperature for 10 minutes before being cooled to −78° C. To this cooled mixture the sulfonyl chloride (1.5 eq., 0.439 mmol) was added and the mixture was stirred at −78° C. for 1 hour then warmed to room temperature and stirred for 16 hours. The reaction mixture was loaded onto silica gel and purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C. then 0-40% MeOH in EtOAc) to give a solid which was suspended in diethyl ether (25 mL) and sonicated for 5 minutes. The solid was collected by filtration and air dried to give the desired product.

Method EI

[0531] A mixture of 4-methoxybenzo[d]isoxazol-3-amine (0.035 g, 0.21 mmol) and a sulfonyl chloride (1.05 eq., 0.22 mmol) in pyridine (1 mL) was stirred at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. Extraction with DCM (2×1 mL) and purification using silica gel column chromatography (0-100% EtOAc in petroleum benzine 40-60° C.) gave the desired product.

Method EJ

[0532] To a solution of 4-methoxybenzo[d]isoxazol-3-amine (1 eq.) in THF (3 mL) was added LiHMDS (1M in THF, 1.5 eq.). After 10 minutes of stirring, the sulfonyl chloride (1.5 eq.) was added and the reaction was left to stir for 17 hours, open to air. The THF was removed in vacuo, then DCM (3 mL) and water (3 mL) were added and stirred for 10 minutes. After separation of the layers, the organic fraction was loaded onto a 1 g Si-amine cartridge (Biotage). The cartridge was washed with MeOH (6 mL), then stripped with 1.25 M HCl in MeOH (6 mL). The HCl washings were then evaporated in vacuo to yield the desired product.

TABLE-US-00009 TABLE E Structure and yield (where applicable) Name Analytical data Method 72 [00186]   15 mg, 13% 2-methoxy-N-(4- methoxybenzo[d] isoxazol-3-yl)-4,6- dimethylbenzene sulfonamide LCMS-A: rt 6.474 min, m/z 363.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.51- 9.42 (s, 1H), 7.61-7.51 (t, J = 8.2 Hz, 1H), 7.19-7.10 (d, J = 8.4 Hz, 1H), 6.90-6.87 (s, 1H), 6.87-6.82 (d, J = 8.0 Hz, 1H), 6.80-6.74 (s, 1H), 3.99-3.93 (s, 3H), 3.84- 3.78 (s, 3H), 2.58-2.54 (s, 3H), 2.31-2.25 (s, 3H). Method EA 73 [00187]   10 mg, 8% N-(4-methoxy benzo[d]isoxazol- 3-yl)-3-methyl quinoline-8- sulfonamide LCMS-A: rt 6.469 min, m/z = 370.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ = 8.94 (d, J = 2.1 Hz, 1H), 8.37 (dd, J = 7.3, 1.3 Hz, 1H), 8.33 (s, 1H), 8.25 (d, J = 8.0 Hz, 1H), 7.76 (t, J = 7.8 Hz, 1H), 7.50 (t, J = 8.2 Hz, 1H), 7.10 (d, J = 8.4 Hz, 1H), 6.79 (d, J = 8.1 Hz, 1H), 3.89 (s, 3H), 2.52 (s, 3H). Method EB 74 [00188]   35 mg, 29% 5-methoxy-N-(4- methoxybenzo[d] isoxazol-3-yl) quinoline-8- sulfonamide LCMS-A: rt 6.461 min, m/z 386.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ = 9.08 (dd, J = 4.3, 1.7 Hz, 1H), 8.62 (dd, J = 8.5, 1.7 Hz, 1H), 8.42 (d, J = 8.4 Hz, 1H), 7.67 (dd, J = 8.5 Hz, 4.3, 1H), 7.49 (t, J = 8.2 Hz, 1H), 7.22 (d, J = 8.5 Hz, 1H), 7.08 (d, J = 8.4 Hz, 1H), 6.78 (d, J = 8.0 Hz, 1H), 4.08 (s, 3H), 3.94 (s, 3H) Method EC 75 [00189]   29 mg, 24% 4-methoxy-N-(4- methoxybenzo[d] isoxazol-3- yl)quinoline-8- sulfonamide LCMS-A: rt 6.253 min, m/z 386.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ = 8.93 (d, J = 5.4 Hz, 1H), 8.52-8.37 (m, 2H), 7.75 (t, J = 7.8 Hz, 1H), 7.50 (t, J = 8.3 Hz, 1H), 7.22 (d, J = 5.3 Hz, 1H), 7.10 (d, J = 8.6 Hz, 1H), 6.80 (d, J = 8.1 Hz, 1H), 4.08 (s, 3H), 3.93 (s, 3H) Method EC 76 [00190] 2,4-dimethoxy-N- (4-methoxybenzo [d]isoxazol-3- yl)benzene sulfonamide LCMS-A: rt 6.188 min, m/z = 365.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ = 9.76 (s, 1H), 7.80-7.73 (m, 1H), 7.55 (t, J = 8.2 Hz, 1H), 7.15 (d, J = 8.4 Hz, 1H), 6.84 (d, J = 8.0 Hz, 1H), 6.73-6.62 (m, 2H), 3.92 (s, 3H), 3.84 (s, 3H), 3.79 (s, 3H) Method ED 10 eq. NaH used 59 mg, 26% 77 [00191] N-(4-methoxy benzo[d]isoxazol- 3-yl)-7-methyl quinoline-8- sulfonamide LCMS-A: rt 6.419 min, m/z = 370.2 [M + H].sup.+ Method EF 68 mg, 30% 78 [00192] N-(4-methoxy benzo[d]isoxazol- 3-yl)-6-methyl quinoline-8- sulfonamide LCMS-A: rt 6.332 min, m/z = 370.1 [M + H].sup.+ Method ED 5 eq. NaH used 4 mg, 2% 79 [00193] N-(4-methoxy benzo[d]isoxazol- 3-yl)-4-methyl quinoline-8- sulfonamide LCMS-A: rt 6.325 min, m/z = 370.1 [M + H].sup.+ Method ED 5 eq. NaH used 15 mg, 7% 80 [00194] N-(4-methoxy benzo[d]isoxazol- 3-yl)-2-methyl quinoline-8- sulfonamide LCMS-A: rt 6.349 min, m/z = 370.1 [M + H].sup.+ Method ED 5 eq. NaH used 50 mg, 22% 81 [00195] N-(4-methoxy benzo[d]isoxazol- 3-yl)benzofuran- 7-sulfonamide LCMS-A: rt 6.225 min, m/z = 345.1 [M + H].sup.+ Method EG 38 mg, 18% 82 [00196] N-(4-methoxy benzo[d]isoxazol- 3-yl)chromane-8- sulfonamide LCMS-A: rt 6.282 min, m/z = 361.1 [M + H].sup.+ Method EG 44 mg, 20% 83 [00197]   10 mg, 9% N-(4-methoxy benzo[d]isoxazol- 3-yl)quinoline-8- sulfonamide LCMS-A: rt 6.198 min; m/z = 356.2 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ = 9.08 (dd, J = 4.3, 1.7 Hz, 1H), 8.57 (dd, J = 8.4, 1.6 Hz, 1H), 8.46 (dd, J = 7.4, 1.4 Hz, 1H), 8.36 (d, J = 8.0 Hz, 1H), 7.81 (t, J = 7.8 Hz, 1H), 7.73 (dd, J = 8.3, 4.3 Hz, 1H), 7.50 (t, J = 8.2 Hz, 1H), 7.10 (d, J = 8.4 Hz, 1H), 6.78 (d, J = 8.0 Hz, 1H), 3.88 (s, 3H) Method EH 84 [00198]   9 mg, 12% N-(4-methoxy benzo[d]isoxazol- 3-yl)-5,6,7,8- tetrahydro- naphthalene-2- sulfonamide LCMS-A: rt 6.955 min; m/z 359.1 [M + H].sup.+; .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 7.81- 7.76 (m, 2H), 7.55-7.49 (m, 1H), 7.23 (d, J = 7.7 Hz, 1H), 7.06 (d, J = 8.4 Hz, 1H), 6.79 (d, J = 8.0 Hz, 1H), 3.96 (s, 3H), 1.81-1.77 (m, 4H). NB: solvent obscuring aliphatic 2 × CH.sub.2 Method EI 85 [00199] 2,4,6-trimethoxy- N-(4-methoxy benzo[d]isoxazol- 3-yl)benzene sulfonamide LCMS-A: rt 6.095 min; m/z 395.1 [M + H].sup.+ Method EJ 86 [00200] 2,6-dimethoxy-N- (4-methoxy benzo[d]isoxazol- 3-yl)benzene sulfonamide LCMS-A: rt 5.991 min; m/z 365.1 [M + H].sup.+ Method EJ 87 [00201] 2-methoxy-N-(4- methoxybenzo[d] isoxazol-3-yl)-5- (trifluoromethyl) benzene- sulfonamide LCMS-B: rt 3.379 min; m/z 403.0 [M + H].sup.+ Method EJ 88 [00202] N-(4-methoxy benzo[d]isoxazol- 3-yl)-2-(methoxy methyl)benzene- sulfonamide LCMS-B: rt 3.344 min; m/z 349.1 [M + H].sup.+ Method EJ

Examples 89-147 (Table F)

Method FA

[0533] ##STR00203##

[0534] To a solution of the amine (0.5 mmol, 1.0 eq.) in anhydrous THF (10 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 3 eq.) dropwise and the mixture was stirred at −78° C. for 30 min. A solution of the sulfonyl chloride (1.5 eq.) in anhydrous THF (2.0 mL) was then added dropwise and the mixture was allowed to warm to RT and stirred overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography or prep. TLC to give the title compound. Variations to above conditions have been noted in Table F.

Method FB

[0535] ##STR00204##

[0536] To a solution of the amine (0.3 mmol, 1.0 eq.) in pyridine (5 mL) under N.sub.2 was added the sulfonyl chloride (2.0 eq.) and the mixture was heated at 100° C. overnight. The reaction was quenched with 1 M aq. HCl, water was then added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography or prep. TLC to give the title compound. Variations to above conditions have been noted in Table F.

Method FC

[0537] ##STR00205##

[0538] To a solution of the amine (0.5 mmol, 1.0 eq.) in anhydrous THF (10 mL) at −20° C. under N.sub.2 was added n-BuLi (2.5 M in hexanes, 1.5 eq.) dropwise and the mixture was stirred at −20° C. for 1 h. A solution of the sulfonyl chloride (1.5 eq.) in anhydrous THF (2.0 mL) was then added dropwise and the mixture was allowed to warm to RT and stirred overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified prep. TLC (DCM/MeOH=20/1) to give the title compound.

Method FD

[0539] ##STR00206##

[0540] To a solution of the amine (0.5 mmol, 1.0 eq.) in anhydrous THF (10 mL) at −78° C. under N.sub.2 was added KHMDS (1 M solution in THF, equivalents specified in Table F) dropwise and the mixture was stirred at −78° C. or 0° C. for 30 min to 1 h (specified in Table F). A solution of the sulfonyl chloride (equivalents specified in Table F) in anhydrous THF (2.0 mL) was then added dropwise and the mixture was allowed to warm to RT and stirred overnight. Water was added and the mixture was extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography or prep. TLC to give the title compound.

TABLE-US-00010 TABLE F Intermediates Name and structure Analytical (if applicable) Method Notes 89 [00207]   N-(6-Bromo-4- LCMS-C: R.sub.t 2.18 min, m/z 442.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.80 (s, 1H), 7.54-7.48 (m, 2H), 7.05 (s, 1H), 6.78 (d, J = 8.4 Hz, 2H), 3.92 (s, 3H), 3.76 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 6-Bromo-4- methoxybenzo [d]isoxazol-3- amine I22 FA 4 eq. LiHMDS used. Prep. TLC (DCM/ MeOH = 100/1) methoxybenzo[d] isoxazol-3-yl)-2,6- dimethoxybenzenesulfonamide 90 [00208]   N-(4- Methoxybenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-C: R.sub.t 1.97 min, m/z 304.9 [M + H].sup.+; .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.21 (d, J = 7.2 Hz, 2H), 7.82 (s, 1H), 7.61-7.54 (m, 3H), 7.43 (t, J = 8.0 Hz, 1H), 7.02 (d, J = 8.0 Hz, 1H), 6.59 (d, J = 7.6 Hz, 1H), 3.91 (s, 3H). FA Stirred 2 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 100/1) 91 [00209]   3,5-Dimethoxy-N-(4- methoxy-6- LCMS-C: R.sub.t 2.33 min, m/z 485.0 [M + H].sup.+; .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.26 (s, 1H), 7.52 (d, J = 6.8 Hz, 2H), 7.46-7.42 (m, 3H), 6.98 (s, 1H), 6.73 (s, 2H), 6.65 (s, 1H), 4.51 (s, 2H), 4.04 (s, 3H), 3.94 (s, 6H), 3.41 (s, 3H). 3,5- Dimethoxy- [1,1-biphenyl]- 4-sulfonyl chloride I116 4-Methoxy-6- (methoxymethyl) benzo[d]isoxazol- 3-amine I9 FA 5 eq. LiHMDS used, stirred 2 h before adding sulfonyl chloride. Column chroma- tography (Pet. ether/ EtOAc = 2/1) (methoxymethyl)benzo [d]isoxazol-3-yl)-[1,1- biphenyl]-4-sulfonamide 92 [00210]   N-(6-(3- Hydroxyphenyl)-4- methoxybenzo[d]isoxazol- 3-yl)-2,6- dimethoxybenzenesulfonamide LCMS-C: R.sub.t 2.19 min, m/z 457.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.64 (s, 1H), 9.62 (s, 1H), 7.53 (t, J = 8.8 Hz, 1H), 7.35 (s, 1H), 7.30 (t, J = 8.0 Hz, 1H), 7.19 (d, J = 7.6 Hz, 1H), 7.12 (s, 1H), 7.01 (s, 1H), 6.85- 6.78 (m, 3H), 4.01 (s, 3H), 3.79 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 3-(3-Amino-4- methoxybenzo [d]isoxazol-6- yl)phenol I19 FA 8 eq. LiHMDS used, stirred 1 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 30/1) 93 [00211]   2,6-Dimethoxy-N-(4- methoxy-6-(1- LCMS-C: R.sub.t 1.94 min, m/z 423.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.56 (s, 1H), 7.51 (t, J = 8.4 Hz, 1H), 7.08 (s, 1H), 6.80 (d, J = 8.4 Hz, 2H), 6.78 (s, 1H), 4.45 (q, J = 6.4 Hz, 1H), 3.92 (s, 3H), 3.78 (s, 6H), 3.17 (s, 3H), 1.37 (d, J = 6.4 Hz, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 4-Methoxy-6- (1- methoxyethyl) benzo[d]isoxazol- 3-amine I15 FA Stirred 2 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 75/1) methoxyethyl)benzo[d] isoxazol-3- yl)benzenesulfonamide 94 [00212]   3-Ethyl-2,6-dimethoxy-N-(4- methoxybenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-C: R.sub.t 2.31 min, m/z 393.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.57 (s, 1H), 7.57 (t, J = 8.0 Hz, 1H), 7.46 (d, J = 8.8 Hz, 1H), 7.16 (d, J = 8.8 Hz, 1H), 6.93 (d, J = 8.8 Hz, 1H), 6.85 (d, J = 8.0 Hz, 1H), 3.92 (s, 3H), 3.78 (s, 3H), 3.75 (s, 3H), 2.60 (q, J = 7.2 Hz, 3-Ethyl-2,6- dimethoxyben- zenesulfonyl chloride I106 FA Stirred 3 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 75/1) 2H), 1.15 (t, J = 7.2 Hz, 3H). 95 [00213]   3,5-Dimethoxy-N-(4- methoxybenzo[d]isoxazol- LCMS-C: R.sub.t 2.34 min, m/z 441.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.60 (s, 1H), 7.79 (d, J = 6.8 Hz, 2H), 7.58-7.44 (m, 4H), 7.17 (d, J = 8.0 Hz, 1H), 6.99 (s, 2H), 6.87 (d, J = 7.6 Hz, 1H), 3.95 (s, 3H), 3.88 (s, 6H). 3,5- Dimethoxy- [1,1-biphenyl]- 4-sulfonyl chloride I116 FA 3.3 eq. LiHMDS used, stirred at −70° C. for 3 h before adding 1.8 eq. sulfonyl chloride. Purification: Precipitated from DCM with Pet. ether 3-yl)-[1,1-biphenyl]- 4-sulfonamide 96 [00214]   2,4-Dimethoxy-N-(4- LCMS-C: R.sub.t 2.42 min, m/z 441.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.84 (s, 1H), 7.59-7.54 (m, 2H), 7.48-7.42 (m, 4H), 7.39-7.35 (m, 1H), 7.18 (d, J = 8.0 Hz, 1H), 7.07 (d, J = 8.8 Hz, 1H), 6.87 (d, J = 8.0 Hz, 1H), 3.91 (s, 3H), 3.81 (s, 3H), 3.34 (s, 3H). 2,4- Dimethoxy- [1,1-biphenyl]- 3-sulfonyl chloride I114 FA 2 eq. LiHMDS used and stirred 3 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 50/1) methoxybenzo[d]isoxazol- 3-yl)-[1,1-biphenyl]- 3-sulfonamide 97 [00215]   2,6-Dimethoxy-N-(6- LCMS-D: R.sub.t 2.38 min, m/z 393.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.3 (s, 1H), 7.81 (s, 1H), 7.48- 7.45 (m, 2H), 6.75- 6.73 (m, 2H), 4.51 (s, 2H), 3.73 (s, 6H), 3.35 (s, 3H), 2.31 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 6-(Methoxy methyl)-5- methylbenzo[d] isoxazol-3- amine I4 FA 2 eq. LiHMDS used, stirred 2.5 h before adding 3 eq. sulfonyl chloride. Purified by prep-HPLC (methoxymethyl)-5- methylbenzo[d]isoxazol-3- yl)benzenesulfonamide 98 [00216]   7-Methoxy-N-(4- methoxybenzo[d]isoxazol- 3-yl)quinoline-8- sulfonamide LCMS-D: R.sub.t 1.79 min, m/z 385.8 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.6 (s, 1H), 8.98 (dd, J = 4.4, 1.6 Hz, 1H), 8.46 (dd, J = 8.0, 1.6 Hz, 1H), 8.31 (d, J = 5.6 Hz, 1H), 7.55 (dd, J = 8.0, 4.0 Hz, 1H), 7.52 (d, J = 6.0 Hz, 1H), 7.50 (t, J = 8.0 Hz, 1H), 7.08 (d, J = 8.4 Hz, 7-Methoxy quinoline-8- sulfonyl chloride I107 FA LiHMDS added at −60° C. and stirred at 0° C. for 1 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 20/1) 1H), 6.81 (d, J = 8.0 Hz, 1H), 4.06 (s, 3H), 3.99 (s, 3H). 99 [00217] LCMS-D: R.sub.t 2.91 min, m/z 427.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 7.79 (d, J = 8.8 Hz, 2H), 7.56 (t, J = 8.4 Hz, 1H), 7.15-6.99 (m, 7H), 6.82 (d, J = 8.0 Hz, 1H), 3.90 (s, 3H), 3.76 (s, 3H). 2-Methoxy-5- phenoxyben- zenesulfonyl chloride I100 FA 1.1 eq. LiHMDS and 1.05 eq. sulfonyl chloride used. Product not purified 2-Methoxy-N-(4- methoxybenzo[d]isoxazol- 3-yl)-5- phenoxybenzenesulfonamide 100 [00218]   2,6-Dimethoxy-N-(5- (trifluoromethoxy)benzo LCMS-D: R.sub.t 2.61 min, m/z 419.0 [M + H].sup.+; .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 8.01 (d, J = 0.8 Hz, 1H), 7.59-7.42 (m, 3H), 6.71 (d, J = 8.8 Hz, 2H), 3.82 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 5- (Trifluorometh- oxy)benzo[d] isoxazol-3-amine I63 FA Added LiHMDS at −60° C. and stirred at 0° C. for 1 h before adding sulfonyl chloride. Prep. TLC (Pet. ether/ EtOAc = 5/1) [d]isoxazol-3- yl)benzenesulfonamide 101 [00219]   2,6-Dimethoxy-N-(4- methoxybenzo[d]isoxazol- LCMS-D: R.sub.t 2.64 min, m/z 433.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.5 (s, 1H), 7.92 (d, J = 8.8 Hz, 1H), 7.59 (t, J = 8.0 Hz, 1H), 7.20-7.14 (m, 2H), 6.85 (d, J = 8.4 Hz, 1H), 3.87 (s, 6H), 3.85 (s, 3H). 2,6-Dimethoxy- 3-(trifluoro methyl)benzene- sulfonyl chloride I102 FA Added 2 eq. LiHMDS at 0° C. Prep. TLC (Pet. ether/ EtOAc = 1/1) 3-yl)-3- (trifluoromethyl)benzenesulfonamide 102 [00220]   2,6-Dimethoxy-N-(5- methyl-6-(oxazol-2- yl)benzo[d]isoxazol-3- LCMS-D: R.sub.t 2.42 min, m/z 415.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 8.32 (s, 1H), 7.07 (t, J = 8.4 Hz, 2H), 7.50-7.30 (m, 2H), 6.76 (d, J = 8.4 Hz, 2H), 3.75 (s, 6H), 2.70 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 5-Methyl-6- (oxazol-2-yl) benzo[d]isoxazol- 3-amine I65 FA 1.5 eq. LiHMDS used. Prep. TLC (Pet. ether/ EtOAc = 1/2) yl)benzenesulfonamide 103 [00221]   2,6-Dimethoxy-N-(6- (methoxymethyl)benzo [d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.22 min, m/z 378.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.4 (s, 1H), 8.04 (d, J = 8.4 Hz, 1H), 7.50-7.45 (m, 2H), 7.31 (d, J = 8.4 Hz, 1H), 6.75 (d, J = 8.8 Hz, 2H), 4.55 (s, 2H), 3.73 (s, 6H), 3.32 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 6-(Methoxy methyl)benzo [d]isoxazol-3- amine I62 FA Added LiHMDS at −78° C. and stirred at 0° C. for 30 min before adding sulfonyl chloride. Prep. TLC (Pet. ether/ EtOAc = 2/1) 104 [00222]   2,6-Dimethoxy-N-(5- methylbenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.40 min, m/z 348.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.3 (s, 1H), 7.83 (s, 1H), 7.49- 7.44 (m, 3H), 6.75 (d, J = 8.4 Hz, 2H), 3.74 (s, 6H), 2.40 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 5-Methyl benzo[d]isoxazol- 3-amine I60 FA Added LiHMDS at −60° C. and stirred at 0° C. for 1 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 20/1) 105 [00223]   N-(6-(3,5-Dimethyl-1H- pyrazol-1- yl)benzo[d]isoxazol-3- yl)-2,6- dimethoxybenzenesulfonamide LCMS-D: R.sub.t 2.44 min, m/z 429.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 8.16 (d, J = 8.8 Hz, 1H), 7.74 (d, J = 1.6 Hz, 1H), 7.57 (dd, J = 8.8, 2.0 Hz, 1H), 7.48 (t, J = 8.8 Hz, 1H), 6.75 (d, J = 8.4 Hz, 2H), 6.13 (s, 1H), 3.75 (s, 6H), 2.36 (s, 3H), 2.19 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 6-(3,5- Dimethyl-1H- pyrazol-1-yl) benzo[d]isoxazol- 3-amine I59 FC 106 [00224]   4,6-Dimethoxy-N-(4- methoxybenzo[d]isoxazol- 3-yl)-2,3-dihydro-1H- indene-5-sulfonamide LCMS-D: R.sub.t 2.58 min, m/z 405.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.40 (s, 1H), 7.58 (t, J = 8.0 Hz, 1H), 7.16 (d, J = 8.0 Hz, 1H), 6.86- 6.84 (m, 2H), 3.96 (s, 3H), 3.80 (s, 3H), 3.75 (s, 3H), 2.88-2.84 (m, 4H), 2.02-1.99 (m, 2H). 4,6- Dimethoxy- 2,3-dihydro- 1H-indene-5- sulfonyl chloride I98 FA Added 1.33 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 0.67 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 1/1) 107 [00225]   N-(4- Chlorobenzo[d]isoxazol- 3-yl)-5-ethyl-1-methyl- 2-oxo-1,2- LCMS-D: R.sub.t 2.34 min, m/z 368.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.5 (s, 1H), 7.98 (s, 2H), 7.70- 7.62 (m, 2H), 7.45 (d, J = 7.2 Hz, 1H), 3.50 (s, 3H), 2.46 (q, J = 7.2 Hz, 2H), 1.13 (t, J = 7.2 Hz, 3H). 5-Ethyl-1- methyl-2-oxo- 1,2- dihydropyridine- 3-sulfonyl chloride I94 FA Added 2.1 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 2 eq. sulfonyl chloride. Column chromato- graphy (DCM/ MeOH = 50/1) dihydropyridine-3- sulfonamide 108 [00226]   N-(5-Bromo-4- methoxybenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.82 min, m/z 441.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.8 (s, 1H), 7.86 (d, J = 8.8 Hz, 1H), 7.62 (d, J = 1.2 Hz, 1H), 7.50- 7.43 (m, 2H), 7.17 (d, J = 8.8 Hz, 1H), 3.91 (s, 3H), 3.79 (s, 3H), 2.64 (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 Hz, 3H). 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 5-Bromo-4- methoxybenzo [d]isoxazol-3- amine I48 FD Added 2 eq. KHMDS, stirred at 0° C. for 1 h before adding 2 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 50/1 to 3/1) 109 [00227]   N-(5- Ethoxybenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.78 min, m/z 377.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 7.69 (d, J = 2.0 Hz, 1H), 7.50-7.44 (m, 3H), 7.20 (dd, J = 9.8, 2.4 Hz, 1H), 7.10 (d, J = 8.8 Hz, 1H), 4.06 (q, J = 7.4 Hz, 2H), 3.74 (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 1.38 (t, J = 6.8 Hz, 3H), 1.16 (t, J = 7.6 Hz, 3H). 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 5-Ethoxy benzo[d]isoxazol- 3-amine I57 FB Column chromato- graphy (Pet. ether/ EtOAc = 4/1 to 3/1) 110 [00228] LCMS-D: R.sub.t 2.66 min m/z 377.1 [M + H].sup.+; 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 4-(Methoxy methyl)benzo [d]isoxazol-3- amine I51 FB Prep. TLC (Pet. ether/ EtOAc = 2/1) 5-Ethyl-2-methoxy-N- (4- (methoxymethyl)benzo [d]isoxazol-3- yl)benzenesulfonamide 111 [00229]   5-Ethyl-2-methoxy-N- (5-methoxybenzo[d] isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.65 min, m/z 363.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 7.69 (d, J = 2.0 Hz, 1H), 7.52-7.44 (m, 3H), 7.23 (dd, J = 9.8, 2.4 Hz, 1H), 7.10 (d, J = 8.8 Hz, 1H), 3.79 (s, 3H), 3.75 (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 1.16 (t, J = 7.6 Hz, 3H). 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 5-Methoxy benzo[d]isoxazol- 3-amine I54 FB Prep. TLC 112 [00230]   N-(4- Ethoxybenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-E: R.sub.t 5.57 min m/z 376.7 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.68 (s, 1H), 7.67 (d, J = 2.0 Hz, 1H), 7.56-7.45 (m, 2H), 7.16-7.08 (m, 2H), 6.83 (d, J = 8.0 Hz, 1H), 4.19 (q, J = 7.2 Hz, 2H), 3.63 (s, 3H), 2.64 (q, J = 7.6 Hz, 2H), 1.31 (t, J = 7.4 Hz, 3H), 1.17 (t, J = 7.6 Hz, 3H). 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 4-Ethoxy benzo[d]isoxazol- 3-amine I53 FA Added 1.5 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 1.5 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 3/1) 113 [00231]   N-(5- Bromobenzo[d]isoxazol- 3-yl)-3-methoxy- 5,6,7,8- tetrahydronaphthalene- 2-sulfonamide LCMS-D: R.sub.t 3.07 min, m/z 437.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.6 (s, 1H), 8.25 (s, 1H), 7.78 (dd, J = 8.8, 2.0 Hz, 1H), 7.62-7.56 (m, 2H), 6.85 (s, 1H), 3.69 (s, 3H), 2.73-2.69 (m, 4H), 1.71 (m, 4H). 3-Methoxy- 5,6,7,8- tetrahydro- naphthalene-2- sulfonyl chloride I109 5-Bromo benzo[d]isoxazol- 3-amine I40 FA Added 2 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 2 eq. sulfonyl chloride. Column chromato- graphy (DCM/ MeOH = 200/1 to 100/1) 114 [00232]   5-Bromo-N-(4- chlorobenzo[d]isoxazol- 3-yl)-2- methylbenzenesulfonamide LCMS-D: R.sub.t 2.82 min, m/z 401.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 8.02 (d, J = 2.0 Hz, 1H), 7.73- 7.76 (m, 3H), 7.43- 7.35 (m, 2H), 2.49 (s, 3H). FA Added 1 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 0.67 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 6/1) 115 [00233]   Methyl 4-chloro-2-(N- (4- chlorobenzo[d]isoxazol- LCMS-D: R.sub.t 2.78 min, m/z 401.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 8.09 (d, J = 2.0 Hz, 1H), 7.88 (d, J = 8.4 Hz, 1H), 7.74-7.65 (m, 3H), 7.48 (d, J = 7.6 Hz, 1H), 3.64 (s, 3H). FD Added 0.67 eq. KHMDS, stirred at 0° C. for 1 h before adding 0.67 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 1/1) 3-yl)sulfamoyl)benzoate 116 [00234]   5-Ethyl-2-methoxy-N- (4- methoxybenzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.56 min, m/z 363.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.96 (s, 1H), 7.66 (d, J = 1.6 Hz, 1H), 7.57 (t, J = 8.0 Hz, 1H), 7.48-7.46 (m, 1H), 7.12-7.11 (m, 2H), 6.84 (d, J = 8.0 Hz, 1H), 3.87 (s, 3H), 3.75 (s, 3H), 2.64 (q, J = 7.6 Hz, 2H), 1.17 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 FA Added 2 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 2 eq. sulfonyl chloride. Column chromato- graphy (DCM/ MeOH = (t, J = 7.6 Hz, 3H). 30/1) 117 [00235]   N-(4- Chlorobenzo[d]isoxazol- 3-yl)-2,3,4- trifluorobenzenesulfonamide LCMS-D: R.sub.t 2.59 min, m/z 363.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 7.74-7.69 (m, 1H), 7.54-7.40 (m, 3H), 7.31 (d, J = 7.0 Hz, 1H). FA Added 1 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 1 eq. sulfonyl chloride. Column chromato- graphy (DCM/ MeOH = 100/1 to 30/1) 118 [00236]   N-(4- Chlorobenzo[d]isoxazol- 3-yl)-3- LCMS-D: R.sub.t 2.62 min, m/z 374.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 8.81 (d, J = 2.4 Hz, 1H), 8.34- 8.25 (m, 3H), 7.76- 7.61 (m, 3H), 7.43 (d, J = 8.8 Hz, 1H), 2.50 (s, 3H). FA Added 1.5 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 1.5 eq. sulfonyl chloride. Column chromato- graphy (DCM/ MeOH = 20/1) methylquinoline-8- sulfonamide 119 [00237]   N-(4- Chlorobenzo[c]isoxazol- 3-yl)-6-methoxy-2,3- dihydro-1H-indene-5- LCMS-D: R.sub.t 2.69 min, m/z 379.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.4 (s, 1H), 7.75-7.63 (m, 2H), 7.58 (s, 1H), 7.47 (d, J = 7.2 Hz, 1H), 7.11 (s, 1H), 3.69 (s, 3H), 2.93 (t, J = 7.2 Hz, 2H), 2.84 (t, J = 7.2 Hz, 2H), 2.07-2.00 (m, 2H). 6-Methoxy-2,3- dihydro-1H- indene-5- sulfonyl chloride I108 FD Added 0.67 eq. KHMDS, stirred at 0° C. for 1 h before adding 0.67 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 1/1) sulfonamide 120 [00238]   N-(4- Chlorobenzo[c]isoxazol- 3-yl)-3-methoxy- 5,6,7,8- tetrahydronaphthalene- 2-sulfonamide LCMS-D: R.sub.t 2.86 min, m/z 393.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.4 (s, 1H), 7.73-7.64 (m, 2H), 7.48 (d, J = 7.6 Hz, 1H), 7.45 (s, 1H), 6.91 (s, 1H), 3.67 (s, 3H), 2.78 (m, 2H), 2.67 (m, 2H), 1.72 (m, 4H). 3-Methoxy- 5,6,7,8- tetrahydronaph- thalene-2- sulfonyl chloride I109 FA Added 1 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 1 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 50/1 to 2/1) 121 [00239]   5-Ethyl-2-methoxy-N- (4- (trifluoromethyl)benzo[d] isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.74 min, m/z 401.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.3 (s, 1H), 8.14 (t, J = 6.4 Hz, 1H), 7.91-7.88 (m, 2H), 7.55 (d, J = 2.4 Hz, 1H), 7.51 (dd, J = 8.8, 2.4 Hz, 1H), 7.20 (d, J = 8.4 Hz, 1H), 3.82 (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 Hz, 3H). 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 4- (Trifluoromethyl) benzo[d]isoxazol- 3-amine I42 FA Added 2 eq. LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding 2 eq. sulfonyl chloride. Column chromato- graphy (DCM/ MeOH = 20/1) 122 [00240]   N-(4- Chlorobenzo[c]isoxazol- 3-yl)quinoxaline-5- LCMS-D: R.sub.t 2.30 min, m/z 361.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.0 (s, 1H), 9.09 (d, J = 1.4 Hz, 1H), 9.08(d, J = 1.4 Hz, 1H), 8.47- 8.43 (m, 2H), 8.05 (t, J = 8.0 Hz, 1H), 7.72-7.62 (m, 2H), 7.42 (d, J = 7.8 Hz, 1H). FA 2 eq. LiHMDS used. Purification: dissolved in 2 M aq. NaOH, washed with EtOAc, then acidified to pH 2 and extracted with DCM sulfonamide 123 [00241]   N-(4- chlorobenzo[d]isoxazol- LCMS-D: R.sub.t 2.41 min, m/z 360.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 8.93 (dd, J = 4.3, 1.8 Hz, 1H), 8.58 (dd, J = 8.4, 1.8 Hz, 1H), 8.40- 8.35 (m, 2H), 7.79 (t, J = 7.8 Hz, 1H), 7.73-7.60 (m, 3H), 7.41 (d, J = 7.4 Hz, 1H). FA 2 eq. LiHMDS used. Purification: dissolved in 2 M aq NaOH, washed with EtOAc, then acidified to pH 2 and extracted with DCM 3-yl)quinoline-8- sulfonamide 124 [00242]   N-(4- LCMS-D: R.sub.t 2.60 min, m/z 359.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 8.73 (t, J = 8.4 Hz, 1H), 8.31- 8.24 (m, 2H), 8.14 (d, J = 7.8 Hz, 1H), 7.74-7.63 (m, 5H), 7.46 (d, J = 7.2 Hz, 1H). FA 2 eq. LiHMDS used. Column chromato- graphy (Pet. ether/ EtOAc = 50/1 to 2/1 Chlorobenzo[d]isoxazol- 3-yl)naphthalene-1- sulfonamide 125 [00243]   N-(6-(1H-1,2,3-Triazol- 1-yl)benzo[d]isoxazol-3- yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.48 min, m/z 400.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.9 (s, 1H), 8.96 (s, 1H), 8.26- 8.23 (m, 2H), 8.04- 8.01 (m, 2H), 7.73 (d, J = 2.0 Hz, 1H), 7.49 (dd, J = 8.4, 2.0 Hz, 1H), 7.11 (d, J = 8.4 Hz, 1H), 3.73 (s, 3H), 2.65 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-(1H-1,2,3- Triazol-1- yl)benzo[d] isoxazol-3-amine I36 FB Column chromato- graphy (DCM/ MeOH = 100/0 to 50/1) (q, J = 8.0 Hz, 2H), 1.23 (t, J = 8.0 Hz, 3H). 126 [00244]   5-Ethyl-2-methoxy-N- (6-(pyrimidin-2- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.65 min, m/z 411.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.8 (s, 1H), 8.98 (d, J = 4.8 Hz, 2H), 8.43 (d, J = 8.4 Hz, 1H), 8.48 (s, 1H), 8.20 (d, J = 8.4 Hz, 1H), 7.73 (d, J = 2.0 Hz, 1H), 7.55 (t, J = 4.8 Hz, 1H), 7.48 (dd, J = 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-(Pyrimidin-2- yl)benzo[d] isoxazol-3-amine I39 FB Prep. TLC (DCM/ MeOH = 50/1) 8.4, 2.0 Hz, 1H), 7.11 (d, J = 8.8 Hz, 1H), 3.72 (s, 3H), 2.65 (q, J = 7.2 H, 2H), 1.17 (t, J = 7.2 Hz, 3H). 127 [00245]   5-Bromo-N-(4- chlorobenzo[d]isoxazol- 3-yl)-2,3- dihydrobenzofuran-7- LCMS-D: R.sub.t 2.66 min, m/z 428.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.2 (s, 1H), 7.75-7.65 (m, 3H), 7.58 (d, J = 2.0 Hz, 1H), 7.48 (d, J = 7.2 Hz, 1H), 4.57 (t, J = 8.8 Hz, 2H), 3.26 (t, J = 8.8 Hz, 2H). 5-Bromo-2,3- dihydrobenzo- furan-7-sulfonyl chloride I95 FA Added LiHMDS at −78° C. and stirred at 0° C. for 1 h before adding sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 5/1) sulfonamide 128 [00246]   N-(5-Bromo-4- chlorobenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-E: R.sub.t 5.81 min, m/z 444.7 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.7 (s, 1H), 8.02 (d, J = 8.8 Hz, 1H), 7.74 (d, J = 8.8 Hz, 1H), 7.60 (d, J = 2.4 Hz, 1H), 7.50-7.48 (m, 1H), 7.16 (d, J = 8.4 Hz, 1H), 3.66 (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 5-Bromo-4- chlorobenzo[d] isoxazol-3- amine I44 FD Added 1 eq. KHMDS, stirred at −78° C. for 30 min before adding 2 eq. sulfonyl chloride. Column chromato- graphy (Pet. ether/ EtOAc = 50/1 to 2/1) Hz, 3H). 129 [00247]   N-(4- Bromobenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.69 min, m/z 410.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.4 (s, 1H), 7.78 (d, J = 8.0 Hz, 1H), 7.65-7.56 (m, 3H), 7.49 (dd, J = 8.4, 2.4 Hz, 1H), 7.15 (d, J = 8.4 Hz, 1H), 3.68 (s, 3H), 2.60 (q, J = 7.6 Hz, 2H), 1.16 (t, J = 7.6 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 4- Bromobenzo[d] isoxazol-3- amine I41 FA 1.5 eq. LiHMDS used. Column chromato- graphy (Pet. ether/ EtOAc = 2/1 to 1/1) Hz, 3H). 130 [00248]   N-(6-(2H-1,2,3-Triazol- 2-yl)benzo[d]isoxazol-3- yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.77 min, m/z 400.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.9 (s, 1H), 8.24-8.17 (m, 3H), 8.12-8.10 (m, 2H), 7.70 (s, 1H), 7.48 (d, J = 8.4 Hz, 1H), 7.11 (d, J = 8.4 Hz, 1H), 3.76 (s, 3H), 2.65 (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 Hz, 3H). 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-(2H-1,2,3- Triazol-2- yl)benzo[d] isoxazol-3-amine I72 FB 3 eq. sulfonyl chloride used. Prep. TLC (DCM/ MeOH = 50/1) 131 [00249]   N-(6-(1H-Pyrazol-1- yl)benzo[d]isoxazol-3- yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.61 min, m/z 399.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.8 (s, 1H), 8.66 (d, J = 2.4 Hz, 1H), 8.15 (d, J = 8.4 Hz, 1H), 8.07 (d, J = 2.0 Hz, 1H), 7.97 (dd, J = 8.8, 2.0 Hz, 1H), 7.83 (d, J = 1.2 Hz, 1H), 7.72 (d, J = 2.0 Hz, 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-(1H-Pyrazol- 1-yl)benzo [d]isoxazol-3- amine I70 FB 3 eq. sulfonyl chloride used. Column chromato- graphy (DCM/ MeOH = 50/1) 1H), 7.48 (dd, J = 8.4, 2.0 Hz, 1H), 7.11 (d, J = 8.4 Hz, 1H), 6.62 (d, J = 1.2 Hz, 1H), 3.73 (s, 3H), 2.65 (q, J = 7.6 Hz, 2H), 1.18 (t, J = 7.6 Hz, 3H). 132 [00250]   N-(7- Ethoxybenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.67 min, m/z 377.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.6 (s, 1H), 7.69 (d, J = 2.0 Hz, 1H), 7.57 (d, J = 7.6 Hz, 1H), 7.46 (dd, J = 8.8, 2.0 Hz, 1H), 7.26 (d, J = 8.0 Hz, 1H), 7.15 (d, J = 8.0 Hz, 1H), 7.08 (d, J = 8.4 Hz, 1H), 4.21 (q, J = 6.8 Hz, 2H), 3.72 (s, 3H), 3.62 (q, J = 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 7-Ethoxybenzo [d]isoxazol-3- amine I26 FB Column chromato- graphy (Pet. ether/ EtOAc = 5/1) 7.6 Hz, 2H), 1.36 (t, J = 6.8 Hz, 3H), 1.16 (t, J = 7.6 Hz, 3H). 133 [00251]   N-(7- (Cyclopropylmethoxy) benzo[d]isoxazol-3-yl)-5- ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.87 min, m/z 403.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.6 (s, 1H), 7.69 (d, J = 1.6 Hz, 1H), 7.56 (d, J = 8.0 Hz, 1H), 7.46 (d, J = 8.0 Hz, 1H), 7.24 (t, J = 8.0 Hz, 1H), 7.14 (d, J = 7.6 Hz, 1H), 7.09 (d, J = 8.4 Hz, 1H), 3.99 (d, J = 7.2 Hz, 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 7- (Cyclopropyl- methoxy)benzo [d]isoxazol-3- amine I28 FB Column chromato- graphy (DCM/ MeOH = 200/1) 2H), 3.72 (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 1.30 (m, 1H), 1.16 (t, J = 7.6 H, 3H), 0.59-0.54 (m, 2H), 0.35-0.30 (m, 2H). 134 [00252]   N-(6- (Cyclopropylmethoxy) benzo[d]isoxazol-3-yl)- 5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.89 min, m/z 403.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 7.87 (d, J = 8.8 Hz, 1H), 7.68 (d, J = 2.4 Hz, 1H), 7.46 (dd, J = 8.4, 2.0 Hz, 1H), 7.09-7.07 (m, 2H), 6.96 (dd, J = 8.8, 2.0 Hz, 1H), 3.88 (d, J = 6.8 Hz, 2H), 3.73 (s, 3H), 2.63 (q, J = 7.6 Hz, 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-(Cyclopropyl methoxy)benzo [d]isoxazol-3- amine I33 FB Purified by prep. HPLC 2H), 1.30 (m, 1H), 1.16 (t, J = 7.6 Hz, 3H), 0.60-0.55 (m, 2H), 0.25-0.22 (m, 2H). 135 [00253]   N-(5- Bromobenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.83 min, m/z 410.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.8 (s, 1H), 8.25 (s, 1H), 8.78 (d, J = 8.8 Hz, 1H), 7.71 (s, 1H), 7.62 (d, J = 8.8 Hz, 1H), 7.48 (d, J = 8.0 Hz, 1H), 7.11 (d, J = 8.4 Hz, 1H), 3.72 (s, 3H), 3.64 (q, J = 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 5-Bromo benzo[d]isoxazol- 3-amine I40 FA 2 eq. LiHMDS and 2 eq. sulfonyl chloride used. Prep. TLC (Pet. ether/ EtOAc = 2/1) 7.2 Hz, 2H), 1.17 (t, J = 7.2 Hz, 3H). 136 [00254]   5-Ethyl-2-methoxy-N- (7-(pyrimidin-2- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.52 min, m/z 411.1 [M + H].sup.+; .sup.1H NMR (400 MHz, methanol- d.sub.4/CDCl.sub.3) δ 8.87 (d, J = 4.8 Hz, 2H), 8.51 (d, J = 7.6 Hz, 1H), 8.15-8.13 (m, 1H), 7.76 (d, J = 2.4 Hz, 1H), 7.49 (t, J = 8.0 Hz, 1H), 7.37-7.33 (m, 2H), 6.95 (d, J = 8.8 Hz, 1H), 3.81 (s, 3H), 2.61 (q, J = 7.6 Hz, 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 7-(Pyrimidin-2- yl)benzo[d] isoxazol-3-amine I68 FB Prep. TLC (Pet. ether/ EtOAc = 1/1) 2H), 1.18 (t, J = 7.6 Hz, 3H). 137 [00255]   N-(7- Bromobenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.85 min, m/z 411.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.9 (s, 1H), 8.08 (d, J = 8.0 Hz, 1H), 7.89 (d, J = 7.2 Hz, 1H), 7.71 (d, J = 2.0 Hz, 1H), 7.48 (d, J = 8.4 Hz, 1H), 7.34 (d, J = 7.6 Hz, 1H), 7.10 J = 8.4 Hz, 1H), 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 7-Bromobenzo [d]isoxazol-3- amine I66 FB 3 eq. sulfonyl chloride used. Prep. TLC (Pet. ether/ EtOAc = 5/1) 3.71 (s, 3H), 2.64 (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 Hz, 3H). 138 [00256]   N-(6- Bromobenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.93 min, m/z 411.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.8 (s, 1H), 8.08-7.99 (m, 2H), 7.70 (d, J = 2.0 Hz, 1H), 7.58 (dd, J = 8.8, 1.6 Hz, 1H), 7.48 (dd, J = 8.8, 2.0 Hz, 1H), 7.10 (d, J = 8.4 Hz, 1H), 3.71 (s, 3H), 2.64 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-Bromobenzo [d]isoxazol-3- amine I75 FB 1.8 eq. sulfonyl chloride used. Column chromato- graphy (Pet. ether/ EtOAc = 100/0 to 5/1) (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 Hz, 3H). 139 [00257]   N-(6- Ethoxybenzo[d]isoxazol- 3-yl)-5-ethyl-2- methoxybenzenesulfonamide LCMS-D: R.sub.t 2.76 min, m/z 377.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 7.88 (d, J = 8.8 Hz, 1H), 7.66 (d, J = 2.0 Hz, 1H), 7.47- 7.44 (m, 1H), 7.11- 7.08 (m, 1H), 6.94 (dd, J = 8.8, 2.0 Hz, 1H), 4.11 (q, J = 7.2 Hz, 2H), 3.73 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-Ethoxy benzo[d]isoxazol- 3-amine I32 FB Column chromato- graphy (Pet. ether/ EtOAc = 100/0 to 5/1) (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 1.36 (t, J = 7.2 Hz, 3H), 1.17 (t, J = 7.6 Hz, 3H). 140 [00258]   5-Ethyl-2-methoxy-N- (6-(pyridin-2- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.63 min, m/z 410.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.8 (s, 1H), 8.74-8.69 (m, 1H), 8.26 (s, 1H), 8.18-8.09 (m, 3H), 7.98-7.90 (m, 1H), 7.72 (d, J = 2.3 Hz, 1H), 7.50- 7.39 (m, 2H), 7.13-7.06 (m, 5-Ethyl-2- methoxybenzene- sulfonyl chloride I112 6-(Pyridin-2- yl)benzo[d] isoxazol-3-amine I74 FB Column chromato- graphy (DCM/ MeOH = 100/0 to 100/1) 1H), 3.73 (s, 3H), 2.61 (q, J = 7.6 Hz, 2H), 1.15 (t, J = 7.6 Hz, 3H). 141 [00259]   N-(benzo[d]isoxazol-3- LCMS-D: R.sub.t 2.58 min, m/z 382.9 [M + H].sup.+; 4-Bromo-2- methoxybenzene- sulfonyl chloride I110 FB 1.2 eq. sulfonyl chloride used. Column chromato- graphy (Pet. ether/ EtOAc = 5/1 to 2/1) yl)-4-bromo-2- methoxybenzenesulfonamide 142 [00260]   2,6-Dimethoxy-N-(4- methoxy-7- LCMS-C: R.sub.t 2.39 min, m/z 441.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.62 (s, 1H), 7.90-7.69 (m, 3H), 7.59-7.32 (m, 4H), 6.97 (d, J = 8.4 Hz, 1H), 6.86- 6.73 (m, 2H), 3.98 (s, 3H), 3.79 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 4-Methoxy-7- phenylbenzo[d] isoxazol-3- amine I80 FA 4 eq. LiHMDS used, stirred 2 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 100/1) phenylbenzo[d]isoxazol-3- yl)benzenesulfonamide 143 [00261]   2,6-Dimethoxy-N-(4- methoxy-7-(1-methyl- 1H-pyrazol-4- yl)benzo[d]isoxazol-3- LCMS-C: R.sub.t 1.89 min, m/z 445.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.58 (s, 1H), 8.22 (s, 1H), 7.96 (s, 1H), 7.80 (d, J = 8.2 Hz, 1H), 7.50 (t, J = 8.5 Hz, 1H), 6.88 (d, J = 8.3 Hz, 1H), 6.78 (d, J = 8.5 Hz, 2H), 3.95 (s, 3H), 3.88 (s, 3H), 3.79 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 4-Methoxy-7- (1-methyl-1H- pyrazol-4- yl)benzo[d] isoxazol-3-amine I82 FA 4 eq. LiHMDS used, stirred 2 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 30/1) yl)benzenesulfonamide 144 [00262]   2,6-Dimethoxy-N-(4- methoxy-6-(oxazol-2- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-C: R.sub.t 1.81 min, m/z 431.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.81 (s, 1H), 8.33 (d, J = 0.9 Hz, 1H), 7.73 (d, J = 0.9 Hz, 1H), 7.51 (t, J = 8.5 Hz, 1H), 7.48 (d, J = 0.8 Hz, 1H), 7.38 (d, J = 1.0 Hz, 1H), 6.79 (d, J = 8.5 Hz, 2H), 4.01 (s, 3H), 3.78 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 4-Methoxy-6- (oxazol-2- yl)benzo[d] isoxazol-3-amine I86 FA Stirred 2 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 75/1) 145 [00263]   N-(5-Chloro-4-methoxy- LCMS-C: R.sub.t 2.27 min, m/z 442.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 10.4 (s, 1H), 7.56-7.49 (m, 2H), 6.80 (d, J = 8.5 Hz, 2H), 4.58 (s, 2H), 3.93 (s, 3H), 3.78 (s, 6H), 3.41 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 5-Chloro-4- methoxy-6- (methoxymethyl) benzo[d]isoxazol- 3-amine I83 FA 1.5 eq. LiHMDS used, stirred 2 h before adding 2 eq. sulfonyl chloride. Prep. TLC (DCM/ MeOH = 100/1) 6- (methoxymethyl)benzo [d]isoxazol-3-yl)-2,6- dimethoxybenzenesulfonamide 146 [00264]   2,6-Dimethoxy-N-(4- methoxy-6-(pyridin-2- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-C: R.sub.t 1.89 min, m/z 442.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.67 (s, 1H), 8.75-8.68 (m, 1H), 8.15 (d, J = 8.0 Hz, 1H), 7.98- 7.90 (m, 1H), 7.86 (s, 1H), 7.59 (s 1H), 7.51 (t, J = 8.5 Hz, 1H), 7.47- 7.41 (m, 1H), 6.79 (d, J = 8.6 Hz, 2H), 4.02 (s, 3H), 3.79 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 4-Methoxy-6- (pyridin-2- yl)benzo[d] isoxazol-3-amine I77 FA 4 eq. LiHMDS used and stirred 1 h before adding sulfonyl chloride. Prep. TLC (DCM/ MeOH = 50/1) 147 [00265]   2,6-Dimethoxy-N-(6- (oxazol-2- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.31 min, m/z 401.8 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.6 (s, 1H), 8.32 (s, 1H), 8.19- 8.18 (m, 1H), 8.07 (s, 1H), 7.96 (d, J = 8.4 Hz, 1H), 7.45- 7.40 (m, 2H), 6.73 (d, J = 8.4 Hz, 2H), 3.71 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 6-(Oxazol-2- yl)benzo[d] isoxazol-3-amine I90 FB Prep. TLC (Pet. ether/ EtOAc = 1/1)

Example 148: N-(benzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 148

[0541] ##STR00266##

[0542] A solution of 2,4-dimethoxybenzenesulfonyl chloride (0.18 g, 0.75 mmol) and benzo[d]isoxazol-3-amine (0.10 g, 0.75 mmol) in pyridine (1 mL) was irradiated in the microwave at 110° C. for 2 hours. The resultant mixture was loaded onto silica gel and the product purified twice by column chromatography (4 g SiO.sub.2 cartridge, 0-45% EtOAc in petroleum benzine 40-60° C. then 4 g SiO.sub.2 cartridge, 0-35% EtOAc in petroleum benzine 40-60° C.) to yield two batches (78 mg and 5 mg) of the title compound (total mass 83 mg, 33% yield) as white solids. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.11 (d, J=8.05 Hz, 1H), 7.79 (s, 1H), 7.70 (d, J=8.81 Hz, 1H), 7.57-7.50 (m, 1H), 7.47-7.40 (m, 1H), 7.37-7.29 (m, 1H), 6.50 (d, J=2.27 Hz, 1H), 6.42 (dd, J=2.25, 8.81 Hz, 1H), 3.98 (s, 3H), 3.81 (s, 3H). LCMS-B: rt 3.20 min, m/z=356.8 [M+Na].sup.+, 334.8 [M+H].sup.+.

Example 149: N-(benzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 149

[0543] ##STR00267##

[0544] A solution of 2,6-dimethoxybenzene-1-sulfonyl chloride I111 (0.088 g, 0.37 mmol) and benzo[d]isoxazol-3-amine (0.050 g, 0.37 mmol) in pyridine (1 mL) was irradiated in the microwave at 110° C. for 2 hours, then at 120° C. for 2 hours. The reaction mixture was loaded onto silica and purified by column chromatography (12 g SiO.sub.2 cartridge, 0-35% EtOAc in petroleum benzine 40-60° C.) to give the title compound (3.9 mg, 3.1% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.30 (s, 1H), 8.17 (dt, J=1.04, 8.15 Hz, 1H), 7.55-7.47 (m, 1H), 7.47-7.34 (m, 2H), 7.34-7.28 (m, 1H), 6.60 (d, J=8.52 Hz, 2H), 3.91 (s, 6H). LCMS-B: rt 3.13 min, m/z=334.8 [M+H].sup.+.

Example 150: N-(5-chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 150

[0545] ##STR00268##

a) 5-Chlorobenzo[d]isoxazol-3-amine A1

[0546] Potassium tert-butoxide (793 mg, 7.07 mmol) was added to a suspension of acetohydroxamic acid (531 mg, 7.07 mmol) in DMF (10 mL) and stirred at room temperature for 30 minutes. 5-Chloro-2-fluorobenzonitrile (1.00 g, 6.43 mmol) was added and the reaction heated to 50° C. for 1 hour. Upon cooling, the reaction mixture was diluted with an aqueous saturated solution of NaCl (15 mL), the aqueous layer was extracted with EtOAc (3×100 mL), the organics were combined, dried (Na.sub.2SO.sub.4), filtered and the volatiles were removed in vacuo. The residue was loaded onto silica gel and the product purified by column chromatography (Biotage Isolera, 40 g SiO.sub.2 cartridge, 0-40% EtOAc in petroleum benzine 40-60° C.) to yield the title compound as a white solid (507 mg, 47%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=7.94 (dd, J=2.1, 0.6, 1H), 7.59-7.48 (m, 1H), 6.51 (s, 1H).

b) N-(5-chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 150

[0547] A suspension of 5-ethyl-2-methoxybenzene-1-sulfonyl chloride (150 mg, 0.639 mmol) and 5-chlorobenzo[d]isoxazol-3-amine A1 (108 mg, 0.639 mmol) in pyridine (1.5 mL) was irradiated in the microwave at 110° C. for 2 hours. A 10 M aqueous solution of KOH (1 mL) was added and the resultant mixture was stirred for 4 hours at room temperature. The reaction mixture was loaded onto silica gel and the product purified by column chromatography (0-100% EtOAc in petroleum benzine 40-60° C.) to yield the title compound as a white solid (53 mg, 23%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=8.11 (t, J=1.4, 1H), 7.71 (d, J=2.3, 1H), 7.68 (d, J=1.4, 2H), 7.48 (dd, J=8.5, 2.3, 1H), 7.10 (d, J=8.6, 1H), 3.72 (s, 3H), 2.62 (q, J=7.6, 2H), 1.16 (t, J=7.6, 3H). LCMS-A: rt 6.637 min; m/z 367.0 [M+H].sup.+.

Example 151: N-(4-chlorobenzo[d]isoxazol-3-yl)benzenesulfonamide 151

[0548] ##STR00269##

a) N-(4-chlorobenzo[d]isoxazol-3-yl)-N-(phenylsulfonyl)benzenesulfonamide A2

[0549] A solution of 4-chlorobenzo[d]isoxazol-3-amine (50 mg, 0.298 mmol) and benzenesulfonyl chloride (2 eq., 0.595 mmol) in pyridine (1.5 mL) was irradiated in the microwave for 2 hours at 100° C. Upon cooling, the reaction mixture was loaded onto silica gel and purified using silica gel column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the title compound. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=7.97 (d, J=8.6, 1H), 7.90-7.77 (m, 6H), 7.71-7.64 (m, 7H), 7.57 (d, J=7.7, 1H).

b) N-(4-chlorobenzo[d]isoxazol-3-yl)benzenesulfonamide 151

[0550] A suspension of N-(4-chlorobenzo[d]isoxazol-3-yl)-N-(phenylsulfonyl)benzenesulfonamide A2 (50 mg, 0.11 mmol) in THF (10 mL) and 10M KOH aqueous solution (1 mL) was stirred at room temperature for 16 hours. The reaction mixture was diluted with water (25 mL) and the aqueous layer extracted with EtOAc (3×50 mL), the combined organics were washed with brine (25 mL) dried (Na.sub.2SO.sub.4), filtered and concentrated under reduced pressure. The resulting gum was dissolved in a minimum amount of acetone before petroleum benzine 40-60° C. (50 mL) was added and the precipitate was filtered and air dried to give the title compound as a tan solid (10 mg, 29%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=7.89-7.80 (m, 2H), 7.41-7.30 (m, 4H), 7.26 (dd, J=8.3, 0.8, 1H), 7.10 (dd, J=7.5, 0.8, 1H). LCMS-A: rt 6.334 min, m/z 307.0 [M−H].sup.−.

Example 152: 5-Ethyl-N-(7-fluorobenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 152

[0551] ##STR00270##

a) 7-Fluorobenzo[d]isoxazol-3-amine A3

[0552] Potassium tert-butoxide (887 mg, 7.91 mmol) was added to a suspension of acetohydroxamic acid (594 mg, 7.91 mmol) in DMF (10 mL) and the reaction was stirred at room temperature for 30 minutes. 2,3-Difluorobenzonitrile (1.00 g, 7.19 mmol) was added and the reaction was heated to 50° C. for 1 hour. Upon cooling, the reaction mixture was diluted with an aqueous saturated solution of NaCl (15 mL), the aqueous layer was extracted with EtOAc (3×100 mL) the organics were combined, dried (Na.sub.2SO.sub.4) and filtered and the volatiles were removed in vacuo. The resulting gum was loaded onto silica gel and purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the title compound as a white solid (303 mg, 27%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ=7.33 (dd, J=7.6, 1.3, 1H), 7.30-7.26 (m, 1H), 7.26-7.19 (m, 1H), 4.45 (s, 2H). LCMS-B: rt 3.371 min, m/z 153.2 [M+H].sup.+.

b) 5-Ethyl-N-(7-fluorobenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 152

[0553] A solution of 7-fluorobenzo[d]isoxazol-3-amine A3 (100 mg, 0.657 mmol) and 2-methoxy-5-ethylsulfonyl chloride I112 (154 mg, 0.657 mmol) in pyridine (2 mL) was irradiated in the microwave for 2 hours at 100° C. Upon cooling, the reaction mixture was loaded onto silica gel and purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to yield the title compound as a white solid (127 mg, 55%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=7.91 (dd, J=8.1, 0.8, 1H), 7.73 (d, J=2.3, 1H), 7.57 (dd, J=11.9, 8.0, 1H), 7.48 (dd, J=8.5, 2.3, 1H), 7.38 (td, J=8.0, 4.1, 1H), 7.10 (d, J=8.6, 1H), 3.73 (s, 3H), 2.63 (q, J=7.6, 2H), 1.16 (t, J=7.6, 3H). LCMS-A: rt 6.429 min, m/z 351.1 [M+H].sup.+.

Example 153: N-(4-Chloro-5-methylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 153

[0554] ##STR00271##

a) 4-Chloro-5-methylbenzo[d]isoxazol-3-amine A4

[0555] Potassium tert-butoxide (728 mg, 6.49 mmol) was added to a suspension of acetohydroxamic acid (487 mg, 6.49 mmol) in DMF (10 mL) and stirred at room temperature for 30 minutes. 2-Chloro-6-fluoro-3-methylbenzonitrile (1.00 g, 5.90 mmol) was added and the reaction heated to 50° C. for 1 hour. Upon cooling, the reaction mixture was diluted with an aqueous saturated solution of NaCl (15 mL), the aqueous layer was extracted with EtOAc (3×100 mL), the organics were combined, dried (Na.sub.2SO.sub.4), filtered and the volatiles were removed in vacuo. The resultant solid was sonicated in acetone (10 mL) before petroleum benzine 40-60° C. (50 mL) was added, the precipitate was collected by filtration and air dried to yield the product as a white solid (524 mg, 49%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=7.51 (d, J=8.5, 1H), 7.38 (d, J=8.5, 1H), 6.15 (s, 2H), 2.38 (s, 3H). LCMS-B: rt 3.562 min, m/z 183.1 [M+H].sup.+.

b) N-(4-Chloro-5-methylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 153

[0556] A solution of 4-chloro-5-methylbenzo[d]isoxazol-3-amine A4 (100 mg, 0.548 mmol) and 2-methoxy-5-ethylsulfonyl chloride I112 (129 mg, 0.548 mmol) in pyridine (2 mL) was irradiated in the microwave for 2 hours at 100° C. Upon cooling, the reaction mixture was added to water, the precipitate was removed by filtration and the filtrate was loaded onto silica gel and purified by column chromatography (Biotage Isolera, 24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound as a white solid (33 mg, 16%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ=10.48 (s, 1H), 7.69-7.57 (m, 3H), 7.48 (dd, J=8.5, 2.3, 1H), 7.15 (d, J=8.5, 1H), 3.68 (s, 3H), 2.60 (q, J=7.5, 2H), 2.42 (s, 3H), 1.15 (t, J=7.6, 3H). LCMS-A: rt 6.665 min, m/z 381.1 [M+H].sup.+.

Example 154: N-(4-chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 154

[0557] ##STR00272##

[0558] A mixture of 5-ethyl-2-methoxybenzenesulfonyl chloride I112 (0.414 g, 1.77 mmol) and 4-chlorobenzo[d]isoxazol-3-amine (0.225 g, 1.34 mmol) in pyridine (2.0 mL) was stirred at 30° C. for 40 hours under a nitrogen atmosphere. The reaction was concentrated, then sonicated for 2 hours with aqueous HCl (5%) and the resulting precipitate collected. The precipitate was purified using silica gel column chromatography (0-100% ethyl acetate/petroleum benzine 40-60° C.) to give the title compound as two fractions (A and B) with a combined yield of 0.060 g, 12% yield.

[0559] Fraction A: Yield 0.038 g. .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.88 (br s, 1H), 7.75 (d, J=2.3 Hz, 1H), 7.66 (dd, J=8.5, 7.6 Hz, 1H), 7.57 (dd, J=8.5, 0.6 Hz, 1H), 7.49 (dd, J=8.5, 2.3 Hz, 1H), 7.42 (dd, J=7.6, 0.6 Hz, 1H), 7.14 (d, J=8.5 Hz, 1H), 3.91 (s, 3H), 2.66 (q, J=7.6 Hz, 2H), 1.21 (t, J=7.6 Hz, 3H). LCMS-B: rt 3.766 min; m/z 367.1/369.1 [M+H].sup.+.

[0560] Fraction B: Yield 0.021 g. .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.88 (br s, 1H), 7.75 (d, J=2.3 Hz, 1H), 7.65 (dd, J=8.5, 7.6 Hz, 1H), 7.59-7.55 (m, 1H), 7.49 (dd, J=8.5, 2.3 Hz, 1H), 7.44-7.40 (m, 1H), 7.14 (d, J=8.5 Hz, 1H), 3.90 (s, 3H), 2.66 (q, J=7.6 Hz, 2H), 1.21 (t, J=7.6 Hz, 3H). LCMS-B: rt 3.755 min; m/z 367.1/369.1 [M+H].sup.+

Example 155: N-(4-chlorobenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 155

[0561] ##STR00273##

[0562] A mixture of 4-chlorobenzo[d]isoxazol-3-amine (0.034 g, 0.200 mmol) and 2-methoxybenzenesulfonyl chloride (0.092 g, 0.450 mmol) in pyridine (1.0 mL) and triethylamine (0.1 mL) was stirred at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration and purified using preparative mass-directed HPLC to give the title compound. .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 7.94-7.91 (dd, J=7.8, 1.7 Hz, 1H), 7.69-7.63 (m, 2H), 7.60-7.57 (dd, J=8.5, 0.7 Hz, 1H), 7.44-7.42 (dd, J=7.6, 0.7 Hz, 1H), 7.25-7.22 (m, 1H), 7.16-7.11 (m, 1H), 3.94-3.94 (s, 3H). HPLC-MS: rt 6.02 min; m/z 339.16/341.18 [M+H].sup.+.

Example 156: N-(4-fluorobenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide

[0563] ##STR00274##

[0564] A mixture of 4-fluorobenzo[d]isoxazol-3-amine (0.032 g, 0.21 mmol) and 2-methoxybenzenesulfonyl chloride (0.109 g, 0.529 mmol) in pyridine (1.0 mL) and triethylamine (0.1 mL) was stirred at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration and purified using preparative mass-directed HPLC to give the title compound. .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 9.73-9.45 (br s, 1H), 7.92-7.88 (dd, J=7.9, 1.7 Hz, 1H), 7.70-7.61 (m, 2H), 7.44-7.40 (d, J=8.5 Hz, 1H), 7.25-7.21 (d, J=8.3 Hz, 1H), 7.13-7.07 (m, 2H), 3.95-3.91 (s, 3H). HPLC-MS: rt 5.72 min; m/z 323.16 [M+H].sup.+.

Example 157: N-(6-bromobenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 157

[0565] ##STR00275##

[0566] A mixture of 6-bromobenzo[d]isoxazol-3-amine I75 (0.039 g, 0.180 mmol) and 2-methoxybenzenesulfonyl chloride (0.101 g, 0.490 mmol) in pyridine (1.0 mL) and triethylamine (0.1 mL) was stirred at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 minutes. The resulting precipitate was collected by filtration and purified using preparative mass-directed HPLC to give the title compound. .sup.1H NMR (400 MHz, acetone-d.sub.6) δ 8.06-8.02 (dd, J=8.6, 0.5 Hz, 1H), 7.90-7.87 (dd, J=7.9, 1.7 Hz, 1H), 7.85-7.83 (dd, J=1.6, 0.5 Hz, 1H), 7.64-7.59 (ddd, J=8.4, 7.4, 1.8 Hz, 1H), 7.58-7.54 (dd, J=8.6, 1.6 Hz, 1H), 7.21-7.18 (dd, J=8.4, 0.8 Hz, 1H), 7.10-7.05 (m, 1H), 3.88-3.85 (s, 3H). HPLC-MS: rt 6.32 min; m/z 383.1/385.2 [M+H].sup.+.

Example 158: N-(6-chlorobenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 158

[0567] ##STR00276##

[0568] A mixture of 6-chlorobenzo[d]isoxazol-3-amine (0.033 g, 0.200 mmol) and 2-methoxybenzenesulfonyl chloride (0.095 g, 0.460 mmol) were stirred in pyridine (1.0 mL) and triethylamine (0.1 mL) at room temperature for 16 hours. The reaction was concentrated and diluted with 5% aqueous HCl (1 mL) and sonicated for a minimum of 30 min. The resulting precipitate was collected by filtration and purified using mass directed preparative HPLC to give the title compound. .sup.1H NMR (400 MHz, acetone-d.sub.6) δ8.12-8.07 (dd, J=8.6, 0.5 Hz, 1H), 7.91-7.87 (dd, J=7.9, 1.7 Hz, 1H), 7.68-7.65 (dd, J=1.7, 0.5 Hz, 1H), 7.64-7.58 (ddd, J=8.4, 7.4, 1.8 Hz, 1H), 7.44-7.39 (dd, J=8.6, 1.7 Hz, 1H), 7.21-7.17 (m, 1H), 7.10-7.05 (m, 1H), 3.88-3.86 (s, 3H). HPLC-MS: rt 6.26 min; m/z 339.16/341.18 [M+H].sup.+.

Example 159: N-(4-chlorobenzo[d]isoxazol-3-yl)isoquinoline-8-sulfonamide 159

[0569] ##STR00277##

[0570] A solution of 4-chlorobenzo[d]isoxazol-3-amine (0.050 g, 0.30 mmol) in anhydrous THF (2 mL) was cooled to −78° C. under a nitrogen atmosphere. A solution of lithium bis(trimethylsilyl)amide (1.0 M in THF, 0.59 mL, 0.59 mmol) was cautiously added before the mixture was stirred at 0° C. for 1 hour. The mixture was cooled to −78° C., a solution of 8-isoquinolinesulfonyl chloride (0.068 g, 0.30 mmol) in anhydrous THF (1 mL) was added and the mixture was allowed to warm to room temperature. After stirring for 3 hours, TLC indicated only the presence of starting material. The mixture was cooled to −78° C., sodium hydride (60% dispersion in mineral oil, 0.059 g, 1.5 mmol) was added and the mixture was returned to room temperature and stirred overnight. Water (10 mL) was added and the pH was adjusted to ˜3 with aq. HCl (2 M). The aqueous phase was extracted with DCM (3×20 mL), the organics were combined, dried (MgSO.sub.4) and the solvent removed in vacuo. The solid residue was purified by column chromatography (Biotage Isolera, 12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C., then 0-40% MeOH in EtOAc) to give the title compound as a white solid (0.026 g, 24%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.31 (s, 1H), 8.53 (d, J=5.8 Hz, 1H), 8.28-8.21 (m, 1H), 8.09 (d, J=8.2 Hz, 1H), 7.92 (d, J=5.7 Hz, 1H), 7.89-7.82 (m, 1H), 7.39 (t, J=7.9 Hz, 1H), 7.31 (d, J=8.3 Hz, 1H), 7.17 (d, J=7.5 Hz, 1H). LCMS-A: rt 5.43 min; m/z 360.1 [M+H].sup.+.

Example 160: N-(7-iodo-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 160

[0571] ##STR00278##

a) 7-iodo-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine A5

[0572] A portion of 4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (0.121 g, 0.581 mmol) was dissolved in N,N-dimethylformamide (2 mL) and then N-iodosuccinimide (0.131 g, 0.581 mmol) was added. Upon completion of addition, the reaction mixture was heated at 50° C. for 2 h. At the conclusion of this period, the reaction mixture was poured over ice and then diluted with EtOAc (15 mL). The resulting mixture was washed with H.sub.2O (3×8 mL) and brine (8 mL), dried over Na.sub.2SO.sub.4 and filtered. The volatiles were removed under reduced pressure and the residue purified twice by column chromatography (12 g SiO.sub.2 cartridge, 0-35% EtOAc in petroleum benzine 40-60° C. then 12 g SiO.sub.2 cartridge, 0-25% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.038 g, 20% yield) as an off-while solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 6.78 (s, 1H), 4.73 (s, 2H), 4.54 (s, 2H), 3.96 (s, 3H), 3.50 (s, 3H). LCMS-A: rt 3.26 min. m/z 334.7 [M+H].sup.+.

b) N-(7-iodo-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 160

[0573] A solution of 7-iodo-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine A5 (0.024 g, 0.099 mmol) and 2,6-dimethoxybenzenesulfonyl chloride I111 (0.023 g, 0.099 mmol) in pyridine (0.5 mL) was irradiated in the microwave at 110° C. for 2 h. The reaction mixture was cooled to room temperature and wet-loaded onto a silica cartridge. The residue was purified by column chromatography (12 g SiO.sub.2 cartridge, 0-70% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.032 g, 53% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.38 (t, J=8.5 Hz, 1H), 6.86 (s, 1H), 6.58 (d, J=8.5 Hz, 2H), 4.52 (s, 2H), 4.04 (s, 3H), 3.88 (s, 6H), 3.51 (s, 3H). LCMS-A: rt 5.86 min, m/z 534.6 [M+H].sup.+.

Example 161: N-(7-chloro-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 161

[0574] ##STR00279##

a) 7-Chloro-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine A6

[0575] 4-Methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (0.150 g, 0.720 mmol) was dissolved in N,N-dimethylformamide (2 mL) and then N-chlorosuccinimide (96 mg, 0.72 mmol) was added. Upon completion of addition, the reaction mixture was heated at 50° C. for 2 hours. At the conclusion of this period, the reaction mixture was poured over ice and then diluted with EtOAc (15 mL). The resulting mixture was washed with H.sub.2O (3×8 mL) and brine (8 mL), dried over Na.sub.2SO.sub.4 and filtered. The volatiles were removed under reduced pressure and the residue purified by column chromatography (12 g SiO.sub.2 cartridge, 0-40% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.0240 g, 14% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 6.77 (s, 1H), 4.63 (d, J=0.6 Hz, 2H), 3.97 (s, 3H), 3.49 (s, 3H).

b) N-(7-chloro-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)-2,6-dimethoxybenzene-sulfonamide 161

[0576] A solution of 7-chloro-4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine A6 (0.024 g, 0.099 mmol) and 2,6-dimethoxybenzenesulfonyl chloride I111 (0.023 g, 0.099 mmol) in pyridine (0.5 mL) was irradiated in the microwave at 110° C. for 2 hours. The reaction mixture was cooled to room temperature and wet-loaded onto a silica cartridge. The residue was purified by column chromatography (12 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.0094 g, 21% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.20 (s, 1H), 7.39 (t, J=8.5 Hz, 1H), 6.85 (s, 1H), 6.59 (d, J=8.5 Hz, 2H), 4.61 (d, J=0.6 Hz, 2H), 4.04 (s, 3H), 3.88 (s, 6H), 3.49 (s, 3H). LCMS-F: rt 6.39 min, m/z 442.8 [M+H].sup.+.

Example 162: 5-methoxy-N-(4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)quinoline-8-sulfonamide 162

[0577] ##STR00280##

[0578] A solution of 4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (0.0500 g, 0.240 mmol) and 5-methoxyquinoline-8-sulfonyl chloride (0.0619 g, 0.240 mmol) in pyridine (0.500 mL) was irradiated in the microwave at 110° C. for 2 hours. The reaction was cooled to room temperature and added to DCM (10 mL). The organic layer was washed with 0.5 M HCl (10 mL) and the layers separated by phase separation cartridge. The collected organic layers was dried in vacuo and the residue purified by column chromatography (12 g SiO.sub.2 cartridge, 0-80% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.0110 g, 11% yield) as an off-white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.98 (dd, J=4.3, 1.8 Hz, 1H), 8.64-8.53 (m, 2H), 7.45 (dd, J=8.5, 4.3 Hz, 1H), 6.91 (d, J=8.4 Hz, 1H), 6.87 (d, J=0.9 Hz, 1H), 6.54 (s, 1H), 4.44 (s, 2H), 4.05 (s, 3H), 4.03 (s, 3H), 3.36 (s, 3H). LCMS-B: rt 3.49 min, m/z=429.8 [M+H].sup.+.

Example 163: 2-hydroxy-6-methoxy-N-(4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 163

[0579] ##STR00281##

[0580] A solution of 4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (0.0440 g, 0.211 mmol) and 2,6-dimethoxybenzenesulfonyl chloride I111 (0.0500 g, 0.211 mmol) in pyridine (0.500 mL) was irradiated in the microwave at 120° C. for 2 hours then at 120° C. for 1 hour. The reaction was cooled to room temperature and added to DCM (10 mL). The organics were washed with 1M HCl (2×10 mL) then dried over MgSO.sub.4. The crude material was purified twice by silica gel chromatography (24 g SiO.sub.2 cartridge, 0-85% EtOAc in petroleum benzine 40-60° C. then 12 g SiO.sub.2 cartridge, 0-75% EtOAc in petroleum benzine 40-60° C.) to give the title compound (1.5 mg). .sup.1H NMR (400 MHz, CDCl.sub.3) δ 9.62 (s, 1H), 8.14 (s, 1H), 7.33 (t, J=8.4 Hz, 1H), 6.99 (q, J=0.9 Hz, 1H), 6.70-6.61 (m, 2H), 6.37 (dd, J=8.3, 1.0 Hz, 1H), 4.51 (s, 1H), 4.03 (s, 3H), 3.87 (s, 3H), 3.42 (s, 3H). LCMS-A: rt 3.54 min, m/z 394.8 [M+H].sup.30

Example 164: 6-methoxy-N-(6-(methoxymethyl)-5-methylbenzo[d]isoxazol-3-yl)pyridine-3-sulfonamide 164

[0581] ##STR00282##

[0582] A solution of 6-methoxypyridine-3-sulfonyl chloride (0.0540 g, 0.260 mmol) and 6-(methoxymethyl)-5-methylbenzo[d]isoxazol-3-amine I4 (0.050 g, 0.26 mmol) in pyridine (0.500 mL) was irradiated in the microwave at 120° C. for 2 hours. The reaction was cooled to room temperature then taken up in DCM and washed (×2) with 1M HCl. The organic layer was dried in vacuo then wet-loaded onto silica gel and the product purified by column chromatography (24 g SiO.sub.2 cartridge, 0-80% EtOAc in petroleum benzine 40-60° C.) to give the title compound (15.6 mg, 17% yield) as a colourless oil. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.63 (dd, J=0.71, 2.62 Hz, 1H), 7.99-7.89 (m, 2H), 7.72 (s, 1H), 7.55 (s, 1H), 6.75 (dd, J=0.71, 8.94 Hz, 1H), 4.54 (s, 2H), 3.95 (s, 3H), 3.50 (s, 3H), 2.39 (s, 3H). LCMS-F: rt 6.39 min, m/z 348.1 [M+H].sup.+.

Example 165: N-(6-(methoxymethyl)-5-methylbenzo[d]isoxazol-3-yl)pyridine-3-sulfonamide 165

[0583] ##STR00283##

[0584] A solution of pyridine-3-sulfonyl chloride (0.0462 g, 0.260 mmol) and 6-(methoxymethyl)-5-methylbenzo[d]isoxazol-3-amine I4 (0.050 g, 0.26 mmol) in pyridine (0.500 mL) was irradiated in the microwave at 120° C. for 2 hours. The reaction was cooled to room temperature then wet-loaded onto silica gel and the product purified by column chromatography (24 g SiO.sub.2 cartridge, 0-80% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.0220 g, 25% yield) as a yellow solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 9.09 (s, 1H), 8.83 (s, 1H), 8.18 (d, J=8.09 Hz, 1H), 7.70 (s, 1H), 7.57 (s, 1H), 7.46 (s, 1H), 4.54 (s, 2H), 3.50 (s, 3H), 2.40 (s, 3H). LCMS-F: rt 6.12 min m/z 334.1 [M+H].sup.+, 332.0 [M−H].sup.−.

Example 166: 2,4-dimethoxy-N-(6-(methoxymethyl)-5-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 166

[0585] ##STR00284##

[0586] A solution of 2,4-dimethoxybenzenesulfonyl chloride (0.052 g, 0.22 mmol) and 6-(methoxymethyl)-5-methylbenzo[d]isoxazol-3-amine I4 (0.042 g, 0.22 mmol) in pyridine (0.500 mL) was irradiated in the microwave at 110° C. for 2 hours. The resulting mixture was loaded onto silica gel and the product purified by column chromatography (4 g SiO.sub.2 cartridge, 0-45% EtOAc in petroleum benzine 40-60° C.) to yield the title compound (0.0413 g, 48% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.96 (s, 1H), 7.83 (s, 1H), 7.71 (d, J=8.33 Hz, 1H), 7.47 (s, 1H), 6.48 (d, J=1.82 Hz, 1H), 6.42 (d, J=8.36 Hz, 1H), 4.50 (s, 2H), 3.95 (s, 3H), 3.80 (s, 3H), 3.47 (s, 3H), 2.37 (s, 3H). LCMS-A: rt 5.78 min. m/z=392.8 [M+H].sup.+, 414.7 [M+Na].sup.+.

Example 167: N-(6-(hydroxymethyl)benzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 167

[0587] ##STR00285##

a) Methyl 3-aminobenzo[d]isoxazole-6-carboxylate A9

[0588] To a solution of ethanehydroxamic acid (0.629 g, 8.37 mmol) in DMF (5 mL) was added potassium 2-methylpropan-2-olate (0.94 g, 8.4 mmol) and the reaction was stirred for 30 minutes. Methyl 4-cyano-3-fluorobenzoate (1.0 g, 5.6 mmol) was added followed by DMF (2 mL) and the reaction was stirred for a further 2 hours at room temperature. The reaction was diluted with ethyl acetate (50 mL) and water (50 mL), the aqueous layer was extracted with ethyl acetate and the combined organic layers were washed with water, dried, filtered and concentrated. The crude material was purified by silica gel chromatography (12 g SiO.sub.2 cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.55 g, 51% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.12 (d, J=1.02 Hz, 1H), 7.96 (dd, J=1.24, 8.29 Hz, 1H), 7.59 (dd, J=0.77, 8.25 Hz, 1H), 3.98 (s, 3H). LCMS: rt 2.97 min, m/z 193.0 [M+H].sup.+.

b) Methyl 3-((2,4-dimethoxyphenyl)sulfonamido)benzo[d]isoxazole-6-carboxylate A10

[0589] A solution of 2,4-dimethoxybenzene-1-sulfonyl chloride (0.67 g, 2.8 mmol) and methyl 3-aminobenzo[d]isoxazole-6-carboxylate A9 (0.55 g, 2.8 mmol) in pyridine (4 mL) was irradiated in the microwave at 130° C. for 3 hours. The reaction was cooled to room temperature then diluted with DCM (40 mL). The organics were washed with 1M HCl (40 mL) and the aqueous layer back-extracted with DCM (2×40 mL). The combined organic layers were dried in vacuo and the residue purified twice by column chromatography (24 g SiO.sub.2 cartridge, 0-35% EtOAc in petroleum benzine 40-60° C.) to give two batches of the title compound (0.369 g, impure and 0.0310 g, 2.8% yield, >95% purity) as white solids. .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 8.13-8.06 (m, 2H), 7.97 (dd, J=1.25, 8.47 Hz, 1H), 7.86-7.80 (m, 1H), 6.58 (dq, J=2.29, 4.60 Hz, 2H), 3.95 (s, 3H), 3.83 (s, 3H), 3.79 (s, 3H). LCMS: rt 3.26 min, m/z 392.8 [M+H].sup.+, 415.8 [M+Na].sup.+.

c) N-(6-(hydroxymethyl)benzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 167

[0590] To a suspension of lithium aluminium hydride powder (0.0758 g, 2.00 mmol) in anhydrous THF (4 mL) under nitrogen was added a solution of methyl 3-((2,4-dimethoxyphenyl)sulfonamido)benzo [d]isoxazole-6-carboxylate A10 (impure, 0.392 g, 0.500 mmol) in THF (8 mL). The mixture was stirred overnight at room temperature. The reaction was quenched under nitrogen by the dropwise addition of wet THF followed by 1 mL of water. After the evolution of gas ceased, a solution of 0.5 M aqueous HCl was added and the aqueous layer extracted with ethyl acetate (3×20 mL). The combined organic layers were washed with water, brine, dried over MgSO.sub.4 and the solvent removed in vacuo. The crude residue was purified by column chromatography (24 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.191 g, 100% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl) δ8.08 (dd, J=0.78, 8.30 Hz, 1H), 7.77 (s, 1H), 7.69 (d, J=8.82 Hz, 1H), 7.47 (t, J=1.03 Hz, 1H), 7.30 (dd, J=1.34, 8.29 Hz, 1H), 6.49 (d, J=2.26 Hz, 1H), 6.42 (dd, J=2.30, 8.79 Hz, 1H), 4.84 (s, 2H), 3.98 (s, 3H), 3.80 (s, 3H). LCMS-B: rt 3.02 min. m/z 364.8 [M+H].sup.+, 386.8 [M+Na].sup.+.

Example 168: 3-((5-methoxyquinoline)-8-sulfonamido)-5-methylbenzo[d]isoxazole-6-carboxamide I68

[0591] ##STR00286##

a) Methyl 3-amino-5-methylbenzo[d]isoxazole-6-carboxylate A11

[0592] To a solution of ethanehydroxamic acid (0.126 g, 1.69 mmol) in DMF (2 mL) was added potassium 2-methylpropan-2-olate (0.19 g, 1.7 mmol) and the reaction was stirred for 30 minutes. Methyl 4-cyano-5-fluoro-2-methylbenzoate (0.22 g, 1.1 mmol) was added followed by DMF (3 mL) and the reaction was stirred for a further 2 hours at 40° C. The reaction was diluted with ethyl acetate (50 mL) and water (50 mL). The aqueous layer was extracted with ethyl acetate and the combined organic layers were washed with water, dried, filtered and concentrated. The crude material was purified by silica gel chromatography (12 g SiO.sub.2 cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.11 g, 48% yield) as a white solid. .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 7.85 (s, 1H), 7.64 (t, J=0.79 Hz, 1H), 3.92 (s, 3H), 2.62 (d, J=0.85 Hz, 3H). LCMS: rt 3.02 min, m/z 207.0 [M+H].sup.+.

b) Methyl 3-((5-methoxyquinoline)-8-sulfonamido)-5-methylbenzo[d]isoxazole-6-carboxylate hydrochloride salt A12

[0593] A solution of 5-methoxyquinoline-8-sulfonyl chloride (0.12 g, 0.48 mmol) and methyl 3-amino-5-methylbenzo[d]isoxazole-6-carboxylate A11 (0.10 g, 0.48 mmol) in pyridine (3 mL) was irradiated in the microwave at 110° C. for 2 hours. The reaction was irradiated in the microwave at 110° C. for a further 1.5 hours. The resultant mixture was loaded onto silica gel and the product purified by column chromatography (4 g SiO.sub.2 cartridge, 0-45% EtOAc in petroleum benzine 40-60° C.). The product was purified further by solid phase extraction (1 g, Si-amine, 3 void volumes of MeOH followed by 4 void volumes of methanolic HCl). The acidic elutes were collected and dried in vacuo to give the title compound (17.7 mg, 7.9% yield) as a pale yellow solid. .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 9.40-9.33 (m, 2H), 8.77 (d, J=8.66 Hz, 1H), 8.14-8.05 (m, 1H), 7.91 (s, 1H), 7.80-7.73 (m, 1H), 7.47 (d, J=8.73 Hz, 1H), 4.23 (s, 3H), 3.91 (s, 3H), 2.62 (s, 3H). LCMS: rt 3.35 min, m/z 427.8 [M+H].sup.+.

c) 3-((5-Methoxyquinoline)-8-sulfonamido)-5-methylbenzo[d]isoxazole-6-carboxamide 168

[0594] To a 15 mL heavy walled pressure tube equipped with magnetic stir bar under nitrogen was added methyl 3-((5-methoxyquinoline)-8-sulfonamido)-5-methylbenzo[d]isoxazole-6-carboxylate hydrochloride salt A12 (15.0 mg, 0.0323 mmol), ammonia solution (2.0 M in methanol, 0.50 mL, 1.0 mmol) and calcium dichloride (3.59 mg, 0.0323 mmol). The reaction vessel was sealed and heated at 80° C. for 3 days. The solvent was removed under a stream of air and ammonia solution (7.0 M in methanol, 0.50 mL, 3.5 mmol) and calcium dichloride (3.6 mg, 0.032 mmol) were added. The reaction vessel was sealed and heated at 80° C. for 24 hours. The reaction was cooled to room temperature and the solvent removed in vacuo. The compound was purified by column chromatography (4 g SiO.sub.2 cartridge, 0-100% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.00180 g, 13% yield) as a white solid. .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 9.01 (dd, J=1.78, 4.24 Hz, 1H), 8.65 (dd, J=1.78, 8.52 Hz, 1H), 8.43 (d, J=8.47 Hz, 1H), 7.73 (d, J=12.46 Hz, 2H), 7.57 (dd, J=4.28, 8.54 Hz, 1H), 7.08 (d, J=8.50 Hz, 1H), 4.09 (s, 3H), 2.57 (s, 3H). LCMS-B: rt 3.15 min, m/z 413.8 [M+H].sup.+.

Example 169: N-(6-cyano-5-methylbenzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 169

[0595] ##STR00287##

a) 3-Amino-5-methylbenzo[d]isoxazole-6-carbonitrile A13

[0596] To a solution of ethanehydroxamic acid (0.176 g, 2.34 mmol) in DMF (5 mL) was added potassium 2-methylpropan-2-olate (0.26 g, 2.3 mmol) and the reaction was stirred for 30 minutes. 2-Fluoro-5-methyl-terephthalonitrile (0.25 g, 1.6 mmol) was added followed by DMF (3 mL) and the reaction was stirred overnight at room temperature. The reaction was diluted with ethyl acetate (50 mL) and water (50 mL), the aqueous layer was extracted with ethyl acetate and the combined organic layers were washed with water, dried, filtered and concentrated. The crude material was purified by silica gel chromatography (12 g SiO.sub.2 cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.16 g, 59% yield) as an off-white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.72 (s, 1H), 7.47 (t, J=0.86 Hz, 1H), 2.65 (d, J=0.86 Hz, 3H). LCMS-B: rt 2.90 min, m/z 174.0 [M+H].sup.+.

b) N-(6-cyano-5-methylbenzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 169

[0597] A solution of 2,4-dimethoxybenzene-1-sulfonyl chloride (0.22 g, 0.92 mmol) and 3-amino-5-methyl-1,2-benzoxazole-6-carbonitrile A13 (0.16 g, 0.92 mmol) in pyridine (2.5 mL) was irradiated in the microwave at 130° C. for 2 hours. The reaction sat at room temperature for 50 minutes, then irradiated in the microwave at 130° C. for a further 2 hours. The reaction was cooled to room temperature then diluted with DCM (40 mL). The organics were washed with 1M HCl (40 mL) and the aqueous layer back extracted twice with DCM (2×40 mL). The combined organic layers were dried in vacuo and the residue loaded onto silica gel and the product purified by column chromatography (24 g SiO.sub.2 cartridge, 0-45% EtOAc in petroleum benzine 40-60° C.) to give a yellow solid. The solid was dissolved in warm MeOH and DCM and purified by solid phase extraction (1 g Si-amine, 3 void volumes of MeOH followed by 3 void volumes of ˜1.25 M methanolic ammonia). The acidic elute was dried in vacuo to give a white solid. The solid was taken up in MeOH and the MeOH removed in vacuo (repeated×3). The residue was repurified by column chromatography (24 g SiO.sub.2 cartridge, 45% EtOAc in petroleum benzine 40-60° C.) to give two batches of the title compound (22 and 78 mg, total mass 100 mg, 29% yield) as off white solids. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 8.09 (s, 1H), 7.82 (s, 1H), 7.72 (s, 1H), 7.66 (d, J=8.80 Hz, 1H), 6.52 (d, J=2.25 Hz, 1H), 6.44 (dd, J=2.24, 8.85 Hz, 1H), 3.98 (s, 3H), 3.82 (s, 3H), 2.67 (s, 3H). LCMS-B: rt 3.30 min, m/z=373.8 [M+H].sup.+, 371.9 [M−H].sup.−.

Example 170: 2,4-dimethoxy-N-(5-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 170

[0598] ##STR00288##

[0599] A solution of 2,4-dimethoxybenzene-1-sulfonyl chloride (0.0799 g, 0.337 mmol) and 5-methylbenzo[d]isoxazol-3-amine I60 (0.050 g, 0.34 mmol) in pyridine (1 mL) was irradiated in the microwave at 110° C. for 2 hours. The resultant mixture was loaded onto silica gel and the product purified by column chromatography (12 g SiO.sub.2 cartridge, 0-45% EtOAc in petroleum benzine 40-60° C.) to yield the title compound (55.0 mg, 42% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.86-7.82 (m, 1H), 7.72 (d, J=8.81 Hz, 1H), 7.37-7.28 (m, 2H), 6.49 (d, J=2.26 Hz, 1H), 6.43 (dd, J=2.29, 8.82 Hz, 1H), 3.96 (s, 3H), 3.80 (s, 3H), 2.47 (s, 3H). LCMS-A: rt 5.66 min, m/z 348.8 [M+H].sup.+, 347.1 [M−H].sup.−.

Example 171: N-(6-bromo-5-methylbenzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 171

[0600] ##STR00289##

a) 6-Bromo-5-methylbenzo[d]isoxazol-3-amine A14

[0601] To a solution of ethanehydroxamic acid (0.263 g, 3.50 mmol) in N,N-dimethylformamide (5 mL) was added t-BuOK (393 mg, 3.50 mmol) and the reaction was stirred for 30 minutes. 4-Bromo-2-fluoro-5-methylbenzonitrile (0.50 g, 2.3 mmol) was added to the reaction which was stirred for a further 2 hours at room temperature. The reaction was diluted with ethyl acetate (50 mL) and water (50 mL), the aqueous layer was extracted with ethyl acetate and the combined organic layers were washed with water, dried, filtered and concentrated. The crude material was purified by silica gel chromatography (12 g SiO.sub.2 cartridge, 0-50% EtOAc in petroleum benzine 40-60° C.) to give the title compound (0.30 g, 56% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.68 (s, 1H), 7.37 (s, 1H), 4.35 (br s, 2H), 2.49 (s, 3H). LCMS-B: rt 3.18 min. m/z 229.8 [M+H].sup.+.

b) N-(6-bromo-5-methylbenzo[d]isoxazol-3-yl)-2,4-dimethoxybenzenesulfonamide 171

[0602] A solution of 2,4-dimethoxybenzenesulfonyl chloride (0.052 g, 0.22 mmol) and 6-bromo-5-methylbenzo[d]isoxazol-3-amine A14 (0.050 g, 0.22 mmol) in pyridine (1 mL) was irradiated twice in the microwave at 110° C. for 2 hours, then at 130° C. for 2 hours. The resultant mixture was loaded onto silica gel and the product purified by column chromatography (4 g SiO.sub.2 cartridge, 0-45% EtOAc in petroleum benzine 40-60° C.) to give the title compound (102 mg, quantitative yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3) δ 7.98-7.94 (m, 1H), 7.70-7.65 (m, 2H), 6.50 (d, J=2.24 Hz, 1H), 6.43 (dd, J=2.26, 8.82 Hz, 1H), 3.97 (s, 3H), 3.81 (s, 3H), 2.51 (d, J=0.87 Hz, 4H). LCMS-A: rt 6.08 min, m/z 426.9 [M+H].sup.+.

Example 172: N-(6-(Ethoxymethyl)-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 172

[0603] ##STR00290##

[0604] To a solution of 6-(ethoxymethyl)-4-methoxybenzo[d]isoxazol-3-amine I21 (250 mg, 1.13 mmol) in anhydrous THF (25 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 4.5 mL, 4.5 mmol) dropwise and the mixture was stirred at −78° C. for 2 h. A solution of 2,6-dimethoxybenzenesulfonyl chloride I111 (400 mg, 1.69 mmol) in anhydrous THF (2 mL) was then added dropwise and the mixture was allowed to warm to RT and stirred overnight. The mixture was acidified to pH 4-5 with 2 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=100/1) to give the title compound (170 mg, 96% purity) as a white solid. Further purification by prep. HPLC gave the title compound (60 mg, 100% purity, 13% yield). LCMS-C: Rt 2.08 min; m/z 423.0 [M+H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.53 (s, 1H), 7.51 (t, J=8.4 Hz, 1H), 7.09 (s, 1H), 6.78-6.76 (m, 3H), 4.55 (s, 2H), 3.91 (s, 3H), 3.77 (s, 6H), 3.54 (q, J=6.8 Hz, 2H), 1.19 (t, J=6.8 Hz, 3H).

Example 173: 2,6-Dimethoxy-N-(4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 173

[0605] ##STR00291##

[0606] To a solution of 4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (3.0 g, 14.4 mmol) in anhydrous THF (200 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 43.2 mL, 43.2 mmol) dropwise and the mixture was stirred at −78° C. for 2 h. A solution of 2,6-dimethoxybenzenesulfonyl chloride I111 (5.1 g, 21.6 mmol) in anhydrous THF (10 mL) was then added dropwise and the mixture was allowed to warm to RT and stirred overnight. The mixture was acidified to pH 4-5 with 2 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The reaction was repeated using 4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-amine I9 (2.0 g, 9.6 mmol) in 150 mL of THF and the two batches were combined and purified by column chromatography (Pet. ether/EtOAc=8/1 to 2/1) to give the title compound (4.1 g, 42%) as a white solid. LCMS-C: R.sub.t 1.96 min; m/z 409.0 [M+H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.58 (s, 1H), 7.52 (t, J=8.4 Hz, 1H), 7.09 (s, 1H), 6.78 (d, J=8.4 Hz, 2H), 6.76 (s, 1H), 4.51 (s, 2H), 3.91 (s, 3H), 3.77 (s, 6H), 3.33 (s, 3H).

Example 174: 2,6-Dimethoxy-N-(4-methoxy-6-phenylbenzo[d]isoxazol-3-yl)benzenesulfonamide 174

[0607] ##STR00292##

[0608] To a solution of 4-methoxy-6-phenylbenzo[d]isoxazol-3-amine I17 (2.5 g, 10.4 mmol) in anhydrous THF (60 mL) at −78° C. under N.sub.2 was added LiHMDS (1 M solution in THF, 31.0 mL, 31.0 mmol) dropwise and the mixture was stirred at −78° C. for 2 h. A solution of 2,6-dimethoxybenzenesulfonyl chloride I111 (3.7 g, 15.6 mmol) in anhydrous THF (20 mL) was then added dropwise and the mixture was allowed to warm to 0° C. and stirred overnight. Water was added and the mixture was washed with EtOAc (50 mL×2). The aqueous layer was acidified to pH 3 with 1 M aqueous HCl and extracted with EtOAc (50 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=300/1) and further purified by column chromatography (DCM/MeOH=200/1) to give the title compound (1.5 g, 33%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.61 (s, 1H), 7.80 (d, J=7.2 Hz, 2H), 7.50-7.44 (m, 5H), 7.09 (s, 1H), 6.80 (d, J=8.8 Hz, 2H), 4.02 (s, 3H), 3.79 (s, 6H); LCMS-C: R.sub.t 2.46 min; m/z 441.0 [M+H].sup.+.

Example 175: 3-Chloro-2,6-dimethoxy-N-(4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 175

[0609] ##STR00293##

[0610] To a solution of 2,6-dimethoxy-N-(4-methoxy-6-(methoxymethyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 173 (50 mg, 0.123 mmol) in DMF (10 mL) was added NCS (14 mg, 0.123 mmol) and the mixture was heated at 50° C. for 2 h. The mixture was then diluted with EtOAc (150 mL) and washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep-TLC (DCM/MeOH=120/1) to give the title compound (15 mg, 27%) as a white solid. LCMS-C: R.sub.t 2.21 min; m/z 441.0 [M+H].sup.+. .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 7.56 (d, J=9.1 Hz, 1H), 7.01 (s, 1H), 6.91 (d, J=9.1 Hz, 1H), 6.76 (s, 1H), 4.55 (s, 2H), 3.99 (s, 6H), 3.76 (s, 3H), 3.41 (s, 3H).

Example 176: 2,6-Dimethoxy-N-(4-methoxy-6-(2-methoxyphenyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 176

[0611] ##STR00294##

[0612] A mixture of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (30 mg, 0.068 mmol), (2-methoxyphenyl)boronic acid (21 mg, 0.135 mmol), Pd(PPh.sub.3).sub.4 (9 mg, 0.007 mmol) and Na.sub.2CO.sub.3 (22 mg, 0.203 mmol) in 1,4-dioxane (4 mL) and water (1 mL) was heated at 100° C. under N.sub.2 overnight. The mixture was diluted with water and extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (Pet. ether/EtOAc=1/2) to give the title compound (10 mg, 31%) as a white solid. LCMS-C: R.sub.t 2.36 min, m/z 471.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.60 (s, 1H), 7.51 (t, J=8.5 Hz, 1H), 7.44-7.37 (m, 2H), 7.22 (s, 1H), 7.16 (d, J=8.8 Hz, 1H), 7.05 (t, J=7.4 Hz, 1H), 6.90 (s, 1H), 6.79 (d, J=8.6 Hz, 2H), 3.94 (s, 3H), 3.81 (s, 6H), 3.79 (s, 3H).

Example 177: 2,6-Dimethoxy-N-(4-methoxy-6-(3-methoxyphenyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 177

[0613] ##STR00295##

[0614] A mixture of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.113 mmol), (3-methoxyphenyl)boronic acid (35 mg, 0.226 mmol), Pd(PPh.sub.3).sub.4 (14 mg, 0.011 mmol) and Na.sub.2CO.sub.3 (36 mg, 0.339 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was heated at 100° C. under N.sub.2 overnight. The mixture was allowed to cool to RT, adjusted to pH 4-5 then diluted with water and extracted with EtOAc. The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=50/1) to give the title compound (8 mg, 15%) as a white solid. LCMS-C: R.sub.t 2.35 min; m/z 471.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.63 (s, 1H), 7.51 (t, J=8.5 Hz, 1H), 7.46 (d, J=1.0 Hz, 1H), 7.41 (t, J=7.9 Hz, 1H), 7.37-7.29 (m, 2H), 7.07 (s, 1H), 7.03-6.98 (m, 1H), 6.79 (d, J=8.5 Hz, 2H), 4.02 (s, 3H), 3.84 (s, 3H), 3.79 (s, 6H).

Example 178: 5-Ethyl-2-methoxy-N-(7-phenylbenzo[d]isoxazol-3-yl)benzenesulfonamide 178

[0615] ##STR00296##

[0616] A suspension of N-(7-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 137 (100 mg, 0.24 mmol), phenylboronic acid (60 mg, 0.48 mmol), Pd(dppf)Cl.sub.2 (18 mg, 0.024 mmol) and K.sub.3PO.sub.4-3H.sub.2O (260 mg, 0.97 mmol) in toluene (5 mL), isopropanol (2 mL) and water (5 mL) was heated at 100° C. under N.sub.2 for 2 h. The mixture was allowed to cool to RT, diluted with EtOAc and washed with water (25 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by preparative TLC (Pet. ether/EtOAc=2/1) to give the title compound (55 mg, 55%) as a white solid. LCMS-D: R.sub.t 3.06 min; m/z 409.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.8 (s, 1H), 8.08-8.02 (m, 1H), 7.89-7.78 (m, 3H), 7.72 (d, J=2.3 Hz, 1H), 7.55-7.40 (m, 5H), 7.13-7.08 (m, 1H), 3.75 (s, 3H), 2.61 (q, J=7.5 Hz, 2H), 1.15 (t, J=7.5 Hz, 3H).

Example 179: 5-Ethyl-2-methoxy-N-(6-phenylbenzo[d]isoxazol-3-yl)benzenesulfonamide 179

[0617] ##STR00297##

[0618] A mixture of N-(6-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 138 (120 mg, 0.3 mmol), Pd(dppf)Cl.sub.2 (45 mg, 0.06 mmol), phenylboronic acid (150 mg, 1.2 mmol) and K.sub.3PO.sub.4.3H.sub.2O (399 mg, 1.5 mmol) in water (10 mL), toluene (10 mL) and isopropanol (5 mL) was heated at 85° C. under N.sub.2 for 4 h. The mixture was allowed to cool to RT, diluted with water (200 mL) and extracted with diethyl ether (200 mL×3). The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (60 mg, 50%) as a white solid. LCMS-D: R.sub.t 3.10 min; m/z 409.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 8.14-8.08 (m, 1H), 7.87 (s, 1H), 7.79-7.74 (m, 2H), 7.73-7.67 (m, 2H), 7.54-7.39 (m, 4H), 7.12-7.07 (m, 1H), 3.74 (s, 3H), 2.61 (q, J=7.5 Hz, 2H), 1.15 (t, J=7.6 Hz, 3H).

Example 180: N-(4-Chlorobenzo[d]isoxazol-3-yl)-2,3-dihydrobenzofuran-7-sulfonamide 180

[0619] ##STR00298##

[0620] To a solution of 5-bromo-N-(4-chlorobenzo[d]isoxazol-3-yl)-2,3-dihydrobenzofuran-7-sulfonamide 127 (100 mg, 0.23 mmol) in THF (10 mL) was added 10% Pd/C (20 mg) and KOAc (20 mg, 0.28 mmol) and the mixture was stirred at 40° C. under a H.sub.2 atmosphere for 2 h then at RT overnight. The mixture was filtered and the filtrate was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (22 mg 27%) as a light yellow solid. LCMS-D: R.sub.t 2.32 min; m/z 351.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.9 (s, 1H), 7.76-7.62 (m, 2H), 7.53-7.43 (m, 3H), 6.96 (t, J=7.7 Hz, 1H), 4.50 (t, J=8.8 Hz, 2H), 3.22 (t, J=8.8 Hz, 2H).

Example 181: N-(4-Chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2,3-dihydrobenzofuran-7-sulfonamide 181

[0621] ##STR00299##

a) N-(4-Chlorobenzo[d]isoxazol-3-yl)-5-vinyl-2,3-dihydrobenzofuran-7-sulfonamide A15

[0622] To a solution of 5-bromo-N-(4-chlorobenzo[d]isoxazol-3-yl)-2,3-dihydrobenzofuran-7-sulfonamide 127 (200 mg, 0.47 mmol) in 1,4-dioxane (20 mL), EtOH (10 mL) and H.sub.2O (10 mL) was added K.sub.2CO.sub.3 (206 mg, 1.86 mmol), 4,4,5,5-tetramethyl-2-vinyl-1,3,2-dioxaborolane (140 mg, 0.93 mmol) and Pd(PPh.sub.3).sub.4 (54 mg, 0.047 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere overnight. The solvents were removed under reduced pressure and the residue was partitioned between DCM (50 mL), water (45 mL) and 2 M aq. HCl (5 mL). The layers were separated and the organic layer was washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel column chromatography (Pet. ether/EtOAc=3/1) to give the title compound (120 mg 70%) as a yellow solid. LCMS-D: R.sub.t 0.40 min; m/z 377.0 [M+H].sup.+.

b) N-(4-chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2,3-dihydrobenzofuran-7-sulfonamide 181

[0623] To a solution of N-(4-chlorobenzo[d]isoxazol-3-yl)-5-vinyl-2,3-dihydrobenzofuran-7-sulfonamide A15 (120 mg, 0.32 mmol) in MeOH (15 mL) was added 10% Pd/C (24 mg) and the mixture was stirred at RT under a H.sub.2 atmosphere overnight. The mixture was filtered and the filtrate was concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (33 mg, 27%) as a white solid. LCMS-D: R.sub.t 2.59 min; m/z 379.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.8 (s, 1H), 7.75-7.70 (m, 1H), 7.69-7.63 (m, 1H), 7.47-7.43 (m, 1H), 7.37 (s, 1H), 7.29 (s, 1H), 4.46 (t, J=8.7 Hz, 2H), 3.18 (t, J=8.7 Hz, 2H), 2.56 (q, J=7.6 Hz, 2H), 1.13 (t, J=7.6 Hz, 3H).

Example 182: N-(Benzo[d]isoxazol-3-yl)-4-ethyl-2-methoxybenzenesulfonamide 182

[0624] ##STR00300##

a) N-(Benzo[d]isoxazol-3-yl)-2-methoxy-4-vinylbenzenesulfonamide A16

[0625] To a solution of N-(benzo[d]isoxazol-3-yl)-4-bromo-2-methoxybenzenesulfonamide 141 (200 mg, 0.52 mmol) in toluene (16 mL), water (8 mL) and isopropanol (8 mL) was added K.sub.2CO.sub.3 (288 mg, 2.09 mmol), 4,4,5,5-tetramethyl-2-vinyl-1,3,2-dioxaborolane (160 mg, 1.04 mmol) and Pd(PPh.sub.3).sub.4 (60 mg, 0.052 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere for 2 h. The mixture was diluted with water (50 mL) and 2 M aq. HCl (20 mL) and extracted with EtOAc (80 mL×2). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=5/1) to give the title compound (150 mg, 76%) as a light yellow solid. LCMS-D: R.sub.t 2.47 min; m/z 331.0 [M+H].sup.+, 353.0 [M+Na].sup.+.

b) N-(Benzo[d]isoxazol-3-yl)-4-ethyl-2-methoxybenzenesulfonamide 182

[0626] To a solution of N-(benzo[d]isoxazol-3-yl)-2-methoxy-4-vinylbenzenesulfonamide A16 (80 mg, 0.24 mmol) in MeOH (10 mL) was added 10% Pd/C (16 mg) and the mixture was stirred at 25° C. overnight under a H.sub.2 atmosphere. The mixture was filtered and the filtrate was concentrated under reduced pressure. The residue was purified by prep. TLC (Pet. ether/EtOAc=5/1) to give the title compound (20 mg, 25%) as a light yellow solid. LCMS-D: R.sub.t 2.55 min; m/z 333.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 8.07 (d, J=8.0 Hz, 1H), 7.79 (d, J=8.0 Hz, 1H), 7.66-7.55 (m, 2H), 7.44-7.31 (m, 1H), 7.01 (s, 1H), 6.96 (d, J=8.4 Hz, 1H), 3.76 (s, 3H), 2.63 (q, J=7.6 Hz, 2H), 1.17 (t, J=7.6 Hz, 3H).

Example 183: N-(Benzo[d]isoxazol-3-yl)-3-methoxy-[1,1-biphenyl]-4-sulfonamide 183

[0627] ##STR00301##

[0628] To a solution of N-(benzo[d]isoxazol-3-yl)-4-bromo-2-methoxybenzenesulfonamide 141 (100 mg, 0.26 mmol) in toluene (7 mL), water (7 mL) and isopropanol (2.5 mL) was added K.sub.2CO.sub.3 (144 mg, 10 mmol), phenylboronic acid (64 mg, 0.52 mmol) and Pd(PPh.sub.3).sub.4 (30 mg, 0.026 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere for 2 h. The mixture was diluted with water (50 mL) and 2 M aq. HCl (10 mL) and extracted with EtOAc (70 mL×2). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (55 mg, 46%) as a light yellow solid. LCMS-D: R.sub.t 2.79 min; m/z 381.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (s, 1H), 8.10 (d, J=8.0 Hz, 1H), 7.98 (d, J=8.0 Hz, 1H), 7.79-7.72 (m, 2H), 7.66-7.58 (m, 2H), 7.54-7.35 (m, 6H), 3.89 (s, 3H).

Example 184: 3-(5-Ethyl-2-methoxyphenylsulfonamido)-N-methylbenzo[d]isoxazole-7-carboxamide I84

[0629] ##STR00302##

a) N-(7-Bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A17

[0630] To a solution of N-(7-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 137 (2.3 g, 5.5 mmol), (2,4-dimethoxyphenyl)methanol (1.4 g, 8.4 mmol) and PPh.sub.3 (3.6 g, 14.2 mmol) in THF (400 mL) at 0° C. under N.sub.2 was added DIAD (3.3 g, 16.4 mmol) and the mixture was stirred at RT over the weekend. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography (Pet. ether/EtOAc=5/1) to give the title compound (1.0 g, 32%) as a light blue solid. LCMS-D: R.sub.t 3.35 min; m/z 583.1/585.1 [M+Na].sup.+.

b) Methyl 3-(N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxyphenylsulfonamido) benzo[d]isoxazole-7-carboxylate A18

[0631] To a solution of N-(7-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A17 (250 mg, 1.34 mmol) in MeOH (5 mL) and DMF (45 mL) was added Et.sub.3N (675 mg, 6.68 mmol) and Pd(dppf)Cl.sub.2 (98 mg, 0.13 mmol) and the mixture was heated at 80° C. under a CO atmosphere overnight. The solvent was removed under reduced pressure and the residue was diluted with EtOAc (50 mL), washed with water (50 mL×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=4/1) to give the title compound (210 mg, 31%) as a white solid. LCMS-D: R.sub.t 3.10 min; m/z 541.2 [M+H].sup.+.

c) 3-(N-((2,4-Dimethoxybenzyl)oxy)-5-ethyl-2-methoxyphenylsulfonamido)-N-methylbenzo[d]isoxazole-7-carboxamide A19

[0632] A mixture of methyl 3-(N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxyphenylsulfonamido) benzo[d]isoxazole-7-carboxylate A18 (20 mg, 0.037 mmol) and CH.sub.3NH.sub.2 (33% solution in EtOH, 4 mL) was heated at 100° C. in a sealed tube for 30 min. The solvent was removed under reduced pressure to give the title compound (20 mg, 100%), which was used in the next step without further purification. LCMS-D: R.sub.t 2.86 min; m/z 540.2 [M+H].sup.+.

d) 3-(5-Ethyl-2-methoxyphenylsulfonamido)-N-methylbenzo[d]isoxazole-7-carboxamide I84

[0633] A mixture of 3-(N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxyphenyl sulfonamido)-N-methylbenzo[d]isoxazole-7-carboxamide A19 (40 mg, 0.07 mmol) and TFA (2 mL) was stirred at RT for 3 h, then concentrated under reduced pressure. The residue was purified by preparative TLC to give the title compound (18 mg, 64%) as a white solid. LCMS-D: R.sub.t 2.35 min; m/z 390.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (s, 1H), 8.31-8.11 (m, 2H), 8.00-7.90 (m, 1H), 7.72 (s, 1H), 7.52-7.41 (m, 2H), 7.14-7.04 (m, 1H), 3.73 (s, 3H), 2.81 (s, 3H), 2.62 (q, J=8.0, 7.6 Hz, 2H), 1.15 (t, J=7.9 Hz, 3H).

Example 185: 3-(5-Ethyl-2-methoxyphenylsulfonamido)-N,N-dimethylbenzo[d]isoxazole-7-carboxamide I85

[0634] ##STR00303##

a) Methyl 3-(5-ethyl-2-methoxyphenylsulfonamido)benzo[d]isoxazole-7-carboxylate A20

[0635] A mixture of methyl 3-(N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxyphenylsulfonamido) benzo[d]isoxazole-7-carboxylate A18 (150 mg, 0.28 mmol) and TFA (5 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=3/1) to give the title compound (80 mg, 74%) as a white solid. LCMS-D: R.sub.t 2.63 min; m/z 391.1 [M+H].sup.+, 413.1 [M+Na].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (s, 1H), 8.39-8.32 (m, 1H), 8.19-8.12 (m, 1H), 7.72 (d, J=2.2 Hz, 1H), 7.56-7.44 (m, 2H), 7.12-7.05 (m, 1H), 3.89 (s, 3H), 3.71 (s, 3H), 2.62 (q, J=7.5 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

b) 3-((5-Ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-7-carboxylic acid A21

[0636] To a suspension of methyl 3-(5-ethyl-2-methoxyphenylsulfonamido) benzo[d]isoxazole-7-carboxylate A20 (200 mg, 0.5 mmol) in MeOH (10 mL) and THF (10 mL) was added 2 M aq. NaOH (1.28 mL) and the mixture was stirred at RT overnight. The solvent was removed under reduced pressure and the residue was diluted with water and adjusted to pH 2-3. The resulting precipitate was collected by filtration to give the title compound (144 mg, 75%) as an off-white solid. LCMS-D: R.sub.t 2.43 min; m/z 377.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 13.5 (s, 1H), 11.8 (s, 1H), 8.35-8.29 (m, 1H), 8.15-8.09 (m, 1H), 7.72 (d, J=2.3 Hz, 1H), 7.53-7.44 (m, 2H), 7.12-7.05 (m, 1H), 3.71 (s, 3H), 2.62 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

c) 3-(5-Ethyl-2-methoxyphenylsulfonamido)benzo[d]isoxazole-7-carbonyl chloride A22

[0637] A mixture of 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-7-carboxylic acid A21 (30 mg, 0.08 mmol) and SOCl.sub.2 (5 mL) was heated at 85° C. under a N.sub.2 atmosphere for 3 h, then concentrated under reduced pressure to give the title compound (31 mg, 100%), which was used directly in the next step without further purification.

d) 3-(5-Ethyl-2-methoxyphenylsulfonamido)-N,N-dimethylbenzo[d]isoxazole-7-carboxamide I85

[0638] To a solution of 3-(5-ethyl-2-methoxyphenylsulfonamido)benzo[d]isoxazole-7-carbonyl chloride A22 (31 mg, 0.08 mmol) in THF (1 mL) was added dimethylamine (40% solution in water, 2 mL) dropwise and the mixture was stirred at RT for 1 h. The mixture concentrated under reduced pressure and the residue was diluted with water, adjusted to pH 2-3 and extracted with DCM (30 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC to give the title compound (18 mg, 56%) as a white solid. LCMS-D: R.sub.t 2.36 min; m/z 404.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (s, 1H), 8.21-8.06 (m, 1H), 7.78-7.56 (m, 2H), 7.45 (s, 2H), 7.17-6.97 (m, 1H), 3.71 (s, 3H), 3.01 (s, 3H), 2.80 (s, 3H), 2.61 (m, 2H), 1.15 (m, 3H).

Example 186: 5-Ethyl-N-(7-(hydroxymethyl)benzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 186

[0639] ##STR00304##

[0640] A mixture of 3-(5-ethyl-2-methoxyphenylsulfonamido)benzo[d]isoxazole-7-carboxylic acid A21 (30 mg, 0.08 mmol) and BH.sub.3-THF (1 M solution in THF, 3 mL, 3 mmol) was stirred at RT under a N.sub.2 atmosphere for 5 h. The reaction was quenched with water and most of the THF was removed under reduced pressure. The residue was adjusted to pH 2-3 and extracted with DCM (15 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by a silica gel chromatography (DCM/MeOH=30/1) to give the title compound (20 mg, 71%) as a light red solid. LCMS-D: R.sub.t 2.35 min; m/z 363.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 7.96-7.89 (m, 1H), 7.70 (d, J=2.3 Hz, 1H), 7.61-7.55 (m, 1H), 7.46 (dd, J=8.5, 2.3 Hz, 1H), 7.34 (t, J=7.6 Hz, 1H), 7.12-7.05 (m, 1H), 5.39 (t, J=5.7 Hz, 1H), 4.70 (d, J=5.4 Hz, 2H), 3.73 (s, 3H), 2.61 (q, J=7.2 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 187: 5-Ethyl-2-methoxy-N-(7-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 187

[0641] ##STR00305##

[0642] To a suspension of N-(7-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 137 (150 mg, 0.36 mmol) in 1,4-dioxane (18 mL) and water (4.5 mL) was added K.sub.2CO.sub.3 (150 mg, 1.09 mmol), methylboronic acid (45 mg, 0.73 mmol) and Pd(dppf)Cl.sub.2 (27 mg, 0.036 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere for 4 h. The mixture was concentrated under reduced pressure and the residue was partitioned between EtOAc (50 mL), water (40 mL) and 1 M aq. HCl (15 mL). The layers were separated and the organic layer was washed with 0.5 M aq. HCl (40 mL×2), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by preparative HPLC to give the title compound (20 mg, 16%) as a white solid. LCMS-D: R.sub.t 2.25 min; m/z 347.1 [M+H].sup.+, 369.1 [M+Na].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 7.89-7.82 (m, 1H), 7.70 (d, J=2.3 Hz, 1H), 7.50-7.38 (m, 2H), 7.25 (t, J=7.6 Hz, 1H), 7.12-7.04 (m, 1H), 3.73 (s, 3H), 2.60 (q, J=7.6 Hz, 2H), 2.39 (s, 3H), 1.15 (t, J=7.6 Hz, 3H).

Example 188: 5-Ethyl-N-(7-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 188

[0643] ##STR00306##

a) N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxy-N-(7-vinylbenzo[d]isoxazol-3-yl)benzenesulfonamide A23

[0644] To a suspension of N-(7-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A17 (200 mg, 0.36 mmol) in 1,4-dioxane (15 mL) and water (3 mL) was added 4,4,5,5-tetramethyl-2-vinyl-1,3,2-dioxaborolane (110 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere for 4 h. The mixture was concentrated under reduced pressure and the residue was diluted with EtOAc (30 mL) and washed with water (25 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by a silica gel chromatography (Pet. ether/EtOAc=2/1) to give the title compound (95 mg, 52%) as a white solid. LCMS-D: R.sub.t 3.28 min; m/z 509.0 [M+H].sup.+.

b) 5-Ethyl-2-methoxy-N-(7-vinylbenzo[d]isoxazol-3-yl)benzenesulfonamide A24

[0645] A mixture of N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxy-N-(7-vinylbenzo[d]isoxazol-3-yl)benzenesulfonamide A23 (95 mg, 0.18 mmol) and TFA (4 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by a silica gel chromatography (Pet. ether/EtOAc=2/1) to give the title compound (40 mg, 61%) as a white solid. LCMS-D: R.sub.t 2.78 min; m/z 359.1 [M+H].sup.30

c) 5-Ethyl-N-(7-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 188

[0646] To a solution of 5-ethyl-2-methoxy-N-(7-vinylbenzo[d]isoxazol-3-yl)benzenesulfonamide A24 (35 mg, 0.098 mmol) in EtOAc (5 mL) was added 10% Pd/C (7 mg) and the mixture was stirred at RT under a H.sub.2 atmosphere overnight. The mixture was filtered, the filtrate was concentrated and the residue was purified by silica gel chromatography (Pet. ether/EtOAc=4/1) to give the title compound (30 mg, 85%) as a white solid. LCMS-D: R.sub.t 2.83 min; m/z 361.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 7.90-7.83 (m, 1H), 7.70 (d, J=2.3 Hz, 1H), 7.50-7.40 (m, 2H), 7.28 (t, J=7.6 Hz, 1H), 7.12-7.05 (m, 1H), 3.73 (s, 3H), 2.80 (q, J=7.5 Hz, 2H), 2.61 (q, J=7.6 Hz, 2H), 1.22 (t, J=7.5 Hz, 3H), 1.15 (t, J=7.6 Hz, 3H).

Example 189: N-(7-Cyclopropylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 189

[0647] ##STR00307##

a) N-(7-Cyclopropylbenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A25

[0648] To a suspension of N-(7-bromobenzo[d]isoxazol-3-yl)-N-((2,4-diethylbenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A17 (200 mg, 0.36 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was added cyclopropylboronic acid (61 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere for 4 h. The mixture was concentrated under reduced pressure and the residue was diluted with EtOAc (30 mL) and washed with water (25 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=3/1) to give the title compound (140 mg, 75%) as a white solid. LCMS-D: R.sub.t 3.34 min; m/z 523.2 [M+H].sup.+.

b) N-(7-Cyclopropylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 189

[0649] A mixture of N-(7-cyclopropylbenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A25 (140 mg, 0.27 mmol) and TFA (6 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=2/1) to give the title compound (80 mg, 81%) as a white solid. LCMS-D: R.sub.t 2.86 min; m/z 373.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 7.81 (dd, J=7.0, 2.1 Hz, 1H), 7.70 (d, J=2.3 Hz, 1H), 7.50-7.43 (m, 1H), 7.27-7.19 (m, 2H), 7.12-7.06 (m, 1H), 3.73 (s, 3H), 2.61 (q, J=7.6 Hz, 2H), 2.17-2.10 (m, 1H), 1.15 (t, J=7.5 Hz, 3H), 1.04-0.97 (m, 2H), 0.90-0.84 (m, 2H).

Example 190: N-(7-Cyclohexylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 190

[0650] ##STR00308##

a) N-(7-(cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A26

[0651] To a suspension of N-(7-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A17 (200 mg, 0.36 mmol) in 1,4-dioxane (15 mL) and water (3 mL) was added cyclohex-1-en-1-ylboronic acid (90 mg, 0.71 mmol), Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) and K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and the mixture was heated at 90° C. under N.sub.2 for 4 h. The mixture was concentrated under reduced pressure and the residue was diluted with EtOAc (30 mL) and washed with water (25 mL×3). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=3/1) to give the title compound (150 mg, 75%) as a white solid, which was used directly in the next step.

b) N-(7-(Cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide A27

[0652] A mixture of N-(7-(cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A26 (150 mg, 0.26 mmol) and TFA (7 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=2/1) to give the title compound (65 mg, 60%) as a white solid. LCMS-D: R.sub.t 3.64 min; m/z 413 [M+H].sup.+.

c) N-(7-Cyclohexylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 190

[0653] A mixture of N-(7-(cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide A27 (65 mg, 0.15 mmol) and 10% Pd/C (13 mg) in EtOAc (10 mL) was stirred at RT under a H.sub.2 atmosphere for 3 h. The mixture was filtered and the filtrate was concentrated under reduced pressure to give the title compound (40 mg, 61%) as a white solid. LCMS-D: R.sub.t 3.34 min; m/z 415.2 [M+H].sup.+. 1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 7.87-7.82 (m, 1H), 7.70 (d, J=2.3 Hz, 1H), 7.49-7.41 (m, 2H), 7.28 (t, J=7.6 Hz, 1H), 7.12-7.06 (m, 1H), 3.72 (s, 3H), 2.62 (q, J=7.6 Hz, 2H), 1.85-1.75 (m, 4H), 1.75-1.67 (m, 1H), 1.61-1.48 (m, 2H), 1.44-1.20 (m, 4H), 1.15 (t, J=7.6 Hz, 3H).

Example 191: 5-Ethyl-2-methoxy-N-(7-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 191

[0654] ##STR00309##

a) N-((2,4-Dimethoxybenzyl)oxy)-5-ethyl-2-methoxy-N-(7-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide A29

[0655] To a mixture of N-(7-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A17 (150 mg, 0.27 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was added K.sub.2CO.sub.3 (110 mg, 0.80 mmol), (1-methyl-1H-pyrazol-4-yl)boronic acid (67 mg, 0.33 mmol) and Pd(dppf)Cl.sub.2 (20 mg, 0.027 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere overnight. The mixture was diluted with 0.5 M aq. HCl (30 mL) and the organic solvent was mostly removed under reduced pressure. The remaining aqueous mixture was extracted with DCM (40 mL×3) and the combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=100/1) to give the title compound (80 mg, 53%) as a light yellow solid, which was used directly in the next step.

b) 5-Ethyl-2-methoxy-N-(7-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 191

[0656] A mixture of N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxy-N-(7-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide A29 (80 mg, 0.14 mmol) and TFA (3 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=80/1) to give the title compound (50 mg, 86%) as a light yellow solid. LCMS-D: R.sub.t 2.59 min; m/z 413.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.8 (s, 1H), 8.34 (s, 1H), 8.06 (s, 1H), 7.91-7.84 (m, 2H), 7.72 (d, J=2.3 Hz, 1H), 7.50-7.43 (m, 1H), 7.41-7.32 (m, 1H), 7.13-7.06 (m, 1H), 3.90 (s, 3H), 3.74 (s, 3H), 2.62 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.5 Hz, 3H).

Example 192: 5-Ethyl-2-methoxy-N-(7-(pyrimidin-5-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 192

[0657] ##STR00310##

[0658] To a suspension of N-(7-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 137 (200 mg, 0.49 mmol) in toluene (16 mL), water (8 mL) and isopropanol (8 mL) was added pyrimidin-5-ylboronic acid (181 mg, 1.46 mmol), K.sub.3PO.sub.4 (518 mg, 1.95 mmol) and Pd(dppf)Cl.sub.2 (36 mg, 0.049 mmol) and the mixture was heated at 90° C. under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 5-6 and extracted with EtOAc (20 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=40/1) to give the title compound (18 mg, 9%) as a brown solid. LCMS-D: R.sub.t 2.49 min; m/z 411.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (s, 1H), 9.34-9.18 (m, 2H), 8.17 (d, J=8.1 Hz, 1H), 8.06 (d, J=7.4 Hz, 1H), 7.73 (s, 1H), 7.62-7.42 (m, 3H), 7.17-7.06 (m, 1H), 3.75 (s, 3H), 2.62 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 193: 5-Ethyl-2-methoxy-N-(6-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 193

[0659] ##STR00311##

a) N-(6-Bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A30

[0660] To a solution of N-(6-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 138 (4.1 g, 10.0 mmol), (2,4-dimethoxyphenyl)methanol (2.5 g, 15.0 mmol) and PPh.sub.3 (6.6 g, 25.0 mmol) in THF (100 mL) at 0° C. under N.sub.2 was added DIAD (4.0 g, 20.0 mmol) and the mixture was stirred at RT overnight. The mixture was concentrated under reduced pressure and the residue was purified by silica gel chromatography (Pet. ether/EtOAc=50/1 to 5/1) to give the title compound (4.0 g, 71%) as a white solid, which was used directly in the next step.

b) N-(2,4-Dimethoxybenzyl)-5-ethyl-2-methoxy-N-(6-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide A31

[0661] A mixture of N-(6-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A30 (120 mg, 0.214 mmol), CH.sub.3B(OH).sub.2 (64 mg, 1.07 mmol), Pd(dppf)Cl.sub.2 (31 mg, 0.428 mmol) and K.sub.2CO.sub.3 (148 mg, 1.07 mmol) in 1,4-dioxane (10 mL) and water (2 mL) was heated at 90° C. under N.sub.2 overnight. The solvent was removed under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 5/1) to give the title compound (72 mg, 68%) as a white solid, which was used directly in the next step.

c) 5-Ethyl-2-methoxy-N-(6-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 193

[0662] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxy-N-(6-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide A31 (72 mg, 0.145 mmol) and TFA (3 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 3/1) to give the title compound (45 mg, 90%) as a white solid. LCMS-D: R.sub.t 2.76 min; m/z 347.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 7.94-7.87 (m, 1H), 7.68 (d, J=2.3 Hz, 1H), 7.49-7.42 (m, 1H), 7.39 (s, 1H), 7.23-7.16 (m, 1H), 7.13-7.05 (m, 1H), 3.72 (s, 3H), 2.60 (q, J=7.5 Hz, 2H), 2.43 (s, 3H), 1.14 (t, J=7.5 Hz, 3H).

Example 194: 5-Ethyl-N-(6-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 194

[0663] ##STR00312##

a) N-(2,4-Dimethoxybenzyl)-5-ethyl-N-(6-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide A32

[0664] A mixture of N-(6-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A30 (200 mg, 0.356 mmol), ethylboronic acid (132 mg, 1.78 mmol), Pd(dppf)Cl.sub.2 (52 mg, 0.071 mmol) and K.sub.2CO.sub.3 (246 mg, 1.78 mmol) in 1,4-dioxane (20 mL) and water (4 mL) was heated at 90° C. under N.sub.2 overnight. The solvent was removed under reduced pressure and the residue was partitioned between DCM (200 mL) and water (50 mL). The layers were separated and the organic layer was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (120 mg, 67%) as a white solid, which was used directly in the next step.

b) 5-Ethyl-N-(6-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 194

[0665] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-N-(6-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide A32 (120 mg, 0.24 mmol) and TFA (5 mL) was stirred at RT overnight then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 3/1) to give the title compound (80 mg, 94%) as a white solid. LCMS-D: R.sub.t 2.84 min; m/z 361.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 7.97-7.90 (m, 1H), 7.69 (d, J=2.3 Hz, 1H), 7.49-7.37 (m, 2H), 7.26-7.19 (m, 1H), 7.11-7.04 (m, 1H), 3.72 (s, 3H), 2.73 (q, J=7.6 Hz, 2H), 2.60 (q, J=7.6 Hz, 2H), 1.20 (t, J=7.6 Hz, 3H), 1.14 (t, J=7.6 Hz, 3H).

Example 195: N-(6-Cyclopropylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 195

[0666] ##STR00313##

[0667] A mixture of N-(6-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 138 (206 mg, 0.5 mmol), cyclopropylboronic acid (215 mg, 2.5 mmol), Pd(dppf)Cl.sub.2 (73 mg, 0.1 mmol) and K.sub.2CO.sub.3 (345 mg, 2.5 mmol) in 1,4-dioxane (20 mL) and water (4 mL) was heated at 90° C. under N.sub.2 overnight. The solvent was removed under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 3/1) to give the title compound (80 mg, 43%) as a white solid. LCMS-D: R.sub.t 2.86 min; m/z 373.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 7.91-7.85 (m, 1H), 7.68 (d, J=2.3 Hz, 1H), 7.48-7.42 (m, 1H), 7.27 (s, 1H), 7.12-7.04 (m, 2H), 3.72 (s, 3H), 2.60 (q, J=7.6 Hz, 2H), 2.10-2.00 (m, 1H), 1.14 (t, J=7.5 Hz, 3H), 1.07-0.99 (m, 2H), 0.83-0.75 (m, 2H).

Example 196: 5-Ethyl-2-methoxy-N-(6-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 196

[0668] ##STR00314##

a) N-(2,4-Dimethoxybenzyl)-5-ethyl-2-methoxy-N-(6-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide A33

[0669] A mixture of N-(6-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A30 (120 mg, 0.214 mmol), (1-methyl-1H-pyrazol-4-yl)boronic acid (54 mg, 0.428 mmol), Pd(dppf)Cl.sub.2 (31 mg, 0.043 mmol) and K.sub.2CO.sub.3 (148 mg, 1.07 mmol) in 1,4-dioxane (10 mL) and water (2 mL) was heated at 90° C. under N.sub.2 overnight. The solvent was removed under reduced pressure and the residue was partitioned between DCM (150 mL) and water (50 mL). The layers were separated and the organic layer was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 5/1) to give the title compound (90 mg, 75%) as a brown solid. LCMS-D: R.sub.t 3.05 min; m/z 563.0 [M+H].sup.+.

b) 5-Ethyl-2-methoxy-N-(6-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 196

[0670] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxy-N-(6-(1-methyl-1H-pyrazol-4-yl) benzo[d]isoxazol-3-yl)benzenesulfonamide A33 (90 mg, 0.16 mmol) and TFA (5 mL) was stirred at RT overnight then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=50/1 to 5/1) to give the title compound (30 mg, 46%) as a brown solid. LCMS-D: R.sub.t 2.57 min; m/z 413.2 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 8.29 (s, 1H), 8.06-7.95 (m, 2H), 7.78 (s, 1H), 7.70 (d, J=2.3 Hz, 1H), 7.64-7.56 (m, 1H), 7.50-7.42 (m, 1H), 7.13-7.05 (m, 1H), 3.87 (s, 3H), 3.71 (s, 3H), 2.61 (q, J=7.6 Hz, 2H), 1.15 (t, J=7.5 Hz, 3H).

Example 197: 5-Ethyl-2-methoxy-N-(6-(pyrimidin-5-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 197

[0671] ##STR00315##

[0672] A mixture of N-(6-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 138 (100 mg, 0.24 mmol), pyrimidin-5-ylboronic acid (45 mg, 0.36 mmol), Pd(PPh.sub.3).sub.4 (28 mg, 0.024 mmol) and K.sub.2CO.sub.3 (166 mg, 1.2 mmol) in toluene (8 mL), water (8 mL) and isopropanol (2 mL) was heated at 90° C. under N.sub.2 for 4 h. 2 M aq. NaOH (15 mL) was added and the mixture was stirred at RT for 20 min. The mixture was washed with EtOAc (20 mL×2) then adjusted to pH 2 with conc. HCl and extracted with DCM (50 mL×2). The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (DCM/MeOH=30/1) to give the title compound (15 mg, 15%) as a white solid. LCMS-D: R.sub.t 2.97 min; m/z 411.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.8 (s, 1H), 9.24 (s, 3H), 8.21-8.15 (m, 1H), 8.11 (s, 1H), 7.85-7.78 (m, 1H), 7.72 (d, J=2.3 Hz, 1H), 7.49-7.42 (m, 1H), 7.13-7.05 (m, 1H), 3.73 (s, 3H), 2.61 (q, J=7.6 Hz, 2H), 1.15 (t, J=7.6 Hz, 3H).

Example 198: 5-Ethyl-2-methoxy-N-(4-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 198

[0673] ##STR00316##

a) N-(4-Bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34

[0674] To a solution of N-(4-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 129 (2.1 g, 5.1 mmol), (2,4-dimethoxyphenyl)methanol (1.3 g, 7.7 mmol) and PPh.sub.3 (3.35 g, 12.8 mmol) in THF (200 mL) at 0° C. under N.sub.2 was added DIAD (3.1 g, 15.3 mmol) and the mixture was stirred at 0° C. for 1 h then allowed to warm to RT and stirred overnight. The mixture was concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=5/1) to give the title compound (1.2 g, 42%) as a white solid. LCMS-D: R.sub.t 3.40 min; m/z 583.0 [M+H].sup.+.

b) N((2,4-Dimethoxybenzyl)oxy)-5-ethyl-2-methoxy-N-(4-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide A35

[0675] A mixture of N-(4-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34 (200 mg, 0.36 mmol), methylboronic acid (43 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) in 1,4-dioxane (15 mL) and water (3 mL) was heated at 90° C. under N.sub.2 for 4 h. The mixture was adjusted to pH 2-3 and most of the solvent was removed under reduced pressure. The residue was diluted with water (10 mL) and extracted with DCM (25 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EA=5/1) to give the title compound (125 mg, 71%) as a white solid, which was used directly in the next step.

c) 5-Ethyl-2-methoxy-N-(4-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 198

[0676] A mixture of N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxy-N-(4-methyl benzo[d]isoxazol-3-yl)benzenesulfonamide A35 (125 mg, 0.26 mmol) and TFA (3 mL) was stirred at RT under for 3 h then diluted with DCM (100 mL), washed with water, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=3/1) to give the title compound (85 mg, 92%) as a white solid. LCMS-D: R.sub.t 2.69 min m/z 347.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.6 (s, 1H), 7.58-7.56 (m, 1H), 7.52-7.46 (m, 3H), 7.18-7.14 (m, 2H), 3.73 (s, 3H), 2.62-2.56 (m, 5H), 1.14 (t, J=7.6 Hz, 3H)

Example 199: 5-Ethyl-N-(4-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 199

[0677] ##STR00317##

a) N-(2,4-Dimethoxybenzyl)-5-ethyl-N-(4-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide A36

[0678] A mixture of N-(4-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34 (200 mg, 0.36 mmol), ethylboronic acid (53 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was heated at 90° C. under N.sub.2 for 4 h. The mixture was adjusted to pH 2-3 and most of the solvent was removed under reduced pressure. The residue was diluted with water (15 mL) and extracted with DCM (20 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=5/1) to give the title compound (120 mg, 66%) as a white solid, which was used directly in the next step.

b) 5-Ethyl-N-(4-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 199

[0679] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-N-(4-ethylbenzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide A36 (120 mg, 0.23 mmol) and TFA (3 mL) was stirred at room temperature under N.sub.2 for 3 h then diluted with DCM (100 mL), washed with water, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=3/1) to give the title compound (75 mg, 89%) as a white solid. LCMS-D: R.sub.t 2.80 min 361.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.5 (s, 1H), 7.60-7.49 (m, 4H), 7.22-7.18 (m, 2H), 3.81 (s, 3H), 8.09 (q, J=7.6 Hz, 2H), 2.59 (q, J=7.6 Hz, 2H), 1.25 (t, J=7.6 Hz, 3H), 1.14 (t, J=7.6 Hz, 3H).

Example 200: N-(4-Cyclopropylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 200

[0680] ##STR00318##

a) N-(4-Cyclopropylbenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A37

[0681] A mixture of N-(4-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34 (200 mg, 0.36 mmol), cyclopropylboronic acid (61 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was heated at 90° C. under N.sub.2 for 4 h. The mixture was adjusted to pH 2-3 and most of the solvent was removed under reduced pressure. The residue was diluted with water (15 mL) and extracted with DCM (20 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=5/1) to give the title compound (120 mg, 66%) as a yellow solid, which was used directly in the next step.

b) N-(4-Cyclopropylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 200

[0682] A mixture of N-(4-cyclopropylbenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A37 (130 mg, 0.25 mmol) and TFA (3 mL) was stirred at RT under N.sub.2 for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=3/1) to give the title compound (85 mg, 92%) as a yellow solid. LCMS-D: R.sub.t 2.81 min, 373.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.6 (s, 1H), 7.58-7.57 (d, J=2.0 Hz, 1H), 7.53-7.42 (m, 3H), 7.18-7.16 (m, 1H), 6.86-6.84 (m, 1H), 3.74 (s, 3H), 2.72 (m, 1H), 2.60 (q, J=7.6 Hz, 2H), 1.14 (t, J=7.6 Hz, 3H), 1.02-0.98 (m, 2H), 0.82-0.78 (m, 2H).

Example 201: N-(4-cyclohexylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 201

[0683] ##STR00319##

a) N-(4-(Cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A38

[0684] A mixture of N-(4-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34 (200 mg, 0.36 mmol), cyclohex-1-en-1-ylboronic acid (90 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was heated at 90° C. under N.sub.2 for 4 h. Most of the solvent was removed under reduced pressure, the residue was diluted with water (30 mL), adjusted to pH 1-2 and extracted with DCM (35 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/1) to give the title compound (150 mg, 75%) as a white solid, which was used directly in the next step.

b) N-(4-(Cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide A39

[0685] A mixture of N-(4-(cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A38 (150 mg, 0.27 mmol) and TFA (3 mL) was stirred at RT under N.sub.2 for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=2/1) to give the title compound (80 mg, 73%) as a white solid, which was used directly in the next step.

c) N-(4-Cyclohexylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 201

[0686] A mixture of N-(4-(cyclohex-1-en-1-yl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxy benzenesulfonamide A39 (80 mg, 0.19 mmol) and 10% Pd/C (16 mg) in EtOAc (10 mL) was stirred at RT under a H.sub.2 atmosphere for 3 h. The mixture was filtered and the filtrate was concentrated under reduced pressure to give the title compound (75 mg, 94%) as a white solid. LCMS-D: R.sub.t 3.24 min, 415.2 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.5 (s, 1H), 7.58-7.48 (m, 4H), 7.26 (d, J=7.2 Hz, 1H), 7.19 (d, J=8.8 Hz, 1H), 3.80 (s, 3H), 3.62-3.56 (m, 1H), 2.59 (q, J=7.6 Hz, 2H), 1.91-1.71 (m, 5H), 1.45-1.23 (m, 5H), 1.15 (t, J=7.6 Hz, 3H).

Example 202: 5-Ethyl-2-methoxy-N-(4-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 202

[0687] ##STR00320##

a) N-(2,4-Dimethoxybenzyl)-5-ethyl-2-methoxy-N-(4-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide A40

[0688] A mixture of N-(4-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34 (200 mg, 0.36 mmol), (1-methyl-1H-pyrazol-4-yl)boronic acid (90 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was heated at 90° C. under N.sub.2 for 4 h. Most of the solvent was removed under reduced pressure, the residue was diluted with water (30 mL), adjusted to pH 1-2 and extracted with DCM (35 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/1) to give the title compound (105 mg, 53%) as a yellow solid, which was used directly in the next step.

b) 5-Ethyl-2-methoxy-N-(4-(1-methyl-1H-pyrazol-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 202

[0689] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxy-N-(4-(1-methyl-1H-pyrazol-4-yl) benzo[d]isoxazol-3-yl)benzenesulfonamide A40 (105 mg, 0.19 mmol) and TFA (2 mL) was stirred at RT under N.sub.2 for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=80/1) to give the title compound (60 mg, 79%) as a yellow solid. LCMS-D: R.sub.t 2.587 min, m/z 413.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.2 (s, 1H), 8.12 (s, 1H), 7.90 (s, 1H), 7.66-7.45 (m, 4H), 7.39 (d, J=7.2 Hz, 1H), 7.13 (d, J=8.4 Hz, 1H), 3.88 (s, 3H), 3.75 (s, 3H), 2.58 (q, J=7.6 Hz, 2H), 1.15 (t, J=7.6 Hz, 3H).

Example 203: 5-Ethyl-2-methoxy-N-(4-(pyrimidin-5-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 203

[0690] ##STR00321##

a) N-(2,4-Dimethoxybenzyl)-5-ethyl-2-methoxy-N-(4-(pyrimidin-5-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide A41

[0691] A mixture of N-(4-bromobenzo[d]isoxazol-3-yl)-N-((2,4-dimethoxybenzyl)oxy)-5-ethyl-2-methoxybenzenesulfonamide A34 (200 mg, 0.36 mmol), pyrimidin-5-ylboronic acid (43 mg, 0.71 mmol), K.sub.2CO.sub.3 (148 mg, 1.07 mmol) and Pd(dppf)Cl.sub.2 (26 mg, 0.036 mmol) in 1,4-dioxane (15 mL) and H.sub.2O (3 mL) was heated at 90° C. under N.sub.2 for 4 h. Most of the solvent was removed under reduced pressure, the residue was diluted with water (30 mL), adjusted to pH 1-2 and extracted with DCM (35 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=60/1) to give the title compound (95 mg, 47%) as a yellow solid, which was used directly in the next step.

b) 5-Ethyl-2-methoxy-N-(4-(pyrimidin-5-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 203

[0692] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxy-N-(4-(pyrimidin-5-yl) benzo[d]isoxazol-3-yl)benzenesulfonamide A41 (95 mg, 0.17 mmol) and TFA (2 mL) was stirred at RT under N.sub.2 for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=40/1) to give the title compound (45 mg, 65%) as a red solid. LCMS-D: R.sub.t 2.50 min, m/z 411.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.5 (s, 1H), 9.24 (s, 1H), 8.97 (s, 2H), 7.86-7.79 (m, 2H), 7.53-7.38 (m, 3H), 7.13-7.11 (m, 1H), 3.75 (s, 3H), 2.55 (t, J=7.6 Hz, 2H), 1.11 (t, J=7.6 Hz, 3H).

Example 204: N-(5-Ethylbenzo[d]isoxazol-3-yl)-3-methoxy-5,6,7,8-tetrahydronaphthalene-2-sulfonamide 204

[0693] ##STR00322##

[0694] A mixture of N-(5-bromobenzo[d]isoxazol-3-yl)-3-methoxy-5,6,7,8-tetrahydronaphthalene-2-sulfonamide 113 (219 mg, 0.5 mmol), ethylboronic acid (185 mg, 2.5 mmol), Pd(dppf)Cl.sub.2 (73 mg, 0.1 mmol) and K.sub.2CO.sub.3 (345 mg, 2.5 mmol) in 1,4-dioxane (20 mL) and water (20 mL) was heated at 90° C. under N.sub.2 overnight. The mixture was then adjusted to pH 1 and most of the solvent was removed under reduced pressure. The residue was diluted with water (50 mL) and extracted with DCM (100 mL). The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=10/1 to 2/1) followed by preparative TLC (Pet. ether/EtOAc=1/1) to give the title compound (52 mg, 27%) as a white solid. LCMS-D: R.sub.t 3.06 min, m/z 387.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ11.4 (s, 1H), 7.83 (s, 1H), 7.54 (s, 1H), 7.51-7.43 (m, 2H), 6.84 (s, 1H), 3.71 (s, 3H), 2.77-2.65 (m, 6H), 1.75-1.66 (m, 4H), 1.24 (t, J=7.6 Hz, 3H).

Example 205: N-(5-Cyclopropylbenzo[d]isoxazol-3-yl)-3-methoxy-5,6,7,8-tetrahydronaphthalene-2-sulfonamide 205

[0695] ##STR00323##

[0696] A mixture of N-(5-bromobenzo[d]isoxazol-3-yl)-3-methoxy-5,6,7,8-tetrahydronaphthalene-2-sulfonamide 113 (219 mg, 0.5 mmol), cyclopropylboronic acid (215 mg, 2.5 mmol), Pd(dppf)Cl.sub.2 (73 mg, 0.1 mmol) and K.sub.2CO.sub.3 (345 mg, 2.5 mmol) in 1,4-dioxane (20 mL) and water (4 mL) was heated at 90° C. under N.sub.2 overnight. The mixture was then adjusted to pH 1 with conc. HCl and most of the solvent was removed under reduced pressure. The residue was diluted with water (30 mL) and extracted with DCM (100 mL). The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=10/1 to 2/1) followed by preparative TLC (Pet. ether/EtOAc=1/1) to give the title compound (50 mg, 25%) as a white solid. LCMS-D: R.sub.t 3.07 min, m/z 399.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.4 (s, 1H), 7.68 (s, 1H), 7.54 (s, 1H), 7.47-7.43 (m, 1H), 7.40-7.35 (m, 1H), 6.84 (s, 1H), 3.71 (s, 3H), 2.77-2.65 (m, 4H), 2.08-2.00 (m, 1H), 1.74-1.66 (m, 4H), 1.04-0.96 (m, 2H), 0.68-0.61 (m, 2H).

Example 206: N-(4-Chloro-5-ethylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 206

[0697] ##STR00324##

[0698] A mixture of N-(5-bromo-4-chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxy benzenesulfonamide 128 (200 mg, 0.449 mmol), ethylboronic acid (166 mg, 2.244 mmol), Pd(dppf)Cl.sub.2 (66 mg, 0.09 mmol) and K.sub.2CO.sub.3 (310 mg, 2.244 mmol) in 1,4-dioxane (20 mL) and water (4 mL) was heated at 90° C. under N.sub.2 overnight. The mixture was then adjusted to pH 2 with 1 M aq. HCl and most of the solvent was removed under reduced pressure. The residue was diluted with water and extracted with DCM. The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=50/1 to 2/1) followed by preparative TLC (DCM/MeOH=10/1) to give the title compound (15 mg, 9%) as a white solid. LCMS-D: R.sub.t 2.89 min, m/z 395.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.4 (s, 1H), 7.64 (s, 2H), 7.61-7.57 (m, 1H), 7.49-7.44 (m, 1H), 7.15-7.10 (m, 1H), 3.66 (s, 3H), 2.80 (q, J=7.6 Hz, 2H), 2.60 (q, J=7.6 Hz, 2H), 1.21-1.11 (m, 6H).

Example 207: N-(4-Chloro-5-cyclopropylbenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 207

[0699] ##STR00325##

[0700] A mixture of N-(5-bromo-4-chlorobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxy benzenesulfonamide 128 (200 mg, 0.449 mmol), cyclopropylboronic acid (193 mg, 2.244 mmol), Pd(dppf)Cl.sub.2 (66 mg, 0.09 mmol) and K.sub.2CO.sub.3 (310 mg, 2.244 mmol) in 1,4-dioxane (20 mL) and water (4 mL) was heated at 90° C. under N.sub.2 overnight. The mixture was then adjusted to pH 2 with 1 M aq. HCl and most of the solvent was removed under reduced pressure. The residue was diluted with water and extracted with DCM. The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=50/1 to 3/1) followed by preparative TLC (DCM/MeOH=100/1) to give the title compound (20 mg, 11%) as a white solid. LCMS-D: R.sub.t 2.91 min, m/z 407.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.4 (s, 1H), 7.64-7.56 (m, 2H), 7.52-7.44 (m, 1H), 7.34-7.27 (m, 1H), 7.17-7.11 (m, 1H), 3.67 (s, 3H), 2.60 (q, J=7.6 Hz, 2H), 2.27-2.17 (m, 1H), 1.15 (t, J=7.6 Hz, 3H), 1.08-1.00 (m, 2H), 0.78-0.70 (m, 2H).

Example 208: N-(5-Cyclopropyl-4-methoxybenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 208

[0701] ##STR00326##

[0702] A mixture of N-(5-bromo-4-methoxybenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxy benzenesulfonamide 108 (100 mg, 0.227 mmol), cyclopropylboronic acid (97 mg, 1.133 mmol), Pd(dppf)Cl.sub.2 (33 mg, 0.046 mmol) and K.sub.2CO.sub.3 (156 mg, 1.133 mmol) in 1,4-dioxane (20 mL) and water (4 mL) was heated at 90° C. under N.sub.2 overnight. The mixture was then adjusted to pH 2 with 1 M aq. HCl and most of the solvent was removed under reduced pressure. The residue was diluted with water and extracted with DCM. The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (Pet. ether/EtOAc=50/1 to 3/1) followed by preparative TLC (DCM/MeOH=100/1) to give the title compound (30 mg, 33%) as a white solid. LCMS-D: R.sub.t 2.87 min; m/z 403.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.4 (s, 1H), 7.63 (d, J=2.3 Hz, 1H), 7.50-7.45 (m, 1H), 7.32-7.26 (m, 1H), 7.19-7.12 (m, 2H), 3.92 (s, 3H), 3.81 (s, 3H), 2.61 (q, J=7.6 Hz, 2H), 2.22-2.15 (m, 1H), 1.15 (t, J=7.5 Hz, 3H), 1.03-0.94 (m, 2H), 0.76-0.64 (m, 2H).

Examples 209, 210 and 211

[0703] ##STR00327## ##STR00328##

a) tert-Butyl((3,5-dimethoxybenzyl)oxy)dimethylsilane A42

[0704] To a solution of (3,5-dimethoxyphenyl)methanol (10 g, 0.059 mol) and imidazole (6.07 g, 0.089 mol) in DMF (100 mL) at RT was added TBSCl (9.86 g, 0.065 mol) and the mixture was stirred overnight. Water was added and the mixture was extracted with EtOAc. The organic extract was washed with water, concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=20/1 to 10/1) to give the title compound (13 g, 77%) as a colorless oil, which was used directly in the next step.

b) Lithium 4-(((tert-butyldimethylsilyl)oxy)methyl)-2,6-dimethoxybenzenesulfinate A43

[0705] To a solution of tert-butyl((3,5-dimethoxybenzyl)oxy)dimethylsilane A42 (5 g, 0.018 mol) and TMEDA (2.26 g, 0.020 mol) in n-hexane (100 mL) at −70° C. was added n-BuLi (2.5 M solution in hexanes, 7.8 mL, 0.020 mol) and the mixture was stirred at 0° C. for 1 h. The mixture was then re-cooled to −60° C. and bubbled with SO.sub.2 gas for 30 min. The resulting precipitate was collected by filtration and washed with n-hexane to give the title compound (6.2 g, 100%), which was used directly in the next step.

c) 4-(((tert-Butyldimethylsilyl)oxy)methyl)-2,6-dimethoxybenzenesulfonyl chloride A44

[0706] To a mixture of lithium 4-(((tert-butyldimethylsilyl)oxy)methyl)-2,6-dimethoxy benzenesulfinate A43 (6.2 g, 0.018 mol) in n-hexane (100 mL) at 0° C. was added SO.sub.2Cl.sub.2 (2.39 g, 0.018 mol) and the mixture was stirred at 0° C. for 1 h. The solids were collected by filtration, washed with n-hexane then dissolved in EtOAc and washed with water. The organic layer was concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=20/1 to 5/1) to give the title compound (2.4 g, 36%) as a yellow solid, which was used directly in the next step.

d) 4-(((tert-Butyldimethylsilyl)oxy)methyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide A45

[0707] To a solution of 4-methoxybenzo[d]isoxazol-3-amine (819 mg, 4.99 mmol) in THF (20 mL) at −78° C. was added LiHMDS (1 M solution in THF, 5.98 mL, 5.98 mmol) and the mixture was stirred at 0° C. for 30 min, then cooled to −60° C. A solution of 4-(((tert-butyldimethylsilyl)oxy)methyl)-2,6-dimethoxybenzenesulfonyl chloride A44 (1.9 g, 4.99 mmol) in THF (20 mL) was added and the mixture was stirred at RT overnight. The mixture was adjusted to pH 5 with 1 M aq. HCl and extracted with EtOAc. The organic extract was concentrated under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 20/1) to give the title compound (170 mg, 7%) as a yellow solid. LCMS-D: R.sub.t 3.33 min, m/z 509.0 [M+H].sup.+.

e) 4-(Hydroxymethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 209

[0708] To a solution of 4-(((tert-butyldimethylsilyl)oxy)methyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide A45 (170 mg, 0.334 mmol) in THF (10 mL) was added TBAF (175 mg, 0.668 mmol) and the mixture was stirred at RT for 3 h. The reaction was quenched with 1 M aq. HCl and the mixture was extracted with EtOAc. The organic extract was concentrated under reduced pressure and the residue was purified by preparative TLC (DCM/MeOH=100/1 to 50/1) to give the title compound (30 mg, 23%) as a white solid. LCMS-D: R.sub.t 1.93 min, m/z 394.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.40 (s, 1H), 7.55 (t, J=8.2 Hz, 1H), 7.18-7.12 (m, 1H), 6.89-6.82 (m, 1H), 6.72 (s, 2H), 5.39 (t, J=5.8 Hz, 1H), 4.49 (d, J=5.8 Hz, 2H), 3.95 (s, 3H), 3.77 (s, 6H).

f) 4-(Bromomethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide A46

[0709] A solution of 4-(hydroxymethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl) benzenesulfonamide 209 (1.0 g, 2.53 mmol), CBr.sub.4 (2.52 g, 7.60 mmol) and PPh.sub.3 (1.99 g, 7.60 mmol) in DCM (20 mL) was stirred at RT overnight. The mixture was concentrated under reduced pressure and the residue was purified by column chromatography (DCM/MeOH=50/1 to 10:1) to give the title compound (600 mg, 52%) as a yellow solid, which was used directly in the next step.

g) 4-(Azidomethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide A47

[0710] A solution of 4-(bromomethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl) benzenesulfonamide A46 (200 mg, 0.44 mmol) and NaN.sub.3 (85 mg, 1.31 mmol) in DMF (5 mL) was heated at 50° C. for 3 h. The mixture was poured into water and the precipitate was collected by filtration. The filter cake was washed with water and dried to give the title compound (100 mg, 54%) as gray solid. LCMS-D: R.sub.t 2.45 min, m/z 420.1 [M+H].sup.+.

h) 4-(Aminomethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide hydrochloride 210

[0711] A solution of 4-(azidomethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl) benzenesulfonamide A47 (300 mg, 0.716 mmol) and PPh.sub.3 (207 mg, 0.788 mmol) in THF (8 mL) and EtOH (6 mL) was stirred at RT for 3 h. Water (2 mL) and concentrated HCl (2 mL) were added and the mixture was heated at 55° C. for 3 h. Most of the organic solvents were removed under reduced pressure and the aqueous residue was washed with DCM. The aqueous phase was concentrated under reduced pressure to give the title compound (150 mg, 53%) as a yellow solid. LCMS-D: R.sub.t 0.38 min, m/z 394.1 [M+H].sup.+. .sup.1H NMR (400 MHz, methanol-d.sub.4) δ 7.54 (t, J=8.2 Hz, 1H), 7.06-7.01 (m, 1H), 6.87 (s, 2H), 6.86-6.82 (m, 1H), 4.12 (s, 2H), 4.07 (s, 3H), 3.89 (s, 6H).

i) N-(3,5-Dimethoxy-4-(N-(4-methoxybenzo[d]isoxazol-3-yl)sulfamoyl)benzyl)acetamide 211

[0712] A mixture of 4-(aminomethyl)-2,6-dimethoxy-N-(4-methoxybenzo[d]isoxazol-3-yl) benzenesulfonamide hydrochloride 210 (130 mg, 0.33 mmol), NaHCO.sub.3 (83 mg, 0.99 mmol) and acetic anhydride (101 mg, 0.99 mmol) in THF (5 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by preparative TLC to give the title compound (50 mg, 34%) as a yellow solid. LCMS-D: R.sub.t 1.93 min, m/z 436.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.47 (s, 1H), 8.36 (t, J=5.8 Hz, 1H), 7.55 (m, 1H), 7.18-7.12 (m, 1H), 6.89-6.81 (m, 1H), 6.66 (s, 2H), 4.24 (d, J=5.9 Hz, 2H), 3.94 (s, 3H), 3.76 (s, 6H), 1.88 (s, 3H).

Example 212: 2-Fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212

[0713] ##STR00329##

a) 2,6-Difluoro-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide A48

[0714] To a solution of 4-methoxybenzo[d]isoxazol-3-amine (4.0 g, 24.0 mmol) in THF (200 mL) at −78° C. under nitrogen was added LiHMDS (1 M solution in THF, 31.2 mL, 31.2 mmol) dropwise and the mixture was stirred at −78° C. for 3 h. A solution of 2,6-difluorophenylsulfonyl chloride (10.2 g, 48 mmol) in THF (20 mL) was then added dropwise and the mixture was allowed to warm slowly to RT and stirred overnight. Water was added and the mixture was extracted with EtOAc (200 mL×3). The combined organic extracts were washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=6/1 to 2/1) to give the title compound (2.9 g, 35%) as a white solid. LCMS-D: R.sub.t 1.94 min, m/z 341.1 [M+H].sup.+.

b) 2-Fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212

[0715] A mixture of 2,6-difluoro-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide A48 (450 mg, 1.32 mmol) and NaOMe (428 mg, 7.92 mmol) in MeOH (6 mL) was heated at 120° C. overnight then allowed to cool to RT and filtered. The filtrate was concentrated under reduced pressure and the residue was purified by preparative TLC (DCM/MeOH=50/1) to give the title compound (100 mg, 21%) as a white solid. LCMS-D: R.sub.t 2.22 min, m/z 353.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.6 (s, 1H), 7.62 (m, 1H), 7.56 (t, J=8.3 Hz, 1H), 7.18 (d, J=8.4 Hz, 1H), 7.04 (d, J=8.5 Hz, 1H), 7.00-6.92 (m, 1H), 6.84 (d, J=8.0 Hz, 1H), 3.85 (s, 3H), 3.80 (s, 3H).

Example 213: 2-Hydroxy-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 213

[0716] ##STR00330##

[0717] A mixture of 2-fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212 (20 mg, 0.06 mmol), (6-methoxypyridin-3-yl)methanol (50.1 mg, 0.36 mmol) and t-BuOK (20.2 mg, 0.18 mmol) in NMP (1 mL) was heated at 120° C. for 16 h. LCMS analysis indicated that only the F hydrolysis product had formed. The mixture was adjusted to pH<4 with aq. HCl, diluted with water and extracted with EtOAc. The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The procedure was repeated with another batch of 2-fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212 (52 mg, 0.15 mmol), the two crude products were combined and purified by prep. TLC (EtOAc/Pet. ether=1/13 then DCM/MeOH=50/1 to 100/1) to give the title compound (135 mg, 19%) as a white solid. LCMS-D: R.sub.t 2.39 min; m/z 350.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.2 (s, 1H), 7.57 (t, J=8.4 Hz, 1H), 7.41 (t, J=8.4 Hz, 1H), 7.16 (d, J=8.4 Hz, 1H), 6.84 (d, J=8.0 Hz, 1H), 6.60-6.56 (m, 2H), 3.91 (s, 3H), 3.75 (s, 3H).

Example 214: 2-Methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)-6-(methylamino)benzenesulfonamide 214

[0718] ##STR00331##

[0719] A solution of 2-fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212 (30 mg, 0.085 mmol), methylamine HCl (23 mg, 0.34 mmol) and Et.sub.3N (52 mg, 0.51 mmol) in ethanol (3 mL) was heated at 120° C. in a sealed tube overnight. The mixture was concentrated under reduced pressure and the residue was purified by prep. TLC (DCM) to give the title compound (4 mg, 13%) as a yellow solid. LCMS-D: R.sub.t 2.49 min; m/z 364.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.56 (t, J=8.0 Hz, 1H), 7.30 (t, J=8.0 Hz, 1H), 7.14 (d, J=8.0 Hz, 1H), 6.84 (d, J=8.0 Hz, 1H), 6.33 (d, J=8.0 Hz, 1H), 6.24 (d, J=8.0 Hz, 1H), 3.94 (s, 3H), 3.70 (s, 3H), 2.79 (s, 3H).

Example 215: 2-(Cyclopropylmethoxy)-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 215

[0720] ##STR00332##

[0721] To a solution of 2-fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212 (30 mg, 0.08 mmol) in THF (4 mL) was added t-BuOK (27 mg, 0.24 mmol) followed by cyclopropylmethanol (17 mg, 0.24 mmol) and the mixture was heated at 50° C. overnight. The mixture was diluted with water and extracted with EtOAc (20 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (Pet. ether/EtOAc=1/1) to give the title compound (4.4 mg, 13%) as a grey solid. LCMS-D: R.sub.t 2.54 min, m/z 405.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.33 (s, 1H), 7.57 (t, J=8.0 Hz, 1H), 7.48 (t, J=8.0 Hz, 1H), 7.15 (d, J=8.4 Hz, 1H), 6.85 (d, J=8.0 Hz, 1H), 6.77-6.75 (m, 2H), 3.91 (s, 3H), 3.89 (d, J=6.8 Hz, 2H), 3.77 (s, 3H), 0.86-0.83 (m, 1H), 0.43-0.24 (m, 4H).

Example 216: 2-Methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)-6-((2-methoxypyridin-4-yl)methoxy)benzenesulfonamide 216

[0722] ##STR00333##

[0723] To a solution of 2-fluoro-6-methoxy-N-(4-methoxybenzo[d]isoxazol-3-yl)benzenesulfonamide 212 (30 mg, 0.08 mmol) in NMP (3 mL) was added t-BuOK (48 mg, 0.43 mmol) followed by (2-methoxypyridin-4-yl)methanol (118 mg, 0.85 mmol) and the mixture was stirred at RT for 6 h. The mixture was diluted with water, adjusted to pH 5-6 with 1 M aq. HCl and extracted with EtOAc (20 mL×3). The combined organic extracts were washed with brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=40/1) to give the title compound (5 mg, 12%) as a yellow solid. LCMS-D: R.sub.t 2.43 min, m/z 472.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.65 (s, 1H), 8.07 (d, J=5.2 Hz, 1H), 7.51-7.39 (m, 2H), 7.07-6.98 (m, 3H), 6.79-6.75 (m, 3H), 5.22 (s, 2H), 3.84 (s, 3H), 3.83 (s, 3H), 3.81 (s, 3H).

Examples 217-222 (Table G)

[0724]

TABLE-US-00011 TABLE G The following examples were synthesised according to the methods described for 215 or 216. Varitaions of conditions have been noted in the table. Name and R-OH structure Analytical Method Note 217 Iso- propan- ol [00334]   2-Isopropoxy-6- methoxy-N-(4- methoxybenzo[d] isoxazol-3- LCMS-C: R.sub.t 2.18 min, m/z 393.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.13 (s, 1H), 7.58 (t, J = 8.0 Hz, 1H), 7.49 (t, J = 8.0 Hz, 1H), 7.17 (d, J = 8.0 Hz, 1H), 6.87 (d, J = 8.0 Hz, 1H), 6.79-6.75 (m, 2H), 4.75-4.65 (m, 1H), 3.95 (s, 3H), 3.80 (s, 3H), 1.17 (d, J = 6.0 Hz, 6H). As for Example 216 120° C., 16 h; Ratio of fluoride/base/ R-OH 1:3:3 yl)benzenesulfon- amide 218 Ethanol [00335]   2-Ethoxy-6- methoxy-N-(4- methoxybenzo[d] isoxazol-3- LCMS-C: R.sub.t 2.03 min, m/z 379.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.13 (s, 1H), 7.58(t, J = 8.0 Hz, 1H), 7.50 (t, J = 8.0 Hz, 1H), 7.17 (d, J = 8.0 Hz, 1H), 6.86 (d, J = 8.0 Hz, 1H), 6.78 (d, J = 8.0 Hz, 2H), 4.01 (q, J = 7.2 Hz, 2H), 3.94 (s, 3H), 3.76 (s, 3H), 1.12 (t, J = 7.2 Hz, 3H). As for Example 216 120° C., 16 h; Ratio of fluoride/base/ R-OH 1:3:3 yl)benzenesulfon- amide 219 [00336] [00337] LCMS-D: R.sub.t 0.31 min, m/z 408.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.0 (s, 1H), 7.61-7.45 (m, 4H), 7.15 (d, J = 8.4 Hz, 1H), 7.83-6.74 (m, 3H), 4.51 (s, 2H), 3.83 (s, 3H), 3.77 (s, 3H). As for Example 216 120° C., 16 h; Ratio of fluoride/base/ R-OH 1:6:10; Eluent: DCM/ MeOH = 80/1 2-(3-Methoxy-2- (N-(4- methoxybenzo[d] isoxazol-3- yl)sulfamoyl) phenoxy)acetamide 220 [00338] [00339]   2-(2- LCMS-D: R.sub.t 2.11 min, m/z 395.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.70 (s, 1H), 7.57-7.48 (m, 2H), 7.15 (d, J = 8.4 Hz, 1H), 6.84-6.80 (m, 3H), 5.10 (br s, 1H), 4.06 (t, J = 5.0 Hz, 2H), 3.90 (s, 3H), 3.80 (s, 3H), 3.63 (t, J = 5.0 Hz, 2H). As for Example 216 RT o/n then 80° C., 16 h; ratio of fluoride/base/ R-OH 1:6:10; Eluent: DCM/ MeOH = 60/1 Hydroxyethoxy)- 6-methoxy-N-(4- methoxybenzo[d] isoxazol-3- yl)benzenesulfon- amide 221 [00340] [00341]   2-Methoxy-N-(4- LCMS-D: R.sub.t 2.25 min, m/z 445.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.62 (s, 1H) 7.54 (t, J = 8.4 Hz, 1H), 7.46 (t, J = 8.4 Hz, 1H), 7.40 (s, 1H), 7.12 (d, J = 8.4 Hz, 1H), 6.86 (d, J = 8.4 Hz, 1H), 6.81 (d, J = 8.0 Hz, 1H), 6.76 (d, J = 8.4 Hz, 1H), 5.04 (s, 2H), 3.86 (s, 3H), 3.75 (s, 3H), 3.73 (s, 3H). As for Example 215 50° C., 16 h; Ratio of fluoride/base/ R-OH 1:3:3 methoxybenzo[d] isoxazol-3-yl)-6- ((1-methyl-1H- pyrazol-4- yl)methoxy)benzene- sulfonamide 222 [00342] [00343] LCMS-D: R.sub.t 2.67 min, m/z 441.1 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.51-7.43 (m, 4H), 7.36- 7.30 (m, 3H), 7.05 (d, J = 8.4 Hz, 1H), 6.79-6.72 (m, 3H), 5.25 (s, 2H), 3.89 (s, 3H), 3.75 (s, 3H). As for Example 215 50° C., 16 h; Ratio of fluoride/base/ R-OH 1:3:3 2-(Benzyloxy)-6- methoxy-N-(4- methoxybenzo[d] isoxazol-3- yl)benzenesulfon- amide

Example 223: 2,6-Dimethoxy-N-(4-nitrobenzo[d]isoxazol-3-yl)benzenesulfonamide 223

[0725] ##STR00344##

[0726] To a solution of 4-nitrobenzo[d]isoxazol-3-amine I10 (478 mg, 2.63 mmol) in THF (9 mL) at −78° C. under nitrogen was added LiHMDS (1 M solution in THF, 5.30 mL, 5.30 mmol) and the mixture was stirred at −78° C. for 3 h. 2,6-Dimethoxysufonyl chloride I111 (1.25 g, 5.27 mmol) was then added and the mixture was allowed to warm to RT and stirred overnight. The reaction was quenched with water and the mixture was extracted with EtOAc (80 mL×3). The combined organic extracts were washed with water (100 mL×3), brine (50 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=1/0 to 50/1) to give the title compound (108 mg, 11%) as a yellow solid. LCMS-D: R.sub.t 2.23 min; m/z 380.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 10.2 (s, 1H), 8.19 (d, J=8.4 Hz, 2H), 7.92 (t, J=8.4 Hz, 1H), 7.79 (d, J=8.4 Hz, 1H), 6.79 (d, J=8.4 Hz, 2H), 3.71 (s, 6H).

Example 224: N-(4-Aminobenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 224

[0727] ##STR00345##

[0728] To a solution of 2,6-dimethoxy-N-(4-nitrobenzo[d]isoxazol-3-yl)benzenesulfonamide 223 (70.0 mg, 0.18 mmol) in EtOAc (30 mL) was added 10% Pd/C (40.0 mg) and the mixture was stirred at RT overnight under a hydrogen atmosphere. The catalyst was removed by filtration, rinsed with EtOAc and the filtrate was concentrated under reduced pressure. The procedure was repeated on an additional batch of 2,6-dimethoxy-N-(4-nitrobenzo[d]isoxazol-3-yl)benzenesulfonamide 223 (30 mg, 0.079 mmol) and the crude products were combined and purified twice by prep. TLC (DCM/MeOH=50/1) and twice by prep. HPLC to give the title compound (2.5 mg, 3%) as a white solid. LCMS-D: R.sub.t 2.25 min; m/z 350.1 [M+H].sup.+. .sup.1H NMR (400 MHz, FDMSO-d.sub.6) δ 7.52 (t, J=8.4 Hz, 1H), 7.25 (t, J=8.0 Hz, 1H), 6.80 (d, J=8.4 Hz, 2H), 6.66 (d, J=8.0 Hz, 1H), 6.43 (d, J=8.0 Hz, 1H), 3.78 (s, 6H).

Example 225: N-(5-((1H-Pyrazol-1-yl)methyl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 225

[0729] ##STR00346## ##STR00347##

a) N-(5-Bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A49

[0730] To a solution of N-(5-bromobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 135 (8.2 g, 19.9 mmol), (2,4-dimethoxyphenyl)methanol (5.03 g, 29.9 mmol) and PPh.sub.3 (13.1 g, 49.9 mmol) in THF (400 mL) at 0° C. under nitrogen was added DIAD (8.06 g, 39.9 mmol) slowly dropwise and the mixture was stirred at RT overnight. The solvent was removed under reduced pressure and the residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 5/1) to give the title compound (4.7 g, 42%) as a white solid. LCMS-D: R.sub.t 3.39 min. m/z 583.1 [M+Na].sup.+

b) Methyl 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylate A50

[0731] A mixture of N-(5-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A49 (1.5 g, 2.67 mmol), Et.sub.3N (10 mL) and Pd(dppf)Cl.sub.2 (732 mg, 1 mmol) in MeOH (150 mL) was heated at 120° C. under a carbon monoxide atmosphere (20 bar) for 7 h. The reaction was repeated with 1.7 g N-(5-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A49 and 1.5 g N-(5-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A49 and the mixtures were combined and concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=100/1 to 3/1) to give the title compound (2.2 g, 49%) as a white solid. LCMS-D: R.sub.t 3.17 min, m/z 563.1 [M+Na].sup.+

c) 3-((N-(2,4-Dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylic acid A51

[0732] To a solution of methyl 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl) sulfonamido)benzo[d]isoxazole-5-carboxylate A50 (2.2 g, 4.07 mmol) in methanol (30 mL) was added 3 M aq. NaOH (20 mL) and the mixture was stirred at RT overnight. The mixture was adjusted to pH 1 with aq. HCl and the solvent was removed under reduced pressure. The residue was diluted with water (100 mL) and extracted with DCM (200 mL). The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (1.9 g, 89%) as a light yellow solid. LCMS-D: R.sub.t 2.99 min, m/z 549.1 [M+Na].sup.+.

d) N-(2,4-Dimethoxybenzyl)-5-ethyl-N-(5-(hydroxymethyl)benzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide A52

[0733] To a solution of 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido) benzo[d]isoxazole-5-carboxylic acid (800 mg, 1.52 mmol) A51 in THF (5 mL) at 0° C. under nitrogen was added BH.sub.3-THF (1 M solution in THF, 10 mL, 10 mmol) slowly dropwise and the mixture was allowed to warm to RT and stirred for 2 h. The mixture was cooled to 0° C. and the reaction was quenched by slow addition of methanol (20 mL). The solvent was removed under reduced pressure and the residue was diluted with water and extracted with DCM (200 mL). The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/0 to 40/1) to give the title compound (700 mg, 90%) as a white solid. LCMS-D: R.sub.t 2.99 min, m/z 513.1 [M+H].sup.+.

e) N-(5-((1H-Pyrazol-1-yl)methyl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A53

[0734] To a solution of N-(2,4-dimethoxybenzyl)-5-ethyl-N-(5-(hydroxymethyl) benzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide A52 (200 mg, 0.39 mmol) and Et.sub.3N (197 mg, 1.95 mmol) in DCM (10 mL) at 0° C. under nitrogen was added methanesulfonyl chloride (89 mg, 0.78 mmol) and the mixture was stirred at RT for 1.5 h then used in next step directly without workup and isolation. To a solution of pyrazole (133 mg, 1.95 mmol) in DMF (20 mL) at 0° C. under nitrogen was added t-BuOK (219 mg, 1.95 mmol) portion-wise and the mixture was stirred at RT for 1.5 h. The reaction mixture containing (3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido) benzo[d]isoxazol-5-yl)methyl methanesulfonate (assumed 0.39 mmol) was then added slowly and the resulting mixture was stirred at RT for 30 min. The mixture was diluted with water and extracted with EtOAc. The organic extract was washed with water (×3), brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=40/1) to give the title compound (60 mg, 27%) as a white solid. LCMS-D: R.sub.t 3.01 min. m/z 563.2 [M+H].sup.+.

f) N-(5-((1H-Pyrazol-1-yl)methyl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 225

[0735] A mixture of N-(5-((1H-pyrazol-1-yl)methyl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A53 (60 mg, 0.107 mmol) and TFA (5 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=20/1) to give the title compound (30 mg, 68%) as a white solid. LCMS-D: R.sub.t 6.03 min, m/z 412.5 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (s, 1H), 7.89 (s, 1H), 7.85 (d, J=2.0 Hz, 1H), 7.68 (d, J=2.0 Hz, 1H), 7.58-7.49 (m, 3H), 7.46 (dd, J=8.4, 2.0 Hz, 1H), 7.08 (d, J=8.8 Hz, 1H), 6.31 (t, J=2.0 Hz, 1H), 5.54 (s, 2H), 3.68 (s, 3H), 2.63 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 226: N-(5-(Aminomethyl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide trifluoroacetate 226

[0736] ##STR00348##

a) 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxamide A54

[0737] A mixture of 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido) benzo[d]isoxazole-5-carboxylic acid A51 (600 mg, 1.14 mmol) and thionyl chloride (5 mL) was heated at 85° C. for 1.5 h then concentrated under reduced pressure. The residue was dissolved in in DCM (3 mL) and added dropwise to conc. NH.sub.4OH (10 mL) at 0° C. and the mixture was stirred at RT for 30 min. Most of the solvent was removed under reduced pressure and the residue was diluted with water (20 mL). The resulting precipitate was collected by filtration, washed twice with water and dried to give the title compound (400 mg, 67%) as a light-yellow solid. LCMS-D: R.sub.t 2.86 min, m/z 526.2 [M+H].sup.+.

b) N-(5-(Aminomethyl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A55

[0738] A mixture of 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl) sulfonamido)benzo[d]isoxazole-5-carboxamide A54 (400 mg, 0.76 mmol) and BH.sub.3-THF (1 M solution in THF, 20 mL) was heated at 75° C. under nitrogen overnight. The mixture was then cooled to 0° C. and the reaction was quenched by slow addition of methanol (10 mL). The solvent was removed under reduced pressure and the residue was diluted with water and extracted with DCM (100 mL). The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/1 to 10/1) to give the title compound (150 mg, 39%) as a light-yellow solid, which was used directly in the next step.

c) N-(5-(Aminomethyl)benzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide trifluoroacetate 226

[0739] A mixture of N-(5-(aminomethyl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A55 (50 mg, 0.098 mmol) and TFA (5 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=10/1) to give the title compound (30 mg, 86%) as a white solid. LCMS-D: R.sub.t 1.93 min, m/z 362.1[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ11.8 (br s, 1H), 8.53 (br s, 3H), 8.11 (s, 1H), 7.83 (d, J=8.4 Hz, 1H), 7.70-7.68 (m, 2H), 7.48 (d, J=8.0 Hz, 1H), 7.12 (d, J=8.8 Hz, 1H), 4.13 (s, 2H), 3.71 (s, 3H), 2.64 (q, J=7.6 Hz, 2H), 1.17 (t, J=7.6 Hz, 3H).

Example 227: Methyl ((3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazol-5-yl)methyl) carbamate 227

[0740] ##STR00349##

a) Methyl ((3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazol-5-yl)methyl) carbamate A56

[0741] To a solution of N-(5-(aminomethyl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A55 (70 mg, 0.137 mmol) and Et.sub.3N (69 mg, 0.685 mmol) in DCM (20 mL) at 0° C. was added methyl chloroformate (39 mg, 0.411 mmol) dropwise and the mixture was stirred at RT for 20 min. The solvent was removed under reduced pressure and the residue was diluted with water and extracted with DCM. The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=100/0 to 40/1) to give the title compound (30 mg, 43%) as a white solid, which was used directly in the next step.

b) Methyl ((3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazol-5-yl)methyl) carbamate 227

[0742] A mixture of methyl ((3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido) benzo[d]isoxazol-5-yl)methyl)carbamate A56 (30 mg, 0.0558 mmol) and TFA (3 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=40/1) to give the title compound (15 mg, 64%) as a white solid. LCMS-D: R.sub.t 2.45 min, m/z 420.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (s, 1H), 7.91 (s, 1H), 7.79 (t, J=5.6 Hz, 1H), 7.69 (d, J=2.0 Hz, 1H), 7.55-7.43 (m, 3H), 7.09 (d, J=8.4 Hz, 1H), 4.29 (d, J=6.0 Hz, 2H), 3.73 (s, 3H), 3.58 (s, 3H), 2.63 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 228: N-((3-((5-Ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazol-5-yl)methyl)acetamide 228

[0743] ##STR00350##

a) N-((3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazol-5-yl)methyl)acetamide A57

[0744] To a solution of N-(5-(aminomethyl)benzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A55 (100 mg, 0.195 mmol) and Et.sub.3N (98 mg, 0.975 mmol) in DCM (10 mL) at 0° C. under nitrogen was added acetyl chloride (31 mg, 0.391 mmol) and the mixture was stirred at RT for 30 min. The mixture was diluted with water and extracted with DCM. The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (60 mg, 56%) as a white solid, which was used directly in the next step.

b) N-((3-((5-Ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazol-5-yl)methyl)acetamide 228

[0745] A mixture of N-((3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido) benzo[d]isoxazol-5-yl)methyl)acetamide A57 (60 mg, 0.108 mmol) and TFA (5 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=40/1) to give the title compound (30 mg, 68%) as a white solid. LCMS-D: R.sub.t 2.35 min, m/z 404.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.7 (br s, 1H), 8.55 (br s, 1H), 7.85 (s, 1H), 7.69 (s, 1H), 7.47-7.39 (m, 3H), 7.06 (d, J=7.2 Hz, 1H), 4.33 (d, J=3.6 Hz, 2H), 3.72 (s, 3H), 2.60 (q, J=6.8 Hz, 2H), 1.91 (s, 3H), 1.17 (t, J=6.8 Hz, 3H).

Example 229: 5-Ethyl-N-(5-(hydroxymethyl)benzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 229

[0746] ##STR00351##

a) Methyl 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylate A58

[0747] A mixture of methyl 3-((N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxyphenyl)sulfonamido) benzo[d]isoxazole-5-carboxylate A50 (435 mg, 0.8 mmol) and TFA (9 mL) was stirred at RT for 3 h then concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=2/1) to give the title compound (200 mg, 89%) as a light yellow solid. LCMS-D: R.sub.t 2.69 min, m/z 391.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.9 (br s, 1H), 8.82 (s, 1H), 8.18 (dd, J=9.2, 1.6 Hz, 1H), 7.72-7.70 (m, 2H), 7.48 (dd, J=8.8, 2.0 Hz, 1H), 7.10 (d, J=8.8 Hz, 1H), 3.90 (s, 3H), 3.71 (s, 3H), 2.64 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

b) 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylic acid A59

[0748] To a solution of methyl 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylate A58 (220 mg, 0.56 mmol) in THF/MeOH (10 mL/10 mL) was added 2 M aq. NaOH (1.4 mL, 2.8 mmol) and the mixture was stirred at RT overnight. The solvent was removed under reduced pressure and the residue was dissolved in water (10 mL) and the solution was adjusted to pH 2-3. The resulting precipitate was collected by filtration to give the title compound (180 mg, 85%) as a light yellow solid. LCMS-D: R.sub.t 2.51 min, m/z 377.2 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 13.2 (s, 1H), 11.86 (s, 1H), 8.78 (s, 1H), 8.16 (dd, J=8.8, 1.2 Hz, 1H), 7.71-7.66 (m, 2H), 7.47 (dd, J=8.4, 1.6 Hz, 1H), 7.10 (d, J=8.4 Hz, 1H), 3.70 (s, 3H), 2.63 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

c) 5-Ethyl-N-(5-(hydroxymethyl)benzo[d]isoxazol-3-yl)-2-methoxybenzenesulfonamide 229

[0749] A mixture of 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylic acid A59 (50 mg, 0.13 mmol) and BH.sub.3-THF (1 M solution in THF, 5 mL, 5 mmol) was stirred at RT for 5 h under nitrogen. The reaction was quenched with water (10 mL) and most of the THF was removed under reduced pressure. The aqueous residue was adjusted to pH 2-3 and extracted with DCM (15 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by column chromatography (DCM/MeOH=30/1) to give the title compound (30 mg, 62%) as a light yellow solid. LCMS-D: R.sub.t 2.46 min, m/z 363.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 7.98 (s, 1H), 7.69 (d, J=2.0 Hz, 1H), 7.53 (s, 2H), 7.46 (dd, J=8.4, 2.0 Hz, 1H), 7.10 (d, J=8.4 Hz, 1H), 5.35 (t, J=5.6 Hz, 1H), 4.59 (d, J=5.6 Hz, 2H), 3.72 (s, 3H), 2.63 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 230: 3-((5-Ethyl-2-methoxyphenyl)sulfonamido)-N-methylbenzo[d]isoxazole-5-carboxamide 230

[0750] ##STR00352##

[0751] A mixture of methyl 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylate A58 (50 mg, 0.13 mmol) and methylamine (33% solution in EtOH, 5 mL) was heated at 90° C. for 80 min in a sealed tube. The solvent was removed under reduced pressure and the residue was purified by prep. TLC to give the desired product (18 mg, 36%) as a light yellow solid. LCMS-D: R.sub.t 2.39 min, m/z 390.2[M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.8 (s, 1H), 8.53-8.51 (m, 2H), 8.03 (d, J=8.8 Hz, 1H), 7.69 (d, J=2.0 Hz, 1H), 7.62 (d, J=8.8 Hz, 1H), 7.42 (d, J=8.0 Hz, 1H), 7.06 (d, J=8.4 Hz, 1H), 3.69 (s, 3H), 2.81 (d, J=4.4 Hz, 3H), 2.62 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 231: 3-((5-Ethyl-2-methoxyphenyl)sulfonamido)-N,N-dimethylbenzo[d]isoxazole-5-carboxamide 231

[0752] ##STR00353##

[0753] A solution of 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxylic acid A59 (70 mg, 0.19 mmol) in thionyl chloride (10 mL) was heated at 85° C. for 3 h under nitrogen. The mixture was then concentrated under reduced pressure to give 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carbonyl chloride, which was dissolved in THF (2.5 mL) and treated with dimethylamine (40% solution in water, 5 mL). The mixture was stirred at RT overnight. Most of the THF was removed under reduced pressure and the aqueous residue was adjusted to pH 2-3. The precipitate was collected by filtration to give the title compound (60 mg, 80%) as a light-yellow solid. LCMS-D: R.sub.t 2.40 min, m/z 404.2 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 8.13 (s, 1H), 7.71-7.63 (m, 3H), 7.48 (dd, J=8.8, 2.0 Hz, 1H), 7.10 (d, J=8.8 Hz, 1H), 3.70 (s, 3H), 3.01 (s, 3H), 2.96 (s, 3H), 2.63 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 232: 3-((5-Ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxamide 232

[0754] ##STR00354##

[0755] To a solution of 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carbonyl chloride (63 mg, 0.16 mmol), prepared according to the procedure described for 3-((5-ethyl-2-methoxyphenyl)sulfonamido)-N,N-dimethylbenzo[d]isoxazole-5-carboxamide 231, in THF (2.5 mL) was added conc. NH.sub.4OH (5 mL) and the mixture was stirred at RT over a weekend. Most of the THF was removed under reduced pressure and the aqueous residue was adjusted to pH 2-3. The resulting precipitate was collected by filtration to give the title compound (37 mg, 62%) as a light-yellow solid. LCMS-D: R.sub.t 2.33 min, m/z 376.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.8 (s, 1H), 8.49 (s, 1H), 8.04 (d, J=7.6 Hz, 2H), 7.69 (d, J=2.4 Hz, 1H), 7.54 (d, J=8.4 Hz, 2H), 7.36 (d, J=6.8 Hz, 1H), 7.02 (d, J=8.4 Hz, 1H), 3.68 (s, 3H), 2.61 (q, J=7.6 Hz, 2H), 1.16 (t, J=7.6 Hz, 3H).

Example 233: N-(5-Cyanobenzo[d]isoxazol-3-yl)-5-ethyl-2-methoxybenzenesulfonamide 233

[0756] ##STR00355##

[0757] A solution of 3-((5-ethyl-2-methoxyphenyl)sulfonamido)benzo[d]isoxazole-5-carboxamide 232 (22 mg, 0.058 mmol) in POCl.sub.3 was heated at 110° C. overnight under nitrogen. The reaction was quenched with ice-water (25 mL) and the mixture was extracted with DCM (35 mL×2). The combined organic extracts were washed with water (50 mL×3), dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the title compound (19.8 mg, 90%) as a light-yellow solid. LCMS-D: R.sub.t 2.61 min, m/z 358.1 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 12.0 (s, 1H), 8.54 (s, 1H), 8.07 (d, J=8.8, 1.2 Hz, 1H), 7.86 (d, J=8.8 Hz, 1H), 7.73 (d, J=2.0 Hz, 1H), 7.49 (dd, J=8.4, 1.6 Hz, 1H), 7.11 (d, J=8.4 Hz, 1H), 3.70 (s, 3H), 2.65 (q, J=7.6 Hz, 2H), 1.17 (t, J=7.6 Hz, 3H).

Example 234: 5-Ethyl-2-methoxy-N-(5-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 234

[0758] ##STR00356##

a) N-(2,4-Dimethoxybenzyl)-5-ethyl-2-methoxy-N-(5-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide A60

[0759] A mixture of N-(5-bromobenzo[d]isoxazol-3-yl)-N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxybenzenesulfonamide A49 (112 mg, 0.2 mmol), methyl boronic acid (60 mg, 1 mmol), Pd(dppf)Cl.sub.2 (29 mg, 0.04 mmol) and K.sub.2CO.sub.3 (138 mg, 1 mmol) in 1,4-dioxane (10 mL) and water (2 mL) was heated at 90° C. under nitrogen overnight. The solvent was removed under reduced pressure and the residue was diluted with water (30 mL) and extracted with EtOAc (100 mL). The organic extract was washed with water, brine, dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (Pet. ether/EtOAc=3/1) to give the title compound (60 mg, 61%) as a white solid. LCMS-D: R.sub.t 2.72 min, m/z 347.2[M-DMB].sup.+.

b) 5-Ethyl-2-methoxy-N-(5-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 234

[0760] A mixture of N-(2,4-dimethoxybenzyl)-5-ethyl-2-methoxy-N-(5-methylbenzo[d]isoxazol-3-yl) benzenesulfonamide A60 (60 mg, 0.12 mmol) and TFA (5 mL) was stirred at RT for 4 h then concentrated under reduced pressure. The residue was purified by prep. TLC (Pet. ether/EtOAc=2/1) to give the title compound (30 mg, 71%) as a white solid. LCMS-D: R.sub.t 2.72 min, m/z 347.2 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.78 (s, 1H), 7.69 (d, J=2.0 Hz, 1H), 7.49-7.44 (m, 3H), 7.10 (d, J=8.4 Hz, 1H), 3.72 (s, 3H), 2.61 (q, J=7.6 Hz, 2H), 2.40 (s, 3H), 1.16 (t, J=7.6 Hz, 3H).

Examples 235-238 (Table H)

[0761]

TABLE-US-00012 TABLE H The following targets were prepared according to the procedure described for 5-ethyl-2-methoxy-N-(5-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 234 Starting Example materials Name and structure LCMS .sup.1H NMR 235 [00357] [00358]   5-Ethyl-N-(5- ethylbenzo[d]isoxazol- 3-yl)-2- methoxybenzenesulfon- amide LCMS-D: R.sub.t 2.84 min, m/z 361.1 [M + H].sup.+ .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 7.83 (s, 1H), 7.69 (s, 1H), 7.51-7.44 (m, 3H), 7.10 (d, J = 8.4 Hz, 1H), 3.74 (s, 3H), 2.74 (q, J = 7.6 Hz, 2H), 2.63 (q, J = 7.6 Hz, 2H), 1.24 (t, J = 7.6 Hz, 3H), 1.16 (t, J = 7.6 Hz, 3H). 236 [00359] [00360]   N-(5- Cyclopropylbenzo[d] isoxazol-3-yl)-5-ethyl-2- methoxybenzenesulfon- amide LCMS-D: R.sub.t 2.87 min, m/z 373.1 [M + H].sup.+ .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.5 (s, 1H), 7.70 (d, J = 2.8 Hz, 1H), 7.69 (s, 1H), 7.47 (d, J = 8.8 Hz, 2H), 7.38- 7.36 (m, 1H), 7.10 (d, J = 8.8 Hz, 1H), 3.74 (s, 3H), 2.63 (q, J = 7.6 Hz, 2H), 2.06-2.01 (m, 1H), 1.17 (t, J = 7.6 Hz, 3H), 1.02-0.96 (m, 2H), 0.68- 0.64 (m, 2H). 237 [00361] [00362]   5-Ethyl-2-methoxy-N- (5-(1-methyl-1H- pyrazol-4- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.57 min, m/z 413.1 [M + H].sup.+ .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.6 (s, 1H), 8.17 (s, 1H), 8.10 (s, 1H), 7.82-7.80 (m, 2H), 7.72 (d, J = 1.6 Hz, 1H), 7.60 (d, J = 8.8 Hz, 1H), 7.47 (dd, J = 8.4, 1.6 Hz, 1H), 7.11 (d, J = 8.8 Hz, 1H), 3.90 (s, 3H), 3.75 (s, 3H), 2.64 (q, J = 7.6 Hz, 2H), 1.16 (t, J = 7.6 Hz, 3H). 238 [00363] [00364]   5-Ethyl-2-methoxy-N- (5-(pyrimidin-5- yl)benzo[d]isoxazol-3- yl)benzenesulfonamide LCMS-D: R.sub.t 2.52 min, m/z 442.9 [M + H].sup.+ .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 11.8 (s, 1H), 9.24 (s, 1H), 9.14 (s, 2H), 8.44 (s, 1H), 8.09 (d, J = 8.8 Hz, 1H), 7.80-7.74 (m, 2H), 7.48 (d, J = 7.6 Hz, 1H), 7.12 (d, J = 8.8 Hz, 1H), 3.74 (s, 3H), 2.65 (q, J = 7.6 Hz, 2H), 1.17 (t, J = 7.6 Hz, 3H).

Examples 239-242 (Table I)

Method IA:

[0762] ##STR00365##

[0763] To a solution of the amine (0.2 mmol, 1.0 eq.) in pyridine (2 mL) was added the sulfonyl chloride (1.5 eq.) and the mixture was heated at 120° C. under microwave irradiation for 2 h. The mixture was partitioned between water and EtOAc, the layers were separated and the organic layer was washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC to give the title compound. Variations to above conditions have been noted in Table I.

TABLE-US-00013 TABLE I The following examples were synthesised according to the method IA. Variations of conditions have been noted in the table. Intermediates Ex Name and structure Analytical (if applicable) Method Notes 239 [00366]   N-(7-Bromo-5- methylbenzo[d]isoxazol-3-yl)-2,6- dimethoxybenzenesulfonamide LCMS-C: R.sub.t 2.45 min; m/z 427.0, 429.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.5 (s, 1H), 7.85 (s, 1H), 7.73 (s, 1H), 7.48 (t, J = 8.4 Hz, 1H), 6.75 (d, J = 8.4 Hz, 2H), 3.74 (s, 6H), 2.40 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 7-Bromo-5- methylbenzo[d] isoxazol-3-amine I132 IA 0.2 eq. DMAP used. Organic layer washed with 0.1 M aq. HCl in workup. Prep. TLC (DCM/MeOH, 20/1) 240 [00367]   2,6-Dimethoxy-N-(4-methoxy-6- ((2,2,2- LCMS-C: R.sub.t 2.33 min; m/z 476.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.59 (br s, 1H), 7.49 (s, 1H), 7.18-7.06 (m, 1H), 6.86-6.62 (m, 3H), 4.75 (s, 2H), 4.15-4.11 (m, 2H), 3.91 (s, 3H), 3.76 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 4-Methoxy-6- ((2,2,2- trifluoroethoxy) methyl)benzo[d] isoxazol-3-amine I118 IA 1 mL pyridine used. Prep. TLC (Pet. ether/EtOAc = 1/1) trifluoroethoxy)methyl)benzo[d] isoxazol-3-yl)benzenesulfonamide 241 [00368]   2,6-Dimethoxy-N-(5-methyl-6- LCMS-D: R.sub.t 3.32 min; m/z 426.0 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 11.4 (br s, 1H), 8.68 (d, J = 3.6 Hz, 1H), 7.96- 7.90 (m, 2H), 7.59- 7.43 (m, 4H), 6.76 (d, J = 8.4 Hz, 2H), 3.76 (s, 6H), 2.34 (s, 3H). 2,6-Dimethoxy benzenesulfonyl chloride I111 5-Methyl-6- (pyridin-2-yl) benzo[d]isoxazol- 3-amine I127 IA 5 mL pyridine used; 0.1 eq. DMAP used. Prep. TLC (Pet. ether/EtOAc = 1/1) (pyridin-2-yl)benzo[d]isoxazol-3- yl)benzenesulfonamide 242 [00369]   N-(6-(Difluoromethoxy)-4- methoxybenzo[d]isoxazol-3-yl)-2,6- dimethoxybenzenesulfonamide LCMS-C R.sub.t 2.13 min; m/z 430.9 [M + H].sup.+; .sup.1H NMR (400 MHz, DMSO- d.sub.6) δ 9.73 (br s, 1H), 7.52 (t, J = 8.4 Hz, 1H), 7.40 (t, J = 73.2 Hz, 1H), 7.04 (d, J = 1.6 Hz, 1H), 6.78 (d, J = 8.4 Hz, 2H), 6.69 (d, J = 1.6 Hz, 1H), 3.91 (s, 3H), 3.76 (s, 6H). 2,6-Dimethoxy benzenesulfonyl chloride I111 6- (Difluoromethoxy)- 4- methoxybenzo[d] isoxazol-3-amine I121 IA Heated for 1 h. Adjusted aqueous phase to pH 5 with 1 M aq. HCl in workup. Prep. TLC (DCM/MeOH = 50/1)

Example 243: N-(6-(3-Cyanophenyl)-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 243

[0764] ##STR00370##

[0765] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.113 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added (3-cyanophenyl)boronic acid (34 mg, 0.226 mmol), Na.sub.2CO.sub.3 (36 mg, 0.339 mmol) and Pd(PPh.sub.3).sub.4 (14 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 4-5 with 1 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=100/1) to give the title compound (24 mg, 46%) as a white solid. LCMS-C: R.sub.t 2.44 min, m/z 466.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.70 (s, 1H), 8.34 (s, 1H), 8.16 (d, J=7.5 Hz, 1H), 7.90 (d, J=7.7 Hz, 1H), 7.70 (t, J=7.8 Hz, 1H), 7.57 (s, 1H), 7.51 (t, J=8.4 Hz, 1H), 7.19 (s, 1H), 6.79 (d, J=8.5 Hz, 2H), 4.03 (s, 3H), 3.78 (s, 6H).

Example 244: 2,6-Dimethoxy-N-(4-methoxy-6-methylbenzo[d]isoxazol-3-yl)benzenesulfonamide 244

[0766] ##STR00371##

[0767] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.113 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added methylboronic acid (14 mg, 0.226 mmol), Na.sub.2CO.sub.3 (36 mg, 0.339 mmol) and Pd(PPh.sub.3).sub.4 (14 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 4-5 with 1 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. HPLC to give the title compound (8 mg, 19%) as a white solid. LCMS-C: R.sub.t 2.18 min, m/z 379.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.45 (s, 1H), 7.49 (t, J=8.5 Hz, 1H), 6.97 (s, 1H), 6.77 (d, J=8.5 Hz, 2H), 6.70 (s, 1H), 3.91 (s, 3H), 3.77 (s, 6H), 2.42 (s, 3H).

Example 245: 2,6-Dimethoxy-N-(4-methoxy-6-(pyridin-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 245

[0768] ##STR00372##

[0769] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.113 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added pyridin-4-ylboronic acid (28 mg, 0.226 mmol), Na.sub.2CO.sub.3 (36 mg, 0.339 mmol) and Pd(PPh.sub.3).sub.4 (14 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 4-5 with 1 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (22 mg, 44%) as a white solid. LCMS-C: R.sub.t 0.58 min, m/z 442.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.75 (s, 1H), 8.69 (d, J=5.3 Hz, 2H), 7.84 (d, J=5.3 Hz, 2H), 7.63 (s, 1H), 7.50 (t, J=8.4 Hz, 1H), 7.20 (s, 1H), 6.78 (d, J=8.5 Hz, 2H), 4.03 (s, 3H), 3.78 (s, 6H).

Example 246: 2,6-Dimethoxy-N-(4-methoxy-6-(pyridin-3-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 246

[0770] ##STR00373##

[0771] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.113 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added 3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine (47 mg, 0.226 mmol), Na.sub.2CO.sub.3 (36 mg, 0.339 mmol) and Pd(PPh.sub.3).sub.4 (14 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 4-5 with 1 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (9 mg, 18%) as a white solid. LCMS-C: R.sub.t 0.77 min, m/z 442.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.67 (s, 1H), 9.02 (d, J=2.5 Hz, 1H), 8.63 (dd, J=4.8, 1.6 Hz, 1H), 8.21 (dt, J=8.0, 2.0 Hz, 1H), 7.56 (s, 1H), 7.54-7.48 (m, 2H), 7.17 (s, 1H), 6.79 (d, J=8.5 Hz, 2H), 4.03 (s, 3H), 3.79 (s, 6H).

Example 247: 2,6-Dimethoxy-N-(4-methoxy-6-(6-methoxypyridin-3-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 247

[0772] ##STR00374##

[0773] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.113 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added (6-methoxypyridin-3-yl)boronic acid (35 mg, 0.226 mmol), Na.sub.2CO.sub.3 (36 mg, 0.339 mmol) and Pd(PPh.sub.3).sub.4 (14 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 4-5 with 1 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=60/1) to give the title compound (45 mg, 85%) as a white solid. LCMS-C: R.sub.t 2.33 min, m/z 472.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.61 (s, 1H), 8.63 (d, J=2.6 Hz, 1H), 8.15 (dd, J=8.7, 2.6 Hz, 1H), 7.51 (t, J=8.5 Hz, 1H), 7.47 (s, 1H), 7.10 (s, 1H), 6.94 (d, J=8.6 Hz, 1H), 6.79 (d, J=8.5 Hz, 2H), 4.02 (s, 3H), 3.91 (s, 3H), 3.79 (s, 6H).

Example 248: 2,6-Dimethoxy-N-(4-methoxy-6-(3-methoxy-5-methylphenyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 248

[0774] ##STR00375##

a) 2-(3-Methoxy-5-methylphenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane A61

[0775] A mixture of 1-bromo-3-methoxy-5-methylbenzene (500 mg, 2.49 mmol), 4,4,445,5,55octamethyl-2,2bi(1,3,2-dioxaborolane) (1.9 g, 7.49 mmol), potassium acetate (977 mg, 9.96 mmol) and Pd(dppf)Cl.sub.2 (196 mg, 0.25 mmol) in 1,4-dioxane (20 mL) was heated at reflux under N.sub.2 for 3 h. The mixture was diluted with EtOAc (300 mL), washed with water (50 mL×3) and the organic layer was dried over Na.sub.2SO.sub.4, filtered, concentrated under reduced pressure. The residue was purified by column chromatography (Pet. ether/EtOAc=20/1) to give the title compound (300 mg, 49%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.08 (s, 1H), 6.94 (d, J=2.6 Hz, 1H), 6.87 (s, 1H), 3.73 (s, 3H), 2.30-2.25 (m, 3H), 1.28 (s, 12H).

b) 2,6-Dimethoxy-N-(4-methoxy-6-(3-methoxy-5-methylphenyl)benzo[d]isoxazol-3-yl)benzenesulfonamide 248

[0776] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.11 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added 2-(3-methoxy-5-methylphenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane A61 (55 mg, 0.22 mmol), K.sub.2CO.sub.3 (61 mg, 0.44 mmol) and Pd(PPh.sub.3).sub.4 (13 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was adjusted to pH 4-5 with 1 M aqueous HCl and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. HPLC to give the title compound (4.3 mg, 8%) as a white solid. LCMS-C: R.sub.t 2.56 min, m/z 485.3 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.62 (s, 1H), 7.51 (t, J=8.5 Hz, 1H), 7.43 (s, 1H), 7.18 (s, 1H), 7.10 (s, 1H), 7.05 (s, 1H), 6.83 (s, 1H), 6.79 (d, J=8.5 Hz, 2H), 4.02 (s, 3H), 3.81 (s, 3H), 3.79 (s, 6H), 2.36 (s, 3H).

Example 249: 2,6-Dimethoxy-N-(4-methoxy-6-(2-methoxypyridin-4-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 249

[0777] ##STR00376##

[0778] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.11 mmol) in 1,4-dioxane (4 mL) and water (1 mL) was added (2-methoxypyridin-4-yl)boronic acid (33 mg, 0.22 mmol), Na.sub.2CO.sub.3 (35 mg, 0.33 mmol) and Pd(PPh.sub.3).sub.4 (13 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was poured into water and extracted with DCM. The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. HPLC to give the title compound (5 mg, 10%) as a white solid. LCMS-C: R.sub.t 2.29 min, m/z 472.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.71 (br s, 1H), 8.26 (d, J=5.4 Hz, 1H), 7.59 (s, 1H), 7.50 (t, J=8.5 Hz, 1H), 7.42 (dd, J=5.4, 1.6 Hz, 1H), 7.25 (s, 1H), 7.16 (s, 1H), 6.78 (d, J=8.5 Hz, 2H), 4.02 (s, 3H), 3.90 (s, 3H), 3.78 (s, 6H).

Example 250: 2,6-Dimethoxy-N-(4-methoxy-6-(5-methoxypyridin-3-yl)benzo[d]isoxazol-3-yl)benzenesulfonamide 250

[0779] ##STR00377##

[0780] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (50 mg, 0.11 mmol) in 1,4-dioxane (4 mL) and water (1 mL) was added 3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine (52 mg, 0.22 mmol), Na.sub.2CO.sub.3 (35 mg, 0.33 mmol) and Pd(PPh.sub.3).sub.4 (13 mg, 0.011 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was poured into water and extracted with DCM. The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. HPLC to give the title compound (5 mg, 10%) as a white solid. LCMS-C: R.sub.t 2.25 min, m/z 472.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.67 (s, 1H), 8.63 (s, 1H), 8.38 (d, J=2.7 Hz, 1H), 7.81-7.79 (m, 1H), 7.59 (s, 1H), 7.51 (t, J=8.5 Hz, 1H), 7.18 (s, 1H), 6.79 (d, J=8.5 Hz, 2H), 4.04 (s, 3H), 3.94 (s, 3H), 3.79 (s, 6H).

Example 251: N-(6-(3-Cyano-5-methoxyphenyl)-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 251

[0781] ##STR00378##

a) 3-Methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile A62

[0782] A mixture of 3-bromo-5-methoxybenzonitrile (500 mg, 2.35 mmol), 4,4,445,5,55 octamethyl-2,2-bi(1,3,2-dioxaborolane) (1.8 g, 7.07 mmol), potassium acetate (923 mg, 9.4 mmol) and Pd(dppf)Cl.sub.2.DCM (196 mg 0.24 mmol) was heated at reflux under N.sub.2 for 4 h. Water was added and the mixture was extracted with EtOAc (20 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (EtOAc/Pet. ether=1/5) to give the title compound (600 mg, 98%) as a yellow oil. LCMS-C: R.sub.t 2.66 min; m/z 260.0 [M+H].sup.+.

b) N-(6-(3-Cyano-5-methoxyphenyl)-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 251

[0783] To a solution of N-(6-bromo-4-methoxybenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 89 (415 mg, 0.94 mmol) in 1,4-dioxane (80 mL) and water (20 mL) was added 3-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile A62 (500 mg, 2.82 mmol), Na.sub.2CO.sub.3 (399 mg, 3.77 mmol) and Pd(PPh.sub.3).sub.4 (116 mg, 0.1 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was diluted with water and extracted with EtOAc. The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (DCM/MeOH=30/1) to give the title compound (40 mg, 8.6%) as a white solid. LCMS-C: R.sub.t 2.48 min, m/z 495.9 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 9.69 (br s, 1H), 7.89 (s, 1H), 7.67 (s, 1H), 7.57 (m, 1H), 7.49 (s, 2H), 7.15 (s, 1H), 6.77 (d, J=8.5 Hz, 2H), 4.02 (s, 3H), 3.90 (s, 3H), 3.77 (s, 6H).

Example 252: 2,6-Dimethoxy-N-(5-methyl-7-phenylbenzo[d]isoxazol-3-yl)benzenesulfonamide 252

[0784] ##STR00379##

[0785] To a solution of N-(7-bromo-5-methylbenzo[d]isoxazol-3-yl)-2,6-dimethoxybenzenesulfonamide 239 (50 mg, 0.117 mmol) in 1,4-dioxane (8 mL) and water (2 mL) was added phenylboronic acid (22 mg, 0.176 mmol), Na.sub.2CO.sub.3 (50 mg, 0.468 mmol) and Pd(PPh.sub.3).sub.4 (14 mg, 0.012 mmol) and the mixture was heated at reflux under a N.sub.2 atmosphere overnight. The mixture was diluted with water and extracted with EtOAc (30 mL×3). The combined organic extracts were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by prep. TLC (Pet. ether/EtOAc=3/1) to give the title compound (40 mg, 80%) as a white solid. LCMS-C: R.sub.t 2.49 min; m/z 425.0 [M+H].sup.+. .sup.1H NMR (400 MHz, DMSO-d.sub.6) δ 7.87-7.80 (m, 2H), 7.67-7.55 (m, 2H), 7.48 (t, J=7.7 Hz, 2H), 7.42-7.32 (m, 2H), 6.69 (d, J=8.4 Hz, 2H), 3.70 (s, 6H), 2.45 (s, 3H).

Assays

Protein Preparation

KAT5

Molecular Biology:

[0786] A codon optimized DNA sequence (for expression in Escherichia coli) encoding amino acid residues 2 to 461 (Uniprot Q92993-2) of human KAT5 isoform was synthesised by GenScript USA Inc (Piscataway, N.J., USA). This was ligated into a modified pET43a E. coli expression vector designed to encode an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage site and by the KAT5 sequence. The resulting protein sequence is listed below.

TABLE-US-00014 (SEQ ID NO: 1) MGHHHHHHGTENLYFQGSAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILS VKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGL PGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPG RKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECI ELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDL RHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDP FLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLL IEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGE RPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHE RAMLKRLLRIDSKCLHFTPKDWSKRGKWAS*

Protein Expression:

[0787] To produce recombinant KAT5 protein, expression plasmid was transformed into E. coli BL21 DE3 strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin and 50 μM zinc until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.

Protein Purification:

[0788] Protein purification was initiated by thawing the cell pellet (25 g wet weight) in Lysis buffer (50 mM Hepes pH 7.4, 500 mM NaCl, 5 mM imidazole, 5% [v/v]glycerol, 0.1% [w/v] CHAPS, 2 mM 2-mercaptoethanol, 3 mM MgCl.sub.2, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 6 mL of buffer per 1 g of cells. Cells were further lysed by sonication using a Misonix Liquid Processor (6×30 second pulses, amplitude 60 [70 watts]) and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was mixed with 20 mL of Q-Sepharose FF resin (GE Healthcare) pre-equilibrated with Q buffer (20 mM Hepes pH 7.4, 1 M NaCl). The unbound fraction from Q-Sepharose FF was then incubated with 5 mL of cOmplete His-Tag Purification Resin (Roche), pre-equilibrated with IMAC Wash Buffer (20 mM hepes pH 7.4, 500 mM NaCl, 35 mM imidazole). The resin was washed with IMAC Wash Buffer, and bound KAT5 eluted with IMAC Elution buffer (20 mM hepes pH 7.4, 500 mM NaCl, 300 mM imidazole). IMAC-eluted protein was immediately desalted into Storage buffer (50 mM Na citrate pH 6.5, 500 mM NaCl, 5% [v/v] glycerol) using 2×HiPrep 26/10 desalting columns (GE Healthcare) in series. Desalted protein was further purified by passing through a HiLoad 26/60 Superdex 75 column pre-equilibrated in Storage buffer. Finally, KAT5 protein was concentrated to 1.5 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.

KAT6A

Molecular Biology:

[0789] The DNA sequence encoding amino acid residues 507 to 778 (Uniprot Q92794-1) of human KAT6A was amplified by PCR and was ligated into a modified pET E. coli expression vector designed to encode a NusA solubility tag followed by a hexahistidine tag and a tobacco etch virus protease (TEV) cleavage site and by the KAT6A sequence. The resulting protein sequence is listed below.

TABLE-US-00015 (SEQ ID NO: 2) MNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQID RKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESV TFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNI SLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRS KPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGA CVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDE DKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQA EAHAAIDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDE PTVEALRERAKNALATIAQAQEESLGDNKPADDLLNLEGVDRDLAFKLAA RGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEATSGSG HHHHHHSAGENLYFQGAMGRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKL YLCEFCLKYMKSRTILQQHMKKCGWFHPPVNEIYRKNNISVFEVDGNVST IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKH CQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLG RLSYMAYWKSVILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRML DFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTP

Protein Expression:

[0790] To produce recombinant KAT6A protein, expression plasmid was transformed into E. coli BL21 DE3 strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.

Protein Purification:

[0791] Protein purification was initiated by thawing the cell pellet (40 g wet weight) in Lysis buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5 mM DTT, 0.01% [v/v] Triton-X 100, 5% [v/v] glycerol, 2 mM MgCl.sub.2, 10 mM Imidazole, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 5 mL of buffer per 1 g of cells. Cells were further lysed by 3 passes (at 15000 psi) through an ice cooled Avestin C5 cell crusher and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was filtered through a 5 μm filter and applied onto 5 mL HiTrap IMAC Sepharose FF column (GE Healthcare) pre-equilibrated with IMAC wash buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5 mM DTT, 0.01% [v/v] Triton-X 100, 5% [v/v] glycerol, 20 mM Imidazole) using a Profinia Affinity chromatography purification system (Bio-Rad). The IMAC column was then washed with IMAC Wash buffer and bound KAT6A protein eluted with IMAC Elution buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5% [v/v] glycerol, 5 mM DTT, 250 mM Imidazole). IMAC-eluted protein was further purified by passing through a HiLoad 26/60 Superdex 200 column pre-equilibrated in Storage buffer (25 mM Tris-HCl pH 7.8, 500 mM NaCl, 5 mM DTT, 5% [v/v]glycerol). Finally, KAT6A protein was concentrated to ≤1 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.

[0792] KAT6B was obtained from SignalChem, catalog ID: K315-381BG

KAT7

Molecular Biology:

[0793] A codon optimized DNA sequence encoding amino acid residues 325 to 611 (Uniprot O95251-1) of human KAT7 was synthesised by GenScript USA Inc (Piscataway, N.J., USA). This was ligated into a modified pET43a E. coli expression vector designed to encode an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage site and by the KAT7 sequence. The resulting protein sequence is listed below.

TABLE-US-00016 (SEQ ID NO: 3) MGHHHHHHGTENLYFQGSRLQGQITEGSNMIKTIAFGRYELDTWYHSPYP EEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISV FEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHL IGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGS PERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIV STLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWT PPKGTAS

Protein Expression:

[0794] To produce recombinant KAT7 protein, expression plasmid was transformed into E. coli BL21 DE3 RIL strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin and 50 μM zinc until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.

Protein Purification:

[0795] Protein purification was initiated by thawing the cell pellet (10 g wet weight) in Lysis buffer (50 mM Hepes pH 7.5, 300 mM NaCl, 5 mM DTT, 5 mM Imidazole, 0.05% [v/v] Brij 35, 10% [v/v] glycerol, 3 mM MgCl.sub.2, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 10 mL of buffer per 1 g of cells. Cells were further lysed by sonication using a Misonix Liquid Processor (6×30 second pulses, amplitude 60 [70 watts]) and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was incubated with 1 mL of cOmplete His-Tag Purification Resin (Roche), pre-equilibrated with IMAC Wash Buffer 1 (25 mM Hepes pH 7.5, 800 mM NaCl, 5 mM imidazole, 10% [v/v] glycerol, 5 mM DTT, 0.01% [v/v] Brij 35, 50 mM arginine, 50 mM glutamic acid). The resin was sequentially washed with IMAC Wash buffer 1 and IMAC Wash buffer 2 (25 mM hepes pH 7.5, 300 mM NaCl, 20 mM imidazole, 10% [v/v] glycerol, 5 mM DTT, 0.01% [v/v] Brij 35, 50 mM arginine, 50 mM glutamic acid). Bound KAT7 protein was eluted with IMAC Elution buffer (25 mM hepes pH 7.5, 200 mM NaCl, 500 mM imidazole, 10% [v/v] glycerol, 5 mM DTT 0.01% [v/v] Brij 35, 50 mM arginine, 50 mM glutamic acid). The eluting protein was collected directly into 4 volumes of Desalt Buffer (50 mM Na citrate pH 6.5, 200 mM NaCl, 0.01% [v/v] Brij 35, 10% [v/v] glycerol, 5 mM DTT) to bring the final imidazole concentration to 100 mM. IMAC-eluted protein was immediately desalted into Desalt buffer using 2× HiPrep 26/10 desalting columns (GE Healthcare) in series. Desalted protein was further purified by passing through a HiLoad 26/60 Superdex 75 column pre-equilibrated in Storage Buffer (50 mM Na citrate pH 6.5, 200 mM NaCl, 10% [v/v] glycerol, 5 mM DTT). Finally, KAT7 protein was concentrated to 3.5 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.

KAT8

Molecular Biology:

[0796] A codon optimized DNA sequence (for expression in E. coli) encoding amino acid residues 177 to 447 (Uniprot Q9H7Z6-1) of human KAT8 was synthesised by Thermo Fisher Scientific GENEART GmbH (Regensberg, Germany). This was ligated into pPROEX Hta E. coli expression vector designed to encode an N-terminal hexahistidine tag followed by a tobacco etch virus protease (TEV) cleavage site and by the KAT8 sequence. The resulting protein sequence is listed below.

TABLE-US-00017 (SEQ ID NO: 4) MSYYHHHHHHDYDIPTTENLYFQGAKYVDKIHIGNYEIDAWYFSPFPEDY GKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEV DGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGY FSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEK PLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQ SLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAP*

Protein Expression:

[0797] To produce recombinant KAT8 protein, expression plasmid was transformed into E. coli BL21 DE3 strain and grown with shaking at 37° C. in 1 L volumes of Terrific broth (TB) supplemented with 100 μg/mL Ampicillin until an OD600 of 0.8 was reached. Cultures were transferred to 18° C. and protein expression induced by the addition of Isopropyl β-D-1-thiogalactopyranoside to a final concentration of 0.5 mM and the cultures shaken overnight for further 16 hours. Following expression, cell cultures were centrifuged at 5000×g for 20 min and cell pellet stored frozen at −20° C.

Protein Purification:

[0798] Protein purification was initiated by thawing the cell pellet (34 g wet weight) in Lysis buffer (20 mM Hepes pH 7.5, 500 mM NaCl, 5 mM Imidazole, 5% [v/v]glycerol, 0.01% [v/v] Triton-X 100, 5 mM 2-mercaptoethanol, 2 mM MgCl.sub.2, 0.5 mg/mL lysozyme, benzonase endonuclease [EMD Millipore], 1 mM PMSF, complete protease inhibitor tablets EDTA-free [Roche]) using a ratio of 3 mL of buffer per 1 g of cells. Cells were further lysed by 3 passes (at 15000 psi) through an ice cooled Avestin C5 cell crusher and then centrifuged at 48,000×g at 4° C. Supernatant (cell lysate) was filtered through a 0.2 μm filter and applied onto 5 mL HiTrap IMAC Sepharose FF column (GE Healthcare) pre-equilibrated with IMAC wash buffer 1 (20 mM Hepes pH 7.5, 500 mM NaCl, 0.5 mM TCEP, 5 mM Imidazole) using a Profinia Affinity chromatography purification system (Bio-Rad). The IMAC column was then sequentially washed with IMAC Wash buffer 1 and IMAC Wash buffer 2 (20 mM Hepes pH 7.5, 500 mM NaCl, 0.5 mM TCEP, 10 mM Imidazole) and bound KAT8 protein eluted with IMAC Elution buffer (20 mM Hepes pH 7.5, 500 mM NaCl, 0.5 mM TCEP, 500 mM Imidazole). IMAC-eluted protein was further purified by passing through a HiLoad 26/60 Superdex 200 column pre-equilibrated in Storage buffer (20 mM Hepes pH 7.5, 500 mM NaCl, 1 mM TCEP). Finally, KAT8 protein was concentrated to 0.2 mg/mL using Amicon Ultra centrifugal filter unit (Utra-15 MWCO 10 kDa), flash-frozen in liquid nitrogen and stored in −70° C. freezer.

Acetyltransferase Biochemical Assay

[0799] To determine the inhibition of KAT enzymatic activity by test compounds, assay reactions were conducted in a volume of 8 μL in 384-well low volume assay plates. The reactions were performed in assay buffer (100 mM Tris-HCl, pH 7.8, 15 mM NaCl, 1 mM EDTA, 0.01% Tween-20, 1 mM Dithiothreitol, and 0.01% m/v chicken egg white albumin).

[0800] Reactions were set up with 1 μM Acetyl coenzyme A, 100 nM of full-length recombinant histone labelled by limited biotinylation (KAT6A, KAT6B, KAT7: H3.1, KAT5, KAT8: H4), 10/5/8/40/20 nM of KAT5/KAT6A/KAT6B/KAT7/KAT8 enzyme respectively, and an acetyl-lysine specific antibody (H3.1: Cell Signaling Technology, H4: Abcam). 11-point dilution series of the test compounds were prepared in DMSO; a volume of 100 nL was transferred using a pin tool into assay plates containing substrates, before adding enzyme to start the reaction. Positive (no compound, DMSO only) and negative (AcCoA omitted) control reactions were included on the same plates and received the same amount of DMSO as the compound treated wells. After adding all reagents, the plates were sealed with adhesive seals and incubated for 90 min at room temperature. An additional 4 μL of assay buffer containing AlphaScreen® Protein A acceptor beads and Streptavidin donor beads (PerkinElmer, Waltham, Mass.) to a final concentration of 8 μg/mL was then added. After incubation for 2 hours the plates were read using an EnVision 2103 multi label plate reader (PerkinElmer) in HTS AlphaScreen® mode. IC.sub.50 values were obtained from the raw readings by calculating percent inhibition (% I) for each reaction relative to controls on the same plate (% I=(I−CN)/(CP−CN) where CN/CP are the averages of the negative/positive reactions, respectively), then fitting the % I data vs. compound concentration [I] to % I=(A+((B−A)/(1+((C/[I]){circumflex over ( )}D)))) where A is the lower asymptote, E is the upper asymptote, C is the IC.sub.50 value, and D is the slope.

[0801] The results are shown in tables 1 to 5 below:

TABLE-US-00018 TABLE 1 (TIP60-KAT5) Example IC50 (μM) 1 >125.000 2 >125.000 3 =65.106 4 =35.221 5 =114.325 6 =94.934 7 >125.000 8 >125.000 9 =40.976 10 =93.664 11 >125.000 12 >125.000 13 =119.896 14 >125.000 15 =7.294 16 =30.179 17 =27.659 18 =118.055 19 =64.983 20 =81.458 21 >125.000 22 =38.877 23 =72.865 24 >125.000 25 =120.445 26 >125.000 27 >125.000 28 >125.000 29 >125.000 30 >125.000 31 >125.000 32 =56.003 33 =90.452 34 >125.000 35 =33.836 36 =38.979 37 >125.000 38 =80.086 39 >125.000 40 =121.024 41 =65.079 42 =11.568 43 =23.002 44 =60.208 45 =34.341 46 >125.000 47 =123.081 48 =92.895 49 =74.577 50 >125.000 51 =87.660 52 >125.000 53 >125.000 54 >125.000 55 >125.000 56 >125.000 57 >125.000 58 >125.000 59 >125.000 60 >125.000 61 =85.401 62 >125.000 63 >125.000 64 >125.000 65 >125.000 66 =123.371 67 =114.876 68 >125.000 69 =124.236 70 =36.766 71 =28.431 72 >125.000 73 =2.161 74 =8.132 75 =33.535 76 =2.578 77 =51.770 78 >125.000 79 =17.451 80 =10.913 81 =31.488 82 =8.247 83 =17.898 84 =50.464 85 =28.466 86 =97.635 88 >125.000 89 =5.785 90 =90.684 91 =2.183 92 =1.387 93 =53.063 94 =124.242 95 =13.967 96 =28.640 97 =6.181 98 =31.286 99 =9.699 100 =51.711 101 =98.204 102 =9.330 103 =69.326 104 =28.112 105 >125.000 106 =14.254 107 =74.084 108 =41.946 109 =69.262 110 >125.000 111 =26.608 112 =16.494 113 =4.836 114 =59.355 115 =23.660 116 =10.463 117 >125.000 118 =37.082 119 =8.726 120 =5.781 121 =29.010 122 =58.591 123 =59.355 124 =27.879 125 >125.000 126 =51.346 127 =49.699 128 =6.301 129 =18.536 130 >125.000 131 =69.740 132 =53.030 133 =45.717 134 =51.523 135 =4.788 136 >125.000 137 =14.209 138 =5.115 139 =34.292 140 =47.841 141 >125.000 142 =32.183 143 >125.000 144 =11.487 145 =20.967 146 =21.951 147 >125.000 148 >125.000 149 >125.000 150 =50.012 151 >125.000 152 =38.945 153 =4.055 154 =25.313 155 =0.672 156 >125.000 157 >125.000 158 >125.000 159 >125.000 160 =46.217 161 >125.000 162 =13.954 163 >125.000 164 >125.000 165 >125.000 166 =3.093 167 =32.157 168 =3.415 169 =63.197 170 =4.826 171 =4.374 172 =9.070 173 =4.050 174 =1.833 175 =43.215 176 =5.670 177 =7.082 178 =7.535 179 =32.129 180 =25.476 181 =23.827 182 =65.635 183 =33.231 184 >125.000 185 >125.000 186 =84.702 187 =65.279 188 =69.912 189 =31.983 190 =19.884 191 =68.651 192 =29.888 193 =53.125 194 =37.844 195 =16.708 196 =95.399 197 >125.000 198 =73.654 199 =14.892 200 =4.733 201 =21.848 202 =110.730 203 =74.251 204 =4.565 205 =3.729 206 =6.361 207 =4.605 208 =28.461 209 =28.674 210 >125.000 211 =7.931 212 =9.302 213 >125.000 214 >125.000 215 >125.000 216 =123.671 217 >125.000 218 >125.000 219 >125.000 220 >125.000 221 >125.000 222 =26.758 223 >125.000 224 >125.000 225 >125.000 226 =80.348 227 >125.000 228 =124.363 229 >125.000 230 >125.000 231 >125.000 232 >125.000 233 >125.000 234 =10.877 235 =9.044 236 =10.055 237 >125.000 238 >125.000 239 =17.373 240 =122.168 241 =26.350 242 =27.314 243 =18.076 244 =30.172 245 =57.554 246 =27.066 247 =96.592 248 =9.331 249 =69.187 250 =12.220 251 =46.983 252 =101.708

TABLE-US-00019 TABLE 2 (MOZ-KAT6A) Example IC50 (μM) 1 =91.387 2 =94.607 3 =23.759 4 =6.223 5 =31.283 6 =30.156 7 =62.687 8 =113.061 9 =26.816 10 =17.503 11 >125.000 12 >125.000 13 =63.854 14 =45.004 15 =1.907 16 =15.105 17 =11.820 18 =74.876 19 =32.241 20 =29.373 21 =24.799 22 =5.206 23 =21.776 24 >125.000 25 =33.179 26 =60.096 27 =71.527 28 =117.346 29 >125.000 30 =89.484 31 =36.075 32 =31.124 33 =6.847 34 >125.000 35 =4.632 36 =17.653 37 =24.848 38 =27.525 39 =38.220 40 =2.128 41 =4.274 42 =5.947 43 =5.971 44 =10.569 45 =2.085 46 =36.202 47 =12.863 48 =7.410 49 =8.133 50 =123.076 51 =15.032 52 =85.314 53 =90.683 54 =63.015 55 =103.246 56 =72.793 57 =56.212 58 =28.364 59 =49.410 60 =116.146 61 =51.918 62 =43.709 63 =2.558 64 =26.746 65 =27.934 66 =14.554 67 =22.711 68 =85.089 69 =42.890 70 =31.339 71 =11.578 72 =46.210 73 =4.547 74 =3.914 75 =23.533 76 =0.688 77 =10.814 78 =93.778 79 =13.890 80 =3.473 81 =43.616 82 =6.128 83 =13.571 84 =18.678 85 =3.866 86 =5.890 88 =41.205 89 =0.285 90 =4.779 91 =0.009 92 =0.006 93 =0.181 94 =6.105 95 =0.430 96 =1.203 97 =0.061 98 =5.602 99 =2.099 100 =0.972 101 =3.798 102 =0.143 103 =0.810 104 =0.786 105 =2.903 106 =0.782 107 =14.870 108 =3.089 109 =1.207 110 =7.890 111 =0.842 112 =1.463 113 =0.775 114 =29.278 115 =28.986 116 =0.560 117 =85.409 118 =10.003 119 =0.570 120 =0.310 121 =1.236 122 =24.400 123 =26.864 124 =11.011 125 =24.458 126 =10.472 127 =9.165 128 =0.250 129 =0.772 130 =2.956 131 =3.106 132 =7.454 133 =4.449 134 =6.449 135 =0.563 136 =34.274 137 =8.579 138 =2.892 139 =2.144 140 =2.256 141 =39.557 142 =3.296 143 =32.391 144 =0.261 145 =0.127 146 =0.153 147 =93.597 148 =23.965 149 =5.272 150 =4.966 151 =27.867 152 =6.276 153 =0.437 154 =0.516 155 =2.116 156 =1.535 157 =23.036 158 =62.560 159 =66.556 160 =1.048 161 =1.871 162 =0.147 163 =0.884 164 =27.173 165 =99.899 166 =0.123 167 =8.666 168 =10.006 169 =24.793 170 =1.504 171 =1.876 172 =0.037 173 =0.015 174 =0.013 175 =0.441 176 =0.030 177 =0.127 178 =1.440 179 =2.864 180 =9.437 181 =1.058 182 =15.217 183 =5.601 184 >125.000 185 =104.789 186 =25.161 187 =5.664 188 =9.228 189 =4.347 190 =9.733 191 =12.582 192 =9.394 193 =1.950 194 =1.507 195 =1.322 196 =13.919 197 =20.970 198 =2.818 199 =0.709 200 =0.364 201 =1.482 202 =18.907 203 =22.648 204 =0.400 205 =0.115 206 =0.302 207 =0.104 208 =1.629 209 =2.029 210 =8.532 211 =2.128 212 =2.117 213 =8.280 214 =36.431 215 =4.469 216 =0.625 217 =10.237 218 =6.594 219 =33.313 220 =3.497 221 =37.464 222 =0.655 223 =25.496 224 =50.368 225 =3.625 226 =10.774 227 =41.520 228 =75.246 229 =85.020 230 =48.075 231 =58.983 232 =46.464 233 =9.950 234 =0.381 235 =0.395 236 =0.318 237 =4.950 238 =12.039 239 =2.132 240 =1.828 241 =0.157 242 =3.232 243 =0.654 244 =2.126 245 =3.901 246 =0.676 247 =3.476 248 =0.139 249 =1.271 250 =0.423 251 =1.156 252 =4.160

TABLE-US-00020 TABLE 3 (HBO-KAT7) Example IC50 (μM) 1 =53.948 2 =15.521 3 =23.243 4 =5.168 5 =6.011 6 =6.277 7 =14.175 8 >125.000 9 =8.418 10 =54.053 11 =60.488 12 =49.922 13 =63.834 14 =15.174 15 =1.456 16 =9.635 17 =14.575 18 =34.064 19 =36.094 20 =41.258 21 =25.506 22 =6.300 23 =23.893 24 =33.854 25 =41.948 26 =34.465 27 =32.121 28 =54.786 29 =94.098 30 =11.481 31 =53.590 32 =14.923 33 =11.409 34 =31.493 35 =8.748 36 =26.267 37 =114.461 38 =6.698 39 =10.116 40 =19.929 41 =11.845 42 =8.384 43 =12.914 44 =10.794 45 =6.833 46 =74.439 47 =29.419 48 =54.767 49 =77.831 50 >125.000 51 =28.277 52 >125.000 53 >125.000 54 >125.000 55 >125.000 56 >125.000 57 >125.000 58 =16.607 59 >125.000 60 >125.000 61 >125.000 62 =70.618 63 =60.060 64 =105.707 65 =59.720 66 =113.991 67 >125.000 68 >125.000 69 =94.149 70 =32.029 71 =21.593 72 =11.413 73 =0.508 74 =1.665 75 =5.748 76 =0.937 77 =12.022 78 >125.000 79 =4.059 80 =1.129 81 =6.726 82 =1.496 83 =3.792 84 =20.038 85 =1.769 86 =1.981 88 =7.509 89 =0.168 90 =18.889 91 =0.079 92 =0.060 93 =2.799 94 =16.059 95 =0.754 96 =4.265 97 =0.444 98 =3.411 99 =5.739 100 =2.240 101 =32.782 102 =0.568 103 =5.928 104 =3.132 105 =63.160 106 =3.977 107 =11.732 108 =2.038 109 =4.067 110 =17.497 111 =4.536 112 =3.014 113 =0.914 114 =41.609 115 =95.520 116 =1.435 117 >125.000 118 =0.852 119 =1.146 120 =0.503 121 =5.211 122 =4.122 123 =4.198 124 =13.017 125 =85.834 126 =28.884 127 =9.487 128 =0.618 129 =1.318 130 =21.712 131 =23.780 132 =11.785 133 =5.342 134 =27.644 135 =1.426 136 =28.316 137 =6.558 138 =3.683 139 =10.043 140 =9.895 141 =24.336 142 =1.165 143 =7.883 144 =0.286 145 =0.259 146 =0.511 147 >125.000 148 =36.783 149 =9.432 150 =8.039 151 =25.571 152 =9.866 153 =0.507 154 =3.128 155 =0.248 156 =1.975 157 =15.514 158 =44.862 159 =37.620 160 =1.577 161 =2.506 162 =0.969 163 =13.103 164 =61.638 165 =30.654 166 =0.328 167 =6.854 168 =36.401 169 =8.646 170 =0.982 171 =0.292 172 =0.426 173 =0.169 174 =0.031 175 =5.949 176 =0.138 177 =0.021 178 =0.482 179 =13.481 180 =1.759 181 =5.137 182 =15.608 183 =4.480 184 =30.983 185 =60.714 186 =47.092 187 =21.961 188 =40.080 189 =8.016 190 =18.459 191 =1.576 192 =24.230 193 =15.518 194 =6.872 195 =4.963 196 =23.280 197 =45.687 198 =6.951 199 =0.632 200 =0.678 201 =0.773 202 =54.375 203 =23.360 204 =3.045 205 =0.936 206 =0.626 207 =0.257 208 =4.654 209 =1.054 210 =6.539 211 =0.917 212 =1.048 213 =20.519 214 >125.000 215 =16.630 216 =3.106 217 =18.406 218 =6.444 219 =60.688 220 =11.008 221 =63.721 222 =1.422 223 =43.526 224 >125.000 225 =31.135 226 =37.985 227 =63.139 228 >125.000 229 =115.218 230 =109.417 231 >125.000 232 >125.000 233 =17.872 234 =3.739 235 =0.820 236 =1.070 237 =18.016 238 =94.180 239 =3.003 240 =10.198 241 =2.510 242 =1.785 243 =0.720 244 =1.113 245 =2.761 246 =0.478 247 =5.897 248 =0.375 249 =0.889 250 =0.050 251 =0.473 252 =1.303

TABLE-US-00021 TABLE 4 (MOF-KAT8) Example IC50 (μM) 11 =35.565 18 =63.474 19 =40.985 20 =61.440 21 =39.655 26 =29.480 73 =3.459 81 =9.425 93 =96.545 94 =60.943 95 =6.447 96 =53.767 100 =62.604 102 =11.485 107 =42.081 109 =9.122 111 =3.221 132 =15.285 151 =34.717 154 =2.570 161 =117.753 162 =10.649 163 >125.000 164 >125.000 165 >125.000 166 =2.920 168 =6.458 170 =9.666 173 =3.522 178 =0.770 204 =3.063 205 =3.441 211 =29.532 214 >125.000 216 =11.172 219 =69.922 221 =27.895 223 =42.389 224 =112.662 236 =3.682

TABLE-US-00022 TABLE 5 (QKF-KAT6B) Example IC50 (μM) 73 =4.047 91 =0.037 92 =0.053 95 =1.640 96 =3.395 97 =0.049 102 =0.282 116 =1.616 143 =50.697 144 =0.057 146 =0.291 147 >125.000 162 =0.180 166 =0.227 172 =0.042 173 =0.040 174 =0.018 175 =0.821 176 =0.121 177 =0.092 178 =2.455 207 =1.454

Histone H3 Lysine 23 Acetylation Biomarker Assay

[0802] Compounds were tested for their ability to inhibit acetylation of the histone H3K23 marker in the following assay:

[0803] The cell line U2OS was seeded at a density of 9,000 cells per well in 96 well optical quality tissue culture plates in RPMI medium and 10% foetal bovine serum, and allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO2). At the end of this period the medium was aspirated. Compound dilutions prepared in DMSO were added to medium, with negative control wells reserved for treatment with DMSO only and 100% inhibition positive controls receiving a potent inhibitor compound (e.g. cas 2055397-28-7, benzoic acid, 3-fluoro-5-(2-pyridinyl)-, 2-[(2-fluorophenyl)sulfonyl]hydrazide) (Baell, J., Nguyen, H. N., Leaver, D. J., Cleary, B. L., Lagiakos, H. R., Sheikh, B. N., Thomas. T. J., Aryl sulfonohydrazides, WO2016198507A1, 2016) at 10 μM concentration and 200 μL transferred to the cells. After incubation for 24 hours, the cells were fixed with 3.7% formaldehyde in PBS for 20 minutes at room temperature, washed (5×5 minutes) with phosphate buffer saline containing 0.1% Tween 20 and blocked with Odyssey blocking buffer (LI-COR, Lincoln, Nebr.) containing 0.1% TritonX100. Anti-H3K23ac specific antibody (Abcam ab177275) in Odyssey blocking buffer containing 0.1% Tween 20 was added and incubated for 16 hours at 4 degree Celsius. After washing (as above), a secondary antibody labelled with Alexa647 dye (LifeTechnologies) and Hoechst 33342 (1 μg/mL, SigmaAldrich) were added for 1 hour incubation. Plates were washed as previously and read on a PerkinElmer Phenix high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the Alexa647-related intensity in the same area. The resulting mean intensity per cell was directly converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC50).

[0804] The results are shown in table 6 below:

TABLE-US-00023 TABLE 6 Example IC50 (μM) 73 >10.000 86 =1.579 91 =0.182 92 =0.013 95 >10.000 96 >10.000 97 =0.045 116 =3.455 144 =0.128 145 =0.098 146 =0.045 147 >10.000 155 >10.000 162 =0.144 166 =0.398 172 =0.014 173 =0.020 174 =0.017 176 =0.685 177 =1.486 178 >10.000 191 >10.000 242 =0.672 250 =3.713

Histone H3 Lysine 14 Acetylation Biomarker Assay

[0805] Compounds were tested for their ability to inhibit acetylation of the histone H3 Lysine 14 marker in the following assay:

[0806] The cell line U2OS was seeded at a density of 3,000 cells per well in 384-well optical quality tissue culture plates in RPMI medium supplemented with 10% foetal bovine serum and 10 mM Hepes. The cells were allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO2). At the end of this period the cells were washed with serum free medium. Compound dilutions prepared in DMSO were added to the serum free medium, with negative control wells reserved for treatment with DMSO only and 100% inhibition positive controls receiving a potent inhibitor compound (e.g. (Z)-4-fluoro-N-((3-hydroxyphenyl)sulfonyl)-5-methyl-[1,1biphenyl]-3-carbohydrazonic acid) at 10 μM concentration. After incubation for 24 hours, the cells were fixed with 4% formaldehyde in PBS for 15 minutes at room temperature, washed with phosphate buffer saline and blocked with blocking buffer containing 0.2% TritonX100 and 2% BSA. Anti-H3K14ac specific antibody (Cell Signalling Technologies) in blocking buffer was added and incubated overnight at 4 degree Celsius. After washing, a secondary antibody labelled with AlexaFluor 488 dye (ThermoFisher) and Hoechst 33342 (1 μg/mL, Life Technologies) were added for 2 hours incubation at room temperature. Plates were washed and read on a PerkinElmer Opera HCS high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the AlexaFluor 488-related intensity in the same area. The resulting mean intensity per cell was converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC50).

[0807] The results are shown in table 7 below:

TABLE-US-00024 TABLE 7 Example IC50 (μM) 73 =12.451 74 =31.675 75 >40.000 80 =11.511 82 =12.600 89 =3.957 91 =0.874 92 =0.703 95 =9.089 97 =1.093 102 =3.686 144 =2.954 145 =3.383 146 =2.304 147 >40.000 155 =26.130 162 =1.527 163 =20.356 166 =3.686 171 =2.574 172 =1.453 173 =0.533 174 =0.068 176 =1.071 177 =0.135 178 =3.068 191 =17.835 211 >40.000 212 =10.347 218 >40.000 236 >40.000 250 =3.482 252 =24.719

H2A.Z Lysine 7 Acetylation Biomarker Assay

[0808] Compounds were tested for their ability to inhibit the histone H2A.Z Lysine 7 acetylation marker in the following assay:

[0809] The cell line U2OS was seeded at a density of 3,000 cells per well in 384-well optical quality tissue culture plates in RPMI medium supplemented with 10% foetal bovine serum and 10 mM Hepes. The cells were allowed to adhere for 24 hours under standard culture conditions (37 degree Celsius, 5% CO.sub.2). At the end of this period the cells were washed with serum free medium. Compound dilutions prepared in DMSO were added to the serum free medium, with negative control wells reserved for treatment with DMSO only and 100% inhibition positive controls receiving a potent inhibitor compound enantiomer 1 of 7-iodo-N-(2-(oxazol-2-yl)-2-phenylethyl)-2H-benzo[e][1,2,4]thiadiazine-3-carboxamide 1,1-dioxide, which is compound 146 of co-pending application GB1713962.7, filed on 31 Aug. 2018, at 30 μM concentration. After incubation for 24 hours, the cells were fixed with 4% formaldehyde in PBS for 15 minutes at room temperature, washed with phosphate buffer saline and blocked with blocking buffer containing 0.2% TritonX100 and 2% BSA. Anti-H2A.ZK7ac specific antibody (Abcam) in blocking buffer was added and incubated overnight at 4 degree Celsius. After washing, a secondary antibody labelled with AlexaFluor 488 dye (ThermoFisher) and Hoechst 33342 (1 μg/mL, Life Technologies) were added for 2 hours incubation at room temperature. Plates were washed and read on a PerkinElmer Opera HCS high content imaging platform. Using a Columbus image analysis pipeline, individual nuclei were located by Hoechst 33342 stain and the acetylation level was calculated from the AlexaFluor 488-related intensity in the same area. The resulting mean intensity per cell was converted to percent inhibition relative to controls on the same plate and the data fitted against a four-parameter logistic model to determine the 50% inhibitory concentration (IC.sub.50).

[0810] The results are shown in table 8 below:

TABLE-US-00025 TABLE 8 Example IC50 (μM) 73 =36.725 89 =19.816 91 =8.022 92 =4.619 95 >40.000 97 =27.988 102 >40.000 144 =18.752 145 >40.000 146 =15.065 147 >40.000 155 >40.000 162 =29.540 166 =33.304 168 >40.000 172 =29.159 173 =26.225 174 =1.544 176 =7.612 177 =1.088 178 =5.589 191 >40.000 234 >40.000 236 >40.000 250 =13.197 252 >40.000

STATEMENTS OF INVENTION

[0811] 1. A compound of formula (I), or a pharmaceutically acceptable salt thereof, for use in a method of therapy:

##STR00380##

wherein R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are independently selected from: [0812] (i) H; [0813] (ii) C.sub.1-3 alkyl, optionally substituted by: [0814] hydroxy, [0815] C.sub.1-2 alkoxy, optionally substituted by one or more fluoro groups, [0816] NH.sub.2, [0817] phenyl, [0818] C.sub.5-6 heteroaryl, [0819] C.sub.1-4 alkyl carbamoyl, [0820] acylamido, or [0821] one or more fluoro groups; [0822] (iii) C.sub.1-3 alkoxy, optionally substituted by C.sub.3-6 cycloalkyl or by one or more fluoro groups; [0823] (iv) C.sub.3-6 cycloalkyl; [0824] (v) halo; [0825] (vi) COR.sup.C, where R.sup.C is selected from NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and methyl; [0826] (vii) cyano, NH.sub.2, or NO.sub.2; and [0827] (viii) phenyl or C.sub.5-6 heteroaryl, optionally substituted by methyl, cyano, hydroxy or methoxy;

[0828] Ar is a phenyl, napthyl or C.sub.5-10 heteroaryl group, which groups are optionally substituted by one or more groups selected from: [0829] (i) C.sub.1-4 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, C.sub.1-4alkyl carbamoyl, or by one or more fluoro groups; [0830] (ii) C.sub.3-6 cycloalkyl; [0831] (iii) hydroxy; cyano; NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl; or acylamido; [0832] (iv) halo; [0833] (v) C.sub.1-3 alkoxy, optionally substituted by hydroxy, C(O)NH.sub.2, C.sub.3-6 cycloalkyl, phenyl, C.sub.5-6 heteroaryl, or by one or more fluoro groups; [0834] (vi) phenoxy, optionally substituted by fluoro; [0835] (vii) phenyl or C.sub.5-6 heteroaryl; [0836] (viii) SF.sub.5 or SO.sub.2CH.sub.3; [0837] (ix) —(CH.sub.2).sub.n—Y—, where Y is O or CH.sub.2, and n is 2 or 3; or [0838] (x) C.sub.1-4 alkyl ester.
2. A compound for use according to statement 1, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is H.
3. A compound for use according to either statement 1 or statement 2, wherein one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H.
4. A compound for use according to either statement 1 or statement 2, wherein two of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H.
5. A compound for use according to either statement 1 or statement 2, wherein three of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H.
6. A compound for use according to either statement 1 or statement 2, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is not H.
7. A compound for use according to any one of statements 1 to 6, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.1-3 alkyl, optionally substituted by: [0839] hydroxy, [0840] C.sub.1-2 alkoxy, optionally substituted by one or more fluoro groups, [0841] NH.sub.2, [0842] phenyl, [0843] C.sub.5-6 heteroaryl, [0844] C.sub.1-4 alkyl carbamoyl, [0845] acylamido, or [0846] one or more fluoro groups.
8. A compound for use according to statement 7, wherein the C.sub.1-3 alkyl group is unsubstituted.
9. A compound for use according to statement 7, wherein the C.sub.1-3 alkyl group is perfluorinated.
10. A compound for use according to statement 7, wherein the C.sub.1-3 alkyl group is substituted, by a group selected from: [0847] (i) hydroxy; [0848] (ii) C.sub.1-2 alkoxy; [0849] (iii) NH.sub.2; [0850] (iv) phenyl; [0851] (v) C.sub.5-6 heteroaryl; [0852] (vi) C.sub.1-4 alkyl carbamoyl; and [0853] (vii) acylamido.
11. A compound for use according to any one of statements 1 to 10, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.1-3 alkoxy, optionally substituted by C.sub.3-6 cycloalkyl or by one of more fluoro groups.
12. A compound for use according to statement 11, wherein the C.sub.1-3 alkoxy group is unsubstituted.
13. A compound for use according to statement 11, wherein the C.sub.1-3 alkoxy group is perfluorinated.
14. A compound for use according to statement 11, wherein the C.sub.1-3 alkoxy group is substituted by C.sub.3-6 cycloalkyl.
15. A compound for use according to any one of statements 1 to 14, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.3-6 cycloalkyl.
16. A compound for use according to statement 15, wherein the C.sub.3-6 cycloalkyl group is cyclopropyl.
17. A compound for use according to any one of statements 1 to 16, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is halo.
18. A compound for use according to any one of statements 1 to 17, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is COR.sup.C, where R.sup.C is selected from NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and methyl.
19. A compound for use according to any one of statements 1 to 18, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is selected from cyano, NH.sub.2 and NO.sub.2.
20. A compound for use according to statement 19, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is cyano.
21. A compound for use according to statement 19, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is NH.sub.2.
22. A compound for use according to statement 19, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is NO.sub.2.
23. A compound for use according to any one of statements 1 to 22, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is phenyl or C.sub.5-6 heteroaryl, optionally substituted by methyl, cyano, hydroxy or methoxy.
24. A compound for use according to statement 23, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is phenyl, optionally substituted by methyl or methoxy.
25. A compound for use according to statement 23, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.5-6 heteroaryl, optionally substituted by one or more methyl groups.
26. A compound for use according to statement 1, wherein R.sup.4 is methoxy, R.sup.2 is CH.sub.2OCH.sub.3 or CH.sub.2OCH.sub.2CH.sub.3 and R.sup.1 and R.sup.3 are H.
27. A compound for use according to statement 1, wherein R.sup.4 is methoxy, R.sup.2 is phenyl, optionally substituted by methyl or methoxy, and R.sup.1 and R.sup.3 are H.
28. A compound for use according to statement 1, wherein R.sup.4 is methoxy, R.sup.2 is C.sub.5-6 heteroaryl, optionally substituted by methyl.
29. A compound for use according to statement 1, wherein R.sup.4 is methoxy, R.sup.2 is C heteroaryl, optionally substituted by methyl.
30. A compound for use according to statement 1, wherein R.sup.4 is methoxy and R.sup.1, R.sup.2 and R.sup.3 are H.
31. A compound for use according to statement 1, wherein R.sup.4 is chloro, R.sup.2 is C.sub.1-3 alkyl or bromo, and R.sup.1 and R.sup.3 are H.
32. A compound for use according to statement 1, wherein R.sup.4 is chloro and R.sup.1, R.sup.2 and R.sup.4 are H.
33. A compound for use according to statement 1, wherein R.sup.3 is C.sub.1-3 alkyl and R.sup.1, R.sup.2 and R.sup.4 are H.
34. A compound for use according to any one of statements 1 to 33, wherein Ar is phenyl, which may be unsubstituted or substituted.
35. A compound for use according to any one of statements 1 to 33, wherein Ar is napthyl, which may be unsubstituted or substituted.
36. A compound for use according to any one of statements 1 to 33, wherein Ar is substituted phenyl.
37. A compound for use according to any one of statements 1 to 33, wherein Ar is a C.sub.5-10 heteroaryl group, which may be unsubstituted or substituted.
38. A compound for use according to statement 37, wherein the C.sub.5-10 heteroaryl group is selected from: quinolinyl, benzothiazolyl, quinoxalinyl, benzooxadiazolyl, benzothiadiazolyl, benzofuran and benzotriazolyl.
39. A compound for use according to statement 37, wherein the C.sub.5-10 heteroaryl group is quinolinyl or benzothiazolyl.
40. A compound for use according to any one of statements 1 to 33, wherein Ar is the group:

##STR00381##

41. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by C.sub.1-4 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, C.sub.1-4alkyl carbamoyl, or by one or more fluoro groups.
42. A compound for use according to statement 41, wherein the C.sub.1-4 alkyl group is unsubstituted.
43. A compound for use according to statement 41, wherein the C.sub.1-4 alkyl group is perfluorinated.
44. A compound for use according to statement 41, wherein the C.sub.1-4 alkyl group is substituted, by a group selected from: [0854] (i) hydroxy; [0855] (ii) C.sub.1-2 alkoxy; [0856] (iii) NH.sub.2; and [0857] (iv) C.sub.1-4alkyl carbamoyl.
45. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by C.sub.3-6 cycloalkyl.
46. A compound for use according to statement 45, wherein the C.sub.3-6 cycloalkyl group is cyclohexyl.
47. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by hydroxy; cyano; NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl; or acylamido.
48. A compound for use according to statement 47, wherein the substituent is hydroxy.
49. A compound for use according to statement 47, wherein the substituent is cyano.
50. A compound for use according to statement 47, wherein the substituent is NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl.
51. A compound for use according to statement 47, wherein the substituent acylamido.
52. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by halo.
53. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by C.sub.1-3 alkoxy, optionally substituted by hydroxy, C(O)NH.sub.2, C.sub.3-6 cycloalkyl, phenyl, C.sub.5-6 heteroaryl, or by one of more fluoro groups.
54. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is unsubstituted.
55. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is perfluorinated.
56. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is substituted by hydroxy.
57. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is substituted by C(O)NH.sub.2.
58. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is substituted by C.sub.3-6 cycloalkyl.
59. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is substituted by phenyl.
60. A compound for use according to statement 53, wherein the C.sub.1-3 alkoxy group is substituted by C.sub.5-6 heteroaryl.
61. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by phenoxy, optionally substituted by fluoro.
62. A compound for use according to statement 61, wherein Ar is substituted by phenoxy.
63. A compound for use according to statement 61, wherein Ar is substituted by OC.sub.6H.sub.4F.
64. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by phenyl or C.sub.5-6 heteroaryl.
65. A compound for use according to statement 64, wherein Ar is substituted by phenyl.
66. A compound for use according to statement 64, wherein Ar is substituted by C.sub.5-6 heteroaryl.
67. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by SF.sub.5 or SO.sub.2CH.sub.3.
68. A compound for use according to statement 67, wherein Ar is substituted by SF.sub.5.
69. A compound for use according to statement 67, wherein Ar is substituted by SO.sub.2CH.sub.3.
70. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by —(CH.sub.2).sub.n—Y—, where Y is O or CH.sub.2, and n is 2 or 3.
71. A compound for use according to statement 70, where Ar is phenyl.
72. A compound for use according to any one of statements 33 to 39, wherein Ar is substituted by C.sub.1-4 alkyl ester.
73. A compound for use according to statement 72, where Ar is substituted by C(O)OCH.sub.3.
74. A compound for use according to statement 72, where Ar is substituted by C(O)OC(CH.sub.3).sub.3.
75. A compound for use according to any one of statements 1 to 33 and 41 to 74, wherein Ar is represented by the formula (Ar-1):

##STR00382##

where Y is either N or C—R.sup.A4, and Z is either N or C—R.sup.A5; and
R.sup.A1, R.sup.A2, R.sup.A3, R.sup.A4 (if present) and R.sup.A5 (if present) are independently selected from H and the optional substituents for Ar.
76. A compound for use according to statement 75, wherein R.sup.A2 is ethyl.
77. A compound for use according to statement 75, wherein R.sup.A3 is selected from cycloalkyl; phenoxy; phenyl; C.sub.5-6 heteroaryl; SF.sub.5; and SO.sub.2CH.sub.3.
78. A compound for use according to any one of statements 1 to 33, wherein Ar is 5-ethyl-2-methoxyphenyl.
79. A compound for use according to any one of statements 1 to 33, wherein Ar is 5-CF.sub.3-2-methoxyphenyl.
80. A compound for use according to any one of statements 1 to 33, wherein Ar is 2,6-dimethoxyphenyl.
81. A compound for use according to statement 1, with the proviso that when: [0858] R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, [0859] Ar is not 4-aminophenyl.
82. A pharmaceutical composition comprising a compound as defined in any one of statements 1 to 81 and a pharmaceutically acceptable excipient.
83. A method of treatment of cancer, comprising administering to a patient in need of treatment, a compound as defined in any one of statements 1 to 81 or a pharmaceutical composition according to statement 82.
84. A method according to statement 83, wherein the compound is administered simultaneously or sequentially with radiotherapy and/or chemotherapy.
85. The use of a compound as defined in any one of statements 1 to 81 in the manufacture of a medicament for treating cancer.
86. A compound as defined in any one of statements 1 to 81 or a pharmaceutical composition according to statement 82 for use in the treatment of cancer.
87. A compound or pharmaceutical composition according to statement 86, wherein the treatment is for simultaneous or sequential administration with radiotherapy and/or chemotherapy.
88. A compound as defined in any one of statements 1 to 81 or a pharmaceutical salt thereof.
89. A compound according to statement 88, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is not H.
90. A compound according to statement 89, wherein R.sup.3 is not CF.sub.3.
91. A compound according to statement 89, wherein R.sup.3 is not substituted C.sub.1-3 alkyl.
92. A compound according to statement 89, wherein R.sup.3 is ethyl or propyl.
93. A compound according to statement 89, wherein R.sup.3 is not C.sub.1-3 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4alkyl carbamoyl, acylamido or by one or more fluoro groups.
94. A compound according to statement 88, wherein R.sup.4 is methoxy.
95. A compound according to statement 88, wherein R.sup.4 is Cl, and R.sup.1, R.sup.2 and R.sup.3 are H.
96. A compound according to statement 88, wherein R.sup.4 is Cl, and R.sup.2 is C.sub.1-3 alkyl or bromo, and R.sup.1 and R.sup.3 are H.
97. A compound according to statement 88, wherein R.sup.3 is C.sub.1-3 alkyl and R.sup.1, R.sup.2 and R.sup.4 are H.
98. A compound according to statement 88, with the proviso that when: [0860] R.sup.1, R.sup.2 and R.sup.3 are H, and R.sup.4 is methoxy, [0861] Ar is not unsubstituted napthyl.
99. A compound according to statement 88, with the proviso that when: [0862] R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, [0863] Ar is not 2,4,6-trimethylphenyl.
100. A compound according to statement 88, with the proviso that when: [0864] R.sup.1, R.sup.2 and R.sup.4 are H, and R.sup.3 is CF.sub.3, [0865] Ar is not 2-(difluromethoxy)phenyl.
101. A compound according to statement 88, with the proviso that when: [0866] R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, [0867] Ar is not 4-fluoro-3-methyl-phenyl.
102. A compound for use according to statement 88, with the proviso that when: [0868] R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are H, [0869] Ar is not 4-aminophenyl.
103. A method of synthesis of a compound as defined in any one of statements 88 to 102.
104. A compound for use according to statement 1, wherein:
R.sup.1, R.sup.2, R.sup.3 and R.sup.4 are independently selected from: [0870] (i) H; [0871] (ii) C.sub.1-3 alkyl, optionally substituted by: hydroxy, C.sub.1-2 alkoxy, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4 alkyl carbamoyl, acylamido, or one or more fluoro groups; [0872] (iii) C.sub.1-3 alkoxy, optionally substituted by C.sub.3-6 cycloalkyl or by one of more fluoro groups; [0873] (iv) C.sub.3-6 cycloalkyl; [0874] (v) halo; [0875] (vi) COR.sup.C, where R.sup.C is selected from NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and methyl; [0876] (vii) cyano, NH.sub.2, NO.sub.2; [0877] (viii) phenyl or C.sub.5-6 heteroaryl, optionally substituted by methyl, hydroxy or methoxy;

[0878] Ar is a phenyl, napthyl, or C.sub.5-10 heteroaryl group, which groups are optionally substituted by one or more groups selected from: [0879] (i) C.sub.1-4 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, C.sub.1-4alkyl carbamoyl, or by one or more fluoro groups; [0880] (ii) C.sub.3-6 cycloalkyl; [0881] (iii) hydroxy; cyano; NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl; acylamido; [0882] (iv) halo; [0883] (v) C.sub.1-3 alkoxy, optionally substituted by hydroxy, C(O)NH.sub.2, C.sub.3-6 cycloalkyl, phenyl, C.sub.5-6 heteroaryl, or by one of more fluoro groups; [0884] (vi) phenoxy, optionally substituted by fluoro; [0885] (vii) phenyl, C.sub.5-6 heteroaryl [0886] (viii) SF.sub.5, SO.sub.2CH.sub.3; [0887] (ix) —(CH.sub.2).sub.n—Y—, where Y is O or CH.sub.2, and n is 2 or 3;
105. A compound for use according to statement 104, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is not H.
106. A compound for use according to either statement 104 or 105, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.1-3 alkyl, optionally substituted by: hydroxy, C.sub.1-2 alkoxy, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4 alkyl carbamoyl, acylamido, or one or more fluoro groups.
107. A compound for use according to any one of statements 104 to 106, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.1-3 alkoxy, optionally substituted by C.sub.3-6 cycloalkyl or by one of more fluoro groups.
108. A compound for use according to any one of statements 104 to 107, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is C.sub.3-6 cycloalkyl.
109. A compound for use according to any one of statements 104 to 108, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is halo.
110. A compound for use according to any one of statements 104 to 109, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is COR.sup.C, where R.sup.C is selected from NR.sup.N1R.sup.N2, where R.sup.N1 and R.sup.N2 are independently selected from H and methyl.
111. A compound for use according to any one of statements 104 to 110, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is selected from cyano, NH.sub.2 and NO.sub.2.
112. A compound for use according to any one of statements 104 to 111, wherein at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is phenyl or C.sub.5-6 heteroaryl, optionally substituted by methyl, hydroxy or methoxy.
113. A compound for use according to statement 104, wherein:
(a) R.sup.4 is methoxy, R.sup.2 is CH.sub.2OCH.sub.3 or CH2OCH.sub.2CH.sub.3 and R.sup.1 and R.sup.3 are H;
(b) R.sup.4 is methoxy, R.sup.2 is phenyl, optionally substituted by methyl or methoxy, and R.sup.1 and R.sup.3 are H;
(c) R.sup.4 is methoxy, R.sup.2 is C.sub.5-6 heteroaryl, optionally substituted by methyl;
(d) R.sup.4 is methoxy and R.sup.1, R.sup.2 and R.sup.3 are H;
(e) R.sup.4 is chloro, R.sup.2 is C.sub.1-3 alkyl or bromo, and R.sup.1 and R.sup.3 are H;
(f) R.sup.4 is chloro and R.sup.1, R.sup.2 and R.sup.4 are H; or
(g) R.sup.3 is C.sub.1-3 alkyl and R.sup.1, R.sup.2 and R.sup.4 are H.
114. A compound for use according to any one of statements 104 to 113, wherein Ar is:
(a) phenyl, which may be unsubstituted or substituted;
(b) napthyl, which may be unsubstituted or substituted; or
(c) a C.sub.5-10 heteroaryl group, which may be unsubstituted or substituted.
115. A compound for use according to statement 114, wherein Ar is substituted by C.sub.1-4 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, C.sub.1-4alkyl carbamoyl, or by one or more fluoro groups.
116. A compound for use according to statement 114, wherein Ar is substituted by C.sub.3-6 cycloalkyl.
117. A compound for use according to statement 114, wherein Ar is substituted by hydroxy; cyano; NR.sup.N3R.sup.N4, where R.sup.N3 and R.sup.N4 are independently selected from H and methyl; or acylamido.
118. A compound for use according to statement 114, wherein Ar is substituted by halo.
119. A compound for use according to statement 114, wherein Ar is substituted by C.sub.1-3 alkoxy, optionally substituted by hydroxy, C(O)NH.sub.2, C.sub.3-6 cycloalkyl, phenyl, C.sub.5-6 heteroaryl, or by one of more fluoro groups.
120. A compound for use according to statement 114, wherein Ar is substituted by phenoxy, optionally substituted by fluoro.
121. A compound for use according to statement 114, wherein Ar is substituted by phenyl or C.sub.5-6 heteroaryl.
122. A compound for use according to statement 114, wherein Ar is substituted by SF.sub.5 or SO.sub.2CH.sub.3.
123. A compound for use according to statement 114, wherein Ar is substituted by —(CH.sub.2).sub.n—Y—, where Y is O or CH.sub.2, and n is 2 or 3.
124. A compound for use according to any one of statements 104 to 113, wherein Ar is represented by the formula (Ar-1):

##STR00383##

where Y is either N or C—R.sup.A4, and Z is either N or C—R.sup.A5; and
R.sup.A1, R.sup.A2, R.sup.A3, R.sup.A4 (if present) and R.sup.A5 (if present) are independently selected from H and the optional substituents for Ar.
125. A compound for use according to statement 124, wherein:
(a) R.sup.A2 is ethyl; or
(b) R.sup.A3 is selected from cycloalkyl; phenoxy; phenyl; C.sub.5-6 heteroaryl; SF.sub.5; and SO.sub.2CH.sub.3.
126. A compound for use according to any one of statements 104 to 113, wherein Ar is:
(a) 5-ethyl-2-methoxyphenyl;
(b) 5-CF.sub.3-2-methoxyphenyl; or
(c) 2,6-dimethoxyphenyl.
127. A compound as defined in any one of statements 104 to 126 or a pharmaceutical salt thereof.
128. A compound according to statement 127, wherein:
(a) at least one of R.sup.1, R.sup.2, R.sup.3 and R.sup.4 is not H;
(b) R.sup.3 is not CF.sub.3;
(c) R.sup.3 is not substituted C.sub.1-3 alkyl;
(d) R.sup.3 is ethyl or propyl;
(e) R.sup.3 is not C.sub.1-3 alkyl, optionally substituted by hydroxy, C.sub.1-2 alkoxy, NH.sub.2, phenyl, C.sub.5-6 heteroaryl, C.sub.1-4 alkyl carbamoyl, acylamido or by one or more fluoro groups;
(f) R.sup.4 is methoxy;
(g) R.sup.4 is Cl, and R.sup.1, R.sup.2 and R.sup.3 are H;
(h) R.sup.4 is Cl, and R.sup.2 is C.sub.1-3 alkyl or bromo, and R.sup.1 and R.sup.3 are H; or
(i) R.sup.3 is C.sub.1-3 alkyl and R.sup.1, R.sup.2 and R.sup.4 are H.

REFERENCES

[0888] Aggarwal and Calvi, Nature, 2004, 430, 372-376 doi:10.1038/nature02694 [0889] Avvakumov et al., Oncogene, 2007, 26, 5395-5407 doi:10.1038/sj.onc.1210608 [0890] Berge et al., J. Pharm. Sci., 1977, 66, 1-19 doi:10.1002/jps.2600660104 [0891] Borrow et al., Nat. Genet., 1996, 14, 33-41 doi:10.1038/ng0996-33 [0892] Dekker et al., Drug, Discov. Today, 2014, 19, 654-660 doi:10.1016/j.drudis.2013.11.012 [0893] Doyon et al., Mol. Cell., 2006, 21, 51-64 doi:10.1016/j.molcel.2005.12.007 [0894] Dhuban et al., Sci. Immunol., 2017, 2, 9297 doi:10.1126/sciimmunol.aai9297 [0895] Duong et al., Cancer Res., 2013, 73, 5556-5568 doi:10.1158/0008-5472.CAN-13-0013 [0896] Ghizzoni et al., Eur. J. Med. Chem., 2012, 47, 337-344 doi:10.1016/j.ejmech.2011.11.001 [0897] Gil et al., J. Proteomics, 2017, 150, 297-309 doi:10.1016/j.jprot.2016.10.003 [0898] Gobert, M. et al., Cancer Research, 2009, 69, 2000-2009 doi:10.1158/0008-5472.CAN-08-2360 [0899] Holbert et al., J. Biol. Chem., 2007, 282, 36603-36613 doi:10.1074/jbc.M705812200 [0900] Iizuka et al., Mol. Cell. Biol., 2006, 26, 1098-1108 doi:10.1128/MCB.26.3.1098-1108.2006 [0901] Iizuka et al., Cancer Sci., 2013, 104, 1647-1655 doi:10.1111/cas.12303 [0902] Jeong, et al., Blood Res 2016 51(3), 152-154 doi:10.5045/br.2016.51.3.152 [0903] Joshi, et al., Immunity 2015, 43, 579-590 doi:10.1016/j.immuni.2015.08.006 [0904] Li, B. et al., PNAS, 2007, 104, 4571-4576 doi:10.1073/pnas.0700298104 [0905] Melero, et al. Nature Reviews Cancer, 2015, 15, 457-472 doi:10.1038/nrc3973 [0906] Merson et al., J. Neurosci., 2006, 26, 11359-11370 doi:10.1523/JNEUROSCI.2247-06.2006 [0907] Miller, A. M. et al. J. Immunol., 2006, 177, 7398-7405 doi:10.4049/jimmunol.177.10.7398 [0908] Persa, E. et al. Cancer Letters, 2015 368(2), 252-261 doi:10.1016/j.canlet.2015.03.003 [0909] Sheikh et al., Blood, 2015, 125(12), 1910-21 doi:10.1182/blood-2014-08-594655 [0910] Shi et al, Nature Biotech, 2015, 33, 661-667 doi:10.1038/nbt.3235 [0911] Su et al., Int. J. Mol. Sci., 2016, 17, 1-18 doi:10.3390/ijms17101594 [0912] Stern et al., Crit. Rev. Oncol. Hematol., 2005, 54, 11-29 doi:10.1016/j.critrevonc.2004.10.011 [0913] Thomas et al., Development, 2000, 127, 2537-2548 PMID:10821753 [0914] Tao, H. et al., Lung Cancer, 2012, 75, 95-101 doi:10.1016/j.lungcan.2011.06.002 [0915] Turner-Ivey et al., Neoplasia, 2014, 16(8): 644-655 doi:10.1016/j.neo.2014.07.007 [0916] Valerio et al., Cancer Research, 2017, 77(7), 1753-62 doi:10.1158/0008-5472.CAN-16-2374 [0917] Vizmanos et al., Genes Chromosomes Cancer, 2003, 36(4), 402-405 doi:10.1002/gcc.10174 [0918] Voss et al., BioEssays, 2009, 31(10), 1050-1061 doi:10.1002/bies.200900051 [0919] Wang, L., et al. EBioMedicine, 2016, 13, 99-112 doi:10.1016/j.ebiom.2016.10.018 [0920] Wang, X. et al., Oncogene, 2017, 36, 3048-3058 doi:10.1038/onc.2016.458 [0921] Xiao, Y. et al., Cell reports, 2014, 7, 1471-1480 doi:10.1016/j.celrep.2014.04.021 [0922] Yan, M. et al., Breast Cancer Research, 2011, 13, R47 doi:10.1186/bcr2869 [0923] Zack et al., Nature Genetics 2013 45, 1134-1140 doi:10.1038/ng.2760 [0924] Zhang et al., Mini. Rev. Med. Chem., 2017, 17, 1-8 doi:10.2174/1389557516666160923125031