Antibodies against 4G7-derived chimeric antigen receptors

11732041 · 2023-08-22

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are isolated antibodies that specifically bind anti-CD19 chimeric antigen receptors (CARs) derived from a 4G7 scFv. Also provided are methods of making and using these isolated antibodies.

Claims

1. An isolated antibody that specifically binds a molecule comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36, wherein the antibody comprises (a) a heavy chain variable region (VH) CDR1 comprising the amino acid sequence of SEQ ID NO: 15 or 21, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 16 or 22, a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 17 or 23, a light chain variable region (VL) CDR1 comprising the amino acid sequence of SEQ ID NO: 18, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 20; (b) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 24 or 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 25 or 30, a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 26, a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 27, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 28; or (c) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 24 or 29, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 31 or 33, a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 26, a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 27, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 32.

2. The isolated antibody of claim 1 comprising a VH amino acid sequence that is at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% identical to the amino acid sequence of SEQ ID NO: 1, 2 or 3.

3. The isolated antibody of claim 1, comprising a VL amino acid sequence that is at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a VL comprising the amino acid sequence of SEQ ID NO: 7, 8, 9, or 10.

4. The isolated antibody of claim 1, comprising (a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO:21; (b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 22; (c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 23; (d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 18; (e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19; and (f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 20.

5. The isolated antibody of claim 4, comprising (a) a VH comprising the amino acid sequence of SEQ ID NO:1; and (b) a VL comprising the amino acid sequence of SEQ ID NO: 7.

6. The isolated antibody of claim 4, comprising (a) a VH comprising the amino acid sequence of SEQ ID NO: 1; and (b) a VL comprising the amino acid sequence of SEQ ID NO: 10.

7. The isolated antibody of claim 1, comprising (a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29; (b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 30; (c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 26; (d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 27; (e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19; and (f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 28.

8. The isolated antibody of claim 7, comprising (a) a VH comprising the amino acid sequence of SEQ ID NO: 2; and (b) a VL comprising the amino acid sequence of SEQ ID NO: 8.

9. The isolated antibody of claim 1, comprising (a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 29; (b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 33; (c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 26; (d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 27; (e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19; and (f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 32.

10. The isolated antibody of claim 9, comprising (a) a VH comprising the amino acid sequence of SEQ ID NO: 3; and (b) a VL comprising the amino acid sequence of SEQ ID NO: 9.

11. The isolated antibody of claim 1, wherein the isolated antibody further comprises a detectable label.

12. The isolated antibody of claim 11, wherein the detectable label is selected from the group consisting of a fluorescent label, a photochromic compound, a proteinaceous fluorescent label, a magnetic label, a radiolabel, and a hapten.

13. A polynucleotide encoding the isolated antibody of claim 1.

14. A vector comprising the polynucleotide of claim 13.

15. A cell comprising the polynucleotide of claim 13.

16. A method of making an isolated antibody that specifically binds a molecule comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36, the method comprising incubating the cell of claim 15 under suitable conditions.

17. An isolated antibody that specifically binds a molecule comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36, wherein the antibody comprises (a) a VH comprising the amino acid sequence of SEQ ID NO:1 and a VL comprising the amino acid sequence of SEQ ID NO: 7; (b) a VH comprising the amino acid sequence of SEQ ID NO: 2 and a VL comprising the amino acid sequence of SEQ ID NO: 8; (c) a VH comprising the amino acid sequence of SEQ ID NO: 3 and a VL comprising the amino acid sequence of SEQ ID NO: 9; or (d) a VH comprising the amino acid sequence of SEQ ID NO: 1 and a VL comprising the amino acid sequence of SEQ ID NO: 10.

18. The isolated antibody of claim 17, comprising (a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO:15 or 21; (b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 16 or 22; (c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 17 or 23; (d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 18; (e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19; and (f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 20.

19. The isolated antibody of claim 17, comprising (a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 24 or 29; (b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 25 or 30; (c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 26; (d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 27; (e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19; and (f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 28.

20. The isolated antibody of claim 17, comprising (a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 24 or 29; (b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 31 or 33; (c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 26; (d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 27; (e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 19; and (f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 32.

21. A method of determining a number of cells expressing an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36, the method comprising contacting a sample of cells with the isolated antibody of claim 1 and determining the number of cells expressing the anti-CD19 scFv in the sample.

22. The method of claim 21, wherein the anti-CD19 scFv is a component of a chimeric antigen receptor (CAR).

23. The method of claim 22, wherein the cells are CART cells.

24. A method of determining a number of cells presenting a polypeptide comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36, wherein the method comprises: (a) providing a sample comprising cells known or suspected to be presenting a polypeptide comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36; (b) contacting the sample with the isolated antibody of claim 1 under conditions that permit binding of the polypeptide and the antigen binding molecule; and (c) determining the number of cells presenting the polypeptide in the sample.

25. The method of claim 24, wherein the anti-CD19 scFv is a component of a CAR.

26. The method of claim 25, wherein the cells are CAR T cells.

27. A method of determining the presence or absence of a polypeptide comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36, wherein the method comprises: (a) providing a sample known or suspected to comprise a polypeptide comprising an anti-CD19 scFv comprising the amino acid sequence of SEQ ID NO:36; (b) contacting the sample with the isolated antibody of claim 1 under conditions that permit binding of the polypeptide and the antibody; and (c) detecting the presence or absence of a polypeptide:antibody complex.

28. The method of claim 27, wherein the anti-CD19 scFv is a component of a CAR.

29. The method of claim 28, wherein the cells are CAR T cells.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows a sensorgram plot showing capture of all biotinylated anti-Id sub-clones (E2153.1C4.E2 “Clone E2”, E2153.1D9.B4 “Clone B4”, E2153.1G5.H5 “Clone H5”, E2153.2H8.A8 “Clone A8”, E2153.3B11.B7 “Clone B7”, E2153.4D7.E11 “Clone E11”) to CAPture chip surface.

(2) FIGS. 2A and 2B show kinetic fit plots for m4G7-hFab binding to the purified anti-Id antibody sub-clones generated from 4G7 fusion protein E2153 (FIG. 2A) and m4G7-hFab binding to negative control (FIG. 2B) at 25° C.

(3) FIGS. 3A and 3B show exemplary flow cytometry plots of comparing commercially available anti mouse F(ab′)2 antibody and anti-Id antibody clones A8 and Eli for binding to UCART19 cells. Tube A included blood from a healthy volunteer; Tube B: blood from healthy volunteer+100,000 UCART19 transduced cells per mL; Tube C: blood from healthy volunteer+1 million UCART19 transduced cells per mL and Tube D: 10 million UCART19 transduced cells per mL.

(4) FIGS. 4A-4E show exemplary results of blocking experiments using anti-Id antibody A8 labeled anti-UCART19. FIG. 4A shows a line graph of % CAR+ cells detectable by soluble CD19-Fc fusion protein after pretreatment with either the anti-Id antibody or an irrelevant isotype control. FIGS. 4B and 4C show flow cytometry plots from FIG. 4A of increasing concentration of idiotype Ab A8 (E2153.2H8.A8) (FIG. 4B) and unconjugated mouse IgG1 Isotype control (FIG. 4C). FIGS. 4D and 4E show the ability of the anti-Id m4G7 (A8) to block tumor cell lysis at 5:1 and 10:1 E:T ratios, respectively.

(5) FIG. 5A shows exemplary flow cytometry plots of anti-idiotype antibody experiments to determine binding to Jurkat cells expressing CARs with an scFv derived from murine 4G7 (m4G7), a humanized 4G7 (h4G7.7), FMC63 anti-CD19 murine scFv (not related to 4G7) or BC40, an anti-BCMA human scFv. FIG. 5B shows flow cytometry plots of a positive control using sCD19-Fc binding to all anti-CD19 CARs expressed on Jurkat cells.

(6) FIG. 6A and FIG. 6B show exemplary flow cytometry plots of anti-idiotype antibodies binding to h4G7.7 and UCART19 expressed on primary human T cells but do not bind to an FMC63-derived CAR (CTL-019) (FIG. 6A). sCD19-Fc was used as a positive control demonstrating binding to all anti-CD19 CARs expressed on primary human T cells (FIG. 6B).

(7) FIG. 7 shows signal-to-noise ratios of anti-Id clones E11, E2, A8, and B4 at increasing concentrations.

(8) FIG. 8 shows stain index and flow cytometry plots of anti-idiotype antibody A8 conjugated to phycoerythrin (PE) or allophycocyanin (APC) fluorescent probes.

DETAILED DESCRIPTION

(9) The scFv portion of some chimeric antigen receptors (CARs), e.g., at least UCART19, ALLO-501 and ALLO-501A, is derived from the mouse anti-human CD19 antibody clone 4G7. The present disclosure provides reagents to detect anti-CD19 CARs comprising an scFv portion derived from antibody clone 4G7 (e.g., UCART19 and ALLO-501). Disclosed herein are anti-idiotype antibodies (anti-Id) antibodies that specifically bind to anti-CD19 clone 4G7 and anti-CD19 molecules derived from 4G7. Anti-Id antibodies to 4G7 derived molecules disclosed herein demonstrate specific high affinity binding to chimeric antigen receptors (CAR) comprising a 4G7 derived scFv (e.g., UCART19, ALLO-501 and ALLO-501A). One unlimiting example of the 4G7 derived scFv comprises the amino acid sequence of SEQ ID NO:36.

(10) When conjugated to a bright fluorochrome, the anti-id antibodies disclosed herein stain cells expressing chimeric antigen receptors (CAR) comprising a 4G7 derived scFv (e.g., UCART19, ALLO-501 and ALLO-501A) with a high MFI and low background. The antibodies described herein can be used in a method to detect anti-CD19 CAR expression. These antibodies can be used to identify, e.g., UCART19 and ALLO-501 by both flow cytometry and immunohistochemistry. These antibodies can also be used in the context of non-clinical research studies, manufacturing of immune cells comprising a 4G7 derived scFv (e.g., UCART19 and ALLO-501), as a clinical flow-based pharmacokinetic reagent and in clinical immunogenicity studies.

(11) 4G7 is a CD19 monoclonal antibody that recognizes CD19. Single chain variable fragments (scFv) formed from 4G7 comprise the targeting component of some chimeric antigen receptors (CARs) (See WO2014184143A1, U.S. 62/839,455, filed on Apr. 26, 2019, and U.S. 63/005,041, filed on Apr. 3, 2020.). In some embodiments, the scFv derived from the CD19 monoclonal antibody 4G7, comprises a part of the CD19 monoclonal antibody 4G7 immunoglobulin gamma 1 heavy chain (GenBank: CAD88275.1; SEQ ID NO: 34) and a part of anti-CD19 monoclonal antibody 4G7 immunoglobulin kappa light chain (GenBank: CAD88204.1; SEQ ID NO: 35), linked together by a flexible linker. (Peipp M., D. Saul, et al., 2004. Efficient eukaryotic expression of fluorescent scFv fusion proteins directed against CD antigens for FACS applications. J. Immunol. Methods 285: 265-280). In some embodiments, the scFv comprises the variable fragments of the anti-CD19 monoclonal antibody 4G7 immunoglobulin gamma 1 heavy chain and the variable fragments of the anti-CD19 monoclonal antibody 4G7 immunoglobulin kappa light chain linked together by a flexible linker.

(12) The anti-CD19 monoclonal antibody 4G7 immunoglobulin gamma 1 heavy chain comprises the amino acid sequence:

(13) TABLE-US-00001 MEWSWIFLFLLSGTAGVHSEVQLQQSGPELIKPGASVKMSCKASGYTFTSY VMHWVKQKPGQGLEWIGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMEL SSLTSEDSAVYYCARGTYYYGSRVFDYWGQGTTLTVSSAKTTPPSVYPLAP GSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVS SVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQT QPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTK GRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENY KNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLS HSPGK (SEQ ID NO: 34, underlined is a signal sequence, VH is in bold also shown in SEQ ID NO:)

(14) The anti-CD19 monoclonal antibody 4G7 immunoglobulin kappa light chain comprises the amino acid sequence:

(15) TABLE-US-00002 MRCLAEFLGLLVLWIPGAIGDIVMTQAAPSIPVTPGESVSISCRSSKSLLN SNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISR VEAEDVGVYYCMQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSG GASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTL TLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID NO: 35, underlined is a signal sequence, VL is in bold)

(16) An exemplary 4G7 derived scFv comprises the amino acid sequence:

(17) TABLE-US-00003 EVQLQQSGPELIKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYI NPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARGTYY YGSRVFDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQAAPSIPVTPGE SVSISCRSSKSLLNSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFS GSGSGTAFTLRISRVEAEDVGVYYCMQHLEYPFTFGAGTKLELK (SEQ ID NO: 36, VH CDR1, CDR2, CDR3, and VL CDR1, CDR2 and CDR3 are each underlined)

(18) In some embodiments, the scFv comprises a part of amino acid sequences of SEQ ID NO: 34 and/or SEQ ID NO: 35. In some embodiments, the scFv comprises a part of amino acid sequences of SEQ ID NO: 34 and/or SEQ ID NO: 35, with or without the signal sequence. In some embodiments, the scFv comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97% or at least 99% sequence identity with the variable region of amino acid sequence of SEQ ID NO: 34 and/or SEQ ID NO: 35. In some embodiments, the scFv comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 36. Disclosed herein are antigen binding molecules, including antibodies, that specifically bind to the anti-CD19 scFv derived from 4G7, as well as molecules comprising these sequences and cells presenting such molecules. Humanized forms of the antigen binding molecules also form as aspect of the disclosure. Applications and uses of these antigen binding molecules are also disclosed.

(19) I. Antigen Binding Molecules and Polynucleotides Encoding Same

(20) An “antigen binding domain” as used herein means any polypeptide that binds a specified target antigen, for example the specified target antigen can be the CD19 protein or fragment thereof (referred to interchangeably herein as a “CD19 antigen”, “CD19 target antigen”, or “CD19 target”). In the context of an anti-idiotype antibody of the present disclosure, the target antigen is an antigen binding molecule that specifically binds CD19 (e.g., antibody clone 4G7 and antigen binding molecules derived from or related to 4G7, including scFv's).

(21) In some embodiments, the antigen binding domain binds to a CD19 antigen on a tumor cell. In some embodiments, the antigen binding domain binds to a CD19 antigen on a cell involved in a hyperproliferative disease or to a viral or bacterial antigen.

(22) Antigen binding domains include, but are not limited to, antibody binding regions that are immunologically functional fragments. The term “immunologically functional fragment” (or “fragment”) of an antigen binding domain is a species of antigen binding domain comprising a portion (regardless of how that portion is obtained or synthesized) of an antibody that lacks at least some of the amino acids present in a full-length chain, but which is still capable of specifically binding to a target antigen. Such fragments are biologically active in that they bind to the target antigen and can compete with other antigen binding domains, including intact antibodies, for binding to a given epitope. In some embodiments, the fragments are neutralizing fragments. In some embodiments, the fragments can block or reduce the activity of an anti-CD19 CAR (e.g., a blocking effect). In some embodiments, the fragments can antagonize the activity of an anti-CD19 CAR.

(23) In specific embodiments, an anti-Id antibody of the instant disclosure is an antibody identified herein as Clones E2, B4, A8, E11 and each comprises the heavy and light chain amino acid, variable, CDR sequences and nucleotide sequences encoding such sequences, as provided and labeled herein.

(24) Immunologically functional immunoglobulin fragments include, but are not limited to, scFv fragments, Fab fragments (Fab′, F(ab′)2, and the like), one or more complementarity determining regions (“CDRs”), a diabody (heavy chain variable domain on the same polypeptide as a light chain variable domain, connected via a short peptide linker that is too short to permit pairing between the two domains on the same chain), domain antibodies, bivalent antigen binding domains (comprises two antigen binding sites), multispecific antigen binding domains, and single-chain antibodies. These fragments can be derived from any mammalian source, including but not limited to human, mouse, rat, camelid or rabbit. As will be appreciated by one of skill in the art, an antigen binding domain can include non-protein components.

(25) The variable regions typically exhibit the same general structure of relatively conserved framework regions (FR) joined by the 3 hypervariable regions (CDRs). The CDRs from the two chains of each pair typically are aligned by the framework regions, which can enable binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. By convention, CDR regions in the heavy chain are typically referred to as HC CDR1, CDR2, and CDR3. The CDR regions in the light chain are typically referred to as LC CDR1, CDR2, and CDR3.

(26) In some embodiments, antigen binding domains comprise one or more complementarity binding regions (CDRs) present in the full-length light or heavy chain of an antibody, and in some embodiments comprise a single heavy chain and/or light chain or portion thereof. These fragments can be produced by recombinant DNA techniques or can be produced by enzymatic or chemical cleavage of antigen binding domains, including intact antibodies.

(27) In some embodiments, the antigen binding domain is an antibody of fragment thereof, including one or more of the complementarity determining regions (CDRs) thereof. In some embodiments, the antigen binding domain is a single chain variable fragment (scFv), comprising light chain CDRs CDR1, CDR2 and CDR3, and heavy chain CDRs CDR1, CDR2 and CDR3.

(28) The assignment of amino acids to each of the framework, CDR, and variable domains is typically in accordance with numbering schemes of Kabat numbering (see, e.g., Kabat et al. in Sequences of Proteins of Immunological Interest, 5th Ed., NIH Publication 91-3242, Bethesda Md. 1991), Chothia numbering (see, e.g., Chothia & Lesk, (1987), J Mol Biol 196: 901-917; Al-Lazikani et al., (1997) J Mol Biol 273: 927-948; Chothia et al., (1992) J Mol Biol 227: 799-817; Tramontano et al., (1990) J Mol Biol 215(1): 175-82; and U.S. Pat. No. 7,709,226), contact numbering, or the AbM scheme (Antibody Modeling program, Oxford Molecular).

(29) Accordingly, in some embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the Kabat numbering scheme. In other embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the Chothia numbering scheme. In other embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the contact numbering scheme. In other embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the AbM numbering scheme.

(30) Humanized antibodies are described herein and can be prepared by known techniques. In some embodiments, a humanized monoclonal antibody comprises the variable domain of an anti-Id antibody (or all or part of the antigen binding site thereof) and a constant domain derived from a human antibody. Alternatively, a humanized antibody fragment can comprise an antigen binding site of a murine or rabbit monoclonal antibody and a variable domain fragment (lacking the antigen binding site) derived from a human antibody. Procedures for the production of engineered monoclonal antibodies include those described in, e.g., Riechmann et al., (1988) Nature 332:323, Liu et al., (1987) Proc. Nat. Acad. Sci. USA 84:3439, Larrick et al., (1989) Bio/Technology 7:934, and Winter et al., (1993) TIPS 14:139. In some embodiments, the chimeric antibody is a CDR grafted antibody. Techniques for humanizing antibodies are discussed in, e.g., U.S. Pat. Nos. 5,869,619; 5,225,539; 5,821,337; 5,859,205; 6,881,557; Padlan et al., (1995) FASEB J. 9:133-39; Tamura et al., (2000) J. Immunol. 164:1432-41; Zhang et al., (2005) Mol. Immunol. 42(12):1445-1451; Hwang et al., Methods. (2005) 36(1):35-42; Dall'Acqua et al., (2005) Methods 36(1):43-60; and Clark, (2000) Immunology Today 21(8):397-402.

(31) Variants of the anti-idiotype antibodies are also within the scope of the disclosure, e.g., variable light and/or variable heavy chains that each have at least 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, 97-99%, or above 99% identity to the amino acid sequences of the antigen binding domain sequences described herein. In some embodiments, the anti-idiotype antibody is at least about 75%, at least about 85%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to a heavy chain variable region sequence provided in Table 1a and/or a light chain variable sequence provided in Table 1b.

(32) In some instances, such molecules include at least one heavy chain and one light chain, whereas in other instances the variant forms contain two variable light chains and two variable heavy chains (or subparts thereof). A skilled artisan will be able to determine suitable variants of the anti-idiotype antibodies as set forth herein using well-known techniques. In certain embodiments, one skilled in the art can identify suitable areas of the molecule that can be changed without destroying activity by targeting regions not believed to be important for activity.

(33) An anti-Id antibody of the present disclosure can also be a fully human monoclonal antibody. Fully human monoclonal antibodies can be generated by any number of techniques with which those having ordinary skill in the art will be familiar. Such methods include, but are not limited to, Epstein Barr Virus (EBV) transformation of human peripheral blood cells (e.g., containing B lymphocytes), in vitro immunization of human B-cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein.

(34) An anti-Id antibody that specifically binds to anti-CD19 clone 4G7 and anti-CD19 molecules derived from 4G7 is said to be “selective” when it binds to one target more tightly than it binds to a second target.

(35) An anti-Id antibody that specifically binds to anti-CD19 clone 4G7 and anti-CD19 molecules derived from 4G7 is said to “specifically bind” its target antigen (e.g., mouse 4G7 and molecules derived from 4G7) when the dissociation constant (Kd) is ˜1 nM. The antigen binding domain specifically binds antigen with “high affinity” when the Kd is 1-5 nM, and with “very high affinity” when the Kd is 0.1-0.5 nM. In one embodiment, the antigen binding domain has a Kd of ˜1 nM. In one embodiment, the off-rate is <1×10.sup.−5. In other embodiments, the antigen binding domains will bind to mouse 4G7 and molecules derived from 4G7 with a Kd of between about 1×10.sup.−7 M and 1×10.sup.−12 M, and in yet another embodiment the antigen binding domains will bind with a Kd between about 1×10.sup.−5 and 1×10.sup.−12.

(36) As provided herein, the anti-Id antibodies of the present disclosure specifically bind mouse 4G7 and molecules derived from 4G7 (e.g., murine 4G7, humanized 4G7, 4G7 derived CARs). In certain embodiments, the anti-Id antibodies of the present disclosure bind mouse 4G7 and molecules derived from 4G7 with a KD of less than 1×10.sup.−6 M, less than 1×10.sup.−7 M, less than 1×10.sup.−8 M, or less than 1×10.sup.−9 M. In one particular embodiment, the anti-Id antibodies bind mouse 4G7 and molecules derived from 4G7 with a KD of less than 1×10.sup.−7 M. In another embodiment, the anti-Id antibodies bind mouse 4G7 and molecules derived from 4G7 with a KD of less than 1×10.sup.−8 M. In some embodiments, the anti-Id antibodies bind mouse 4G7 and molecules derived from 4G7 with a Kd of about 1×10.sup.−7 M, about 2×10.sup.−7 M, about 3×10.sup.−7 M, about 4×10.sup.−7 M, about 5×10.sup.−7 M, about 6×10.sup.−7 M, about 7×10.sup.−7 M, about 8×10.sup.−7 M, about 9×10.sup.−7 M, about 1×10.sup.−8 M, about 2×10.sup.−8M, about 3×10.sup.−8 M, about 4×10.sup.−8 M, about 5×10.sup.−8 M, about 6×10.sup.−8M, about 7×10.sup.−8M, about 8×10.sup.−8 M, about 9×10.sup.−8 M, about 1×10.sup.−9 M, about 2×10.sup.−9 M, about 3×10.sup.−9 M, about 4×10.sup.−9 M, about 5×10.sup.−9 M, about 6×10.sup.−9 M, about 7×10.sup.−9 M, about 8×10.sup.−9 M, about 9×10.sup.−9 M, about 1×10.sup.−10 M, or about 5×10.sup.−1 M. In certain embodiments, the Kd is calculated as the quotient of K.sub.off/K.sub.on, and the K.sub.on and K.sub.off are determined using a monovalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore® surface plasmon resonance technology. In other embodiments, the Kd is calculated as the quotient of K.sub.off/K.sub.on, and the K.sub.on and K.sub.off are determined using a bivalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore® surface plasmon resonance technology.

(37) In some embodiments, the anti-Id antibodies bind mouse 4G7 and molecules derived from 4G7 with an association rate (k.sub.on) of less than 1×10.sup.−4 M.sup.−1 s.sup.−1, less than 2×10.sup.−4 M.sup.−1 s.sup.−1, less than 3×10.sup.−4 M.sup.−1 s.sup.−1, less than 4×10.sup.−4 M.sup.−1 s.sup.−1, less than 5×10.sup.−4 M.sup.−1 s.sup.−1, less than 7×10.sup.−4 M.sup.−1 s.sup.−1 less than 8×10.sup.−4 M.sup.−1 s.sup.−1 less than 9×10.sup.−4 M.sup.−1 s.sup.−1 less than 1×10.sup.−5 M.sup.−1 s.sup.−1 less than 2×10.sup.−5 M.sup.−1 s.sup.−1 less than 3×10.sup.−5 M.sup.−1 s.sup.−1 less than 4×10.sup.−5 M.sup.−1 s.sup.−1 less than 5×10.sup.−5 M.sup.−1 s.sup.−1 less than 6×10.sup.−5 M.sup.−1 s.sup.−1, less than 7×10.sup.−5 M.sup.−1 s.sup.−1, less than 8×10.sup.−5 M.sup.−1 s.sup.−1, less than 9×10.sup.−5 M.sup.−1 s.sup.−1, less than 1×10.sup.−6 M.sup.−1 s.sup.−1, less than 2×10.sup.−6 M.sup.−1 s.sup.−1 less than 3×10.sup.−6 M.sup.−1 s.sup.−1, less than 4×10.sup.−6 M.sup.−1 s.sup.−1 less than 5×10.sup.−6 M.sup.−1 s.sup.−1 less than 6×10.sup.−6 M.sup.−1 s.sup.−1 less than 7×10.sup.−6 M.sup.−1 s.sup.−1 less than 8×10.sup.−6 M.sup.−1 s.sup.−1, less than 9×10.sup.−6 M.sup.−1 s.sup.−1, or less than 1×10.sup.−7 M.sup.−1 s.sup.−1. In certain embodiments, the k.sub.on is determined using a monovalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore® surface plasmon resonance technology. In other embodiments, the k.sub.on is determined using a bivalent antibody as measured by, e.g., BIAcore® surface plasmon resonance technology.

(38) In some embodiments, the anti-Id antibodies bind mouse 4G7 and molecules derived from 4G7 with an dissociation rate (k.sub.off) of less than 1×10.sup.−2 s.sup.−1, less than 2×10.sup.−2 s.sup.−1, less than 3×10.sup.−2 s.sup.−1, less than 4×10.sup.−2 s.sup.−1, less than 5×10.sup.−2 s.sup.−1, less than 6×10.sup.−2 s.sup.−1, less than 7×10.sup.−2 s.sup.−1, less than 8×10.sup.−2 s.sup.−1, less than 9×10.sup.−2 s.sup.−1, less than 1×10.sup.−3 s.sup.−1, less than 2×10.sup.−3 s.sup.−1, less than 3×10.sup.−3 s.sup.−1, less than 4×10.sup.−3 s.sup.−1, less than 5×10.sup.−3 s.sup.−1, less than 6×10.sup.−3 s.sup.−1, less than 7×10.sup.−3 s.sup.−1, less than 8×10.sup.−3 s.sup.−1, less than 9×10.sup.−3 s.sup.−1, less than 1×10.sup.−4 s.sup.−1, less than 2×10.sup.−4 s.sup.−1, less than 3×10.sup.−4 s.sup.−1, less than 4×10.sup.−4 s.sup.−1, less than 5×10.sup.−4 s.sup.−1, less than 6×10.sup.−4 s.sup.−1 less than 7×10.sup.−4 s.sup.−1, less than 8×10.sup.−4 s.sup.−1, less than 9×10.sup.−4 s.sup.−1, less than 1×10.sup.−5 s.sup.−1, or less than 5×10.sup.−4 s.sup.−1. In certain embodiments, the k.sub.off is determined using a monovalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore® surface plasmon resonance technology. In other embodiments, the k.sub.off is determined using a bivalent antibody as measured by, e.g., BIAcore® surface plasmon resonance technology.

(39) Provided herein are anti-idiotype antibodies (anti-Id) antibodies that specifically bind to anti-CD19 clone 4G7 and antigen binding molecules derived from 4G7, comprising a variable heavy chain (VH), wherein the amino acid sequence or polynucleotide sequence of the VH is selected from the VH sequences presented in Table 1a.

(40) TABLE-US-00004 TABLE 1a Heavy Chain Variable Regions (VH) SEQ ID Clone VH Sequence NO: Amino Acid Sequence A8 QVQLQQSGAELVKPGASVKVSCKAFGYTFTTYPIEWMRQN 1 HGKSLEWIGNFHPYNDDTRYNEKFKDKAKLTVEKSSSTVY LELSRLTYDDSAVYYCTRGNDYDLYGMDYWGQGTSVTVSS B4 QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWIKQR 2 PGQGLEWIGVINpGSGGINYNEKFKGKATLTSDKSSSTAY MQLSSLTSDDSAVYFCARWLDYDWFAYWGQGTLVTVSA E11 QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQR 3 PGQGLEWIGVITpGSGGSNYNEKFKGKATLTADKSSSTAY MQLSSLTSDDSAVYFCARWLDYDWFAYWGQGTLVTVSA E2 QVQLQQSGAELVKPGASVKVSCKAFGYTFTTYPIEWMRQN 1 HGKSLEWIGNFHpYNDDTRYNEKFKDKAKLTVEKSSSTVY LELSRLTYDDSAVYYCTRGNDYdlYGMDYWGQGTSVTVSS Polynucleotide Sequence A8 CAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTGGTGAAGC 4 CTGGGGCCTCAGTGAAGGTGTCCTGCAAGGCTTTTGGCTA CACCTTCACTA CCTATCCAATAGAGTGGATGAGGCAGAA TCATGGAAAGAGCCTAGAGTGGATTGGAAATTTTCATCCT TACAATGATGATACTAGGTACAATGAAAAATTCAAGGACA AGGCCAAATTGACTGTAGAAAAATCCTCTAGCACAGTCTA CTTGGAGCTCAGCCGATTAACATATGATGACTCTGCTGTT TATTACTGTACAAGGGGGAATGATTACGACCTCTATGGTA TGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTC A B4 CAGGTCCAGCTGCAGCAGTCTGGAGCTGAACTGGTAAGGC 5 CTGGGACTTCAGTGAAGGTGTCCTGCAAGGCTTCTGGATA CGCCTTCACTAATTATTTGATAGAGTGGATAAAGCAGAGG CCTGGACAGGGCCTTGAGTGGATTGGAGTGATTAATCCTG GAAGTGGTGGTATTAATTATAATGAGAAGTTCAAGGGCAA GGCAACACTGACTTCAGACAAATCCTCCAGCACTGCCTAC ATGCAGCTCAGCAGCCTGACATCTGATGACTCTGCGGTCT ATTTCTGTGCAAGATGGCTTGATTACGACTGGTTTGCTTA CTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA E11 CAGGTCCAGCTGCAGCAGTCTGGAGCTGAGCTGGTAAGGC 6 CTGGGACTTCAGTGAAGGTGTCCTGCAAGGCCTCTGGGTA CGCCTTCACTAATTATTTGATAGAGTGGGTAAAGCAGAGG CCTGGACAGGGCCTAGAGTGGATTGGAGTGATTACTCCTG GAAGTGGCGGTTCTAACTACAATGAGAAGTTCAAGGGCAA GGCAACACTGACTGCAGACAAATCCTCCAGCACTGCCTAC ATGCAGCTCAGCAGCCTGACATCTGATGACTCTGCGGTCT ACTTCTGTGCAAGATGGCTTGATTACGACTGGTTTGCTTA CTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA E2 CAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTGGTGAAGC 4 CTGGGGCCTCAGTGAAGGTGTCCTGCAAGGCTTTTGGCTA CACCTTCACTACCTATCCAATAGAGTGGATGAGGCAGAAT CATGGAAAGAGCCTAGAGTGGATTGGAAATTTTCATCCTT ACAATGATGATACTAGGTACAATGAAAAATTCAAGGACAA GGCCAAATTGACTGTAGAAAAATCCTCTAGCACAGTCTAC TTGGAGCTCAGCCGATTAACATATGATGACTCTGCTGTTT ATTACTGTACAAGGGGGAATGATTACGACCTCTATGGTAT GGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA

(41) Provided herein are anti-idiotype antibodies (anti-Id) antibodies that specifically bind to anti-CD19 clone 4G7, comprising a variable light chain (VL), wherein the amino acid sequence or polynucleotide sequence of the VL is selected from the VL sequences presented in Table 1b.

(42) TABLE-US-00005 TABLE 1b Light Chain Variable Regions SEQ ID Clone VL Sequence NO: Amino Acid Sequence A8 DIKMTQSPSSMYASLGERVTITCKASQDINTYLTWFQQKP  7 GKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEY EDMGIYYCLQCDDFPLTFGAGTKLELK B4 DIKMTQFPSSMYASVGERVTITCKASQDINSYLSWFQQKP  8 GKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEY EDMGIYYCLQCDEFPFTFGGGTKLEIK E11 DIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKP  9 GKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEY EDMGIYYCRQCDEFPSTFGGGTKLEIK E2 DIKMTQFPSSMYASLGERVTITCKASQDINTYLTWFQQKP 10 GKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEY EDMGIYYCLQCDDFPLTFGAGTKLELK Polynucleotide Sequence A8 GACATCAAGATGACCCAGTCTCCATCTTCCATGTATGCAT 11 CTCTAGGAGAGAGAGTCACTATCACTTGCAAGGCGAGTCA GGACATTAATACCTATTTAACCTGGTTCCAGCAGAAACCA GGGAAATCTCCTAAGACCCTGATCTATCGTGCAAACAGAT TGGTAGATGGGGTCCCATCAAGGTTCAGTGGCAGTGGATC TGGGCAAGATTATTCTCTCACCATCAGCAGCCTGGAGTAT GAAGATATGGGAATTTATTATTGTCTACAGTGTGATGATT TTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAA A B4 GACATCAAGATGACCCAGTTTCCATCTTCCATGTATGCAT 12 CTGTAGGAGAGAGAGTCACTATCACTTGCAAGGCGAGTCA GGACATTAATAGCTATTTAAGCTGGTTCCAGCAGAAACCA GGGAAATCTCCTAAGACCCTGATTTATCGTGCAAACAGAT TGGTAGATGGGGTCCCATCAAGGTTCAGTGGCAGTGGATC TGGGCAAGATTATTCTCTCACCATCAGCAGCCTGGAGTAT GAAGATATGGGAATTTATTATTGTCTACAGTGTGATGAGT TTCCGTTCACGTTCGGAGGGGGGACCAAGCTGGAAATAAA A E11 GACATCAAGATGACCCAGTCTCCATCTTCCATGTATGCAT 13 CTCTAGGAGAGAGAGTCACTATCACTTGCAAGGCGAGTCA GGACATTAATAGCTATTTAAGCTGGTTCCAGCAGAAACCA GGGAAATCTCCTAAGACCCTGATCTATCGTGCAAACAGAT TGGTAGATGGGGTCCCATCAAGGTTCAGTGGCAGTGGATC TGGGCAAGATTATTCTCTCACCATCAGCAGCCTGGAGTAT GAAGATATGGGAATTTATTATTGTCGACAGTGTGATGAGT TTCCGTCCACGTTCGGAGGGGGGACCAAGCTGGAAATAAA A E2 GACATCAAGATGACCCAGTTTCCATCTTCCATGTATGCAT 14 CTCTAGGAGAGAGAGTCACTATCACTTGCAAGGCGAGTCA GGACATTAATACCTATTTAACCTGGTTCCAGCAGAAACCA GGGAAATCTCCTAAGACCCTGATCTATCGTGCAAACAGAT TGGTAGATGGGGTCCCATCAAGGTTCAGTGGCAGTGGATC TGGGCAAGATTATTCTCTCACCATCAGCAGCCTGGAGTAT GAAGATATGGGAATTTATTATTGTCTACAGTGTGATGATT TTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAA A

(43) Provided herein are anti-idiotype antibodies (anti-Id) antibodies that specifically bind to anti-CD19 clone 4G7 and antigen binding molecules derived from 4G7, wherein anti-Id antibodies comprise a variable heavy chain (VH) and a variable light chain (VL), wherein the amino acid sequence or polynucleotide sequence of the VH is selected from the V sequences presented in Table 1a; and wherein the amino acid sequence or polynucleotide sequence of the VL is selected from the VL sequences presented in Table 1b.

(44) In some embodiments, the anti-idiotype antibodies (anti-Id) antibodies that specifically bind to anti-CD19 clone 4G7 and antigen binding molecules derived from 4G7, comprise a VH CDR 1, CDR2, and CDR3 of a VH sequence presented in Table 1a. In some embodiments, the VH CDR 1, CDR2, and CDR3 are selected from a CDR sequence presented in Table 1c.

(45) TABLE-US-00006 TABLE 1c Heavy Chain CDRs CDR1 VH SEQ CDR1 VH SEQ Sequence ID Sequence ID Clone (Chothia) NO: (Kabat) NO: A8 GYTFTTY 15 TYPIE 21 B4 GYAFTNY 24 NYLIE 29 E11 GYAFTNY 24 NYLIE 29 E2 GYTFTTY 15 TYPIE 21 CDR2 VH SEQ CDR2 VH SEQ Sequence ID Sequence ID Clone (Chothia) NO: (Kabat) NO: A8 HPYNDD 16 NFHPYNDDTRYNEKFKD 22 B4 NPGSGG 25 VINPGSGGINYNEKFKG 30 E11 TPGSGG 31 VITPGSGGSNYNEKFKG 33 E2 HPYNDD 16 NFHPYNDDTRYNEKFKD 22 CDR3 VH SEQ CDR3 VH SEQ Sequence ID Sequence ID Clone (Chothia) NO: (Kabat) NO: A8 GNDYDLYGMDY 17 GNDYDLYGMDY 23 B4 WLDYDWFAY 26 WLDYDWFAY 26 E11 WLDYDWFAY 26 WLDYDWFAY 26 E2 GNDYDLYGMDY 17 GNDYDLYGMDY 23

(46) In some embodiments, the anti-idiotype antibodies (anti-Id) antibodies that specifically bind to anti-CD19 clone 4G7 and antigen binding molecules derived from 4G7, comprise a VL CDR 1, CDR2, and CDR3 of a VL sequence presented in Table 1b. In some embodiments, the VH CDR 1, CDR2, and CDR3 are selected from a CDR sequence presented in Table 1d.

(47) TABLE-US-00007 TABLE 1d Light Chain CDRs SEQ Clone CDR1 VL Sequence (Kabat and Chothia) ID NO: A8 KASQDINTYLT 18 B4 KASQDINSYLS 27 E11 KASQDINSYLS 27 E2 KASQDINTYLT 18 SEQ Clone CDR2 VL Sequence (Kabat and Chothia) ID NO: A8 RANRLVD 19 B4 RANRLVD 19 E11 RANRLVD 19 E2 RANRLVD 19 SEQ Clone CDR3 VL Sequence (Kabat and Chothia) ID NO: A8 LQCDDFPLT 20 B4 LQCDEFPFT 28 E11 RQCDEFPST 32 E2 LQCDDFPLT 20

(48) The DNA and amino acid sequences of the heavy chain and light chain of clone A8 are shown below:

(49) 2153.2H8.A8 mouse IgG1 heavy chain DNA sequence

(50) TABLE-US-00008 (SEQ ID NO: 37) ATGGCGTGGATCTCTATCATCCTCTTCCTAGTGGCAACAGCTATAGGTGTC CACTCCCAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTGGTGAAGCCTGGG GCCTCAGTGAAGGTGTCCTGCAAGGCTTTTGGCTACACCTTCACTACCTAT CCAATAGAGTGGATGAGGCAGAATCATGGAAAGAGCCTAGAGTGGATTGGA AATTTTCATCCTTACAATGATGATACTAGGTACAATGAAAAATTCAAGGAC AAGGCCAAATTGACTGTAGAAAAATCCTCTAGCACAGTCTACTTGGAGCTC AGCCGATTAACATATGATGACTCTGCTGTTTATTACTGTACAAGGGGGAAT GATTACGACCTCTATGGTATGGACTACTGGGGTCAAGGAACCTCAGTCACC GTCTCCTCAGCCAAAACGACACCCCCATCTGTCTATCCACTGGCCCCTGGA TCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGC TATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGC GGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGC AGCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGC AACGTTGCCCACCCGGCCAGCAGCACCAAGGTGGACAAGAAAATTGTGCCC AGGGATTGTGGTTGTAAGCCTTGCATATGTACAGTCCCAGAAGTATCATCT GTCTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACTCTGACT CCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCGAGGTC CAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAA CCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCC ATCATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAAC AGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGC AGACCGAAGGCTCCACAGGTGTACACCATTCCACCTCCCAAGGAGCAGATG GCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAA GACATTACTGTGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAG AACACTCAGCCCATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAG CTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACCTGCTCT GTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCAC TCTCCTGGTAAATGA

(51) 2153.2H8.A8 mouse IgG1 heavy chain amino acid sequence

(52) TABLE-US-00009 MAWISIILFLVATAIGVHSQVQLQQSGAELVKPGASVKVSCKAFGYTFTTY PIEWMRQNHGKSLEWIGNFHPYNDDTRYNEKFKDKAKLTVEKSSSTVYLEL SRLTYDDSAVYYCTRGNDYDLYGMDYWGQGTSVTVSSAKTTPPSVYPLAPG SAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLS SSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSS VFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQ PREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKG RPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYK NTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSH SPGK (SEQ ID NO: 38, underlined is a signal sequence)

(53) 2153.2H8.A8 mouse IgG1 heavy chain amino acid sequence without the signal sequence

(54) TABLE-US-00010 (SEQ ID NO: 39) QVQLQQSGAELVKPGASVKVSCKAFGYTFTTYPIEWMRQNHGKSLEWIGNF HPYNDDTRYNEKFKDKAKLTVEKSSSTVYLELSRLTYDDSAVYYCTRGNDY DLYGMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYF PEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNV AHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPK VTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIM HQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAK DKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLN VQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

(55) 2153.2H8.A8 mouse kappa light chain DNA sequence

(56) TABLE-US-00011 (SEQ ID NO: 40) ATGAGGACCCCTGCTCAGTTTCTTGGAATCTTGTTGCTCTGGTTTCCAGGT ATCAAATGTGACATCAAGATGACCCAGTCTCCATCTTCCATGTATGCATCT CTAGGAGAGAGAGTCACTATCACTTGCAAGGCGAGTCAGGACATTAATACC TATTTAACCTGGTTCCAGCAGAAACCAGGGAAATCTCCTAAGACCCTGATC TATCGTGCAAACAGATTGGTAGATGGGGTCCCATCAAGGTTCAGTGGCAGT GGATCTGGGCAAGATTATTCTCTCACCATCAGCAGCCTGGAGTATGAAGAT ATGGGAATTTATTATTGTCTACAGTGTGATGATTTTCCGCTCACGTTCGGT GCTGGGACCAAGCTGGAGCTGAAACGGGCTGATGCTGCACCAACTGTATCC ATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTG TGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATT GATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGAC AGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGAC GAGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCA ACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTAG

(57) 2153.2H8.A8 mouse kappa light chain amino acid sequence

(58) TABLE-US-00012 MRTPAQFLGILLLWFPGIKCDIKMTQSPSSMYASLGERVTITCKASQDINT YLTWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEYED MGIYYCLQCDDFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVV CFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKD EYERHNSYTCEATHKTSTSPIVKSFNRNEC (SEQ ID NO: 41, underlined is a signal sequence)

(59) 2153.2H8.A8 mouse kappa light chain amino acid sequence without the signal sequence

(60) TABLE-US-00013 (SEQ ID NO: 42) DIKMTQSPSSMYASLGERVTITCKASQDINTYLTWFQQKPGKSPKTLIYRA NRLVDGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQCDDFPLTFGAGT KLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGS ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSP IVKSFNRNEC

(61) The disclosure encompasses modifications to the anti-Id antibodies comprising the sequences shown in Tables 1a to 1d, including functionally equivalent anti-Id antibodies having modifications which do not significantly affect their properties and variants which have enhanced or decreased activity and/or affinity. For example, the amino acid sequence can be mutated to obtain an anti-Id antibody with the desired binding affinity to anti-CD19 clone 4G7 and antigen binding molecules derived from 4G7. Modification of polypeptides is routine practice in the art and thus need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or the use of chemical analogs.

(62) Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions rangingginlengthfromoneresiduetopolypeptidescontainingahundredormoreresidues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminalinsertionsincludeanantibodywithanN-terminalmethionylresidueorthe antibody fused to an epitope tag. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.

(63) Substitution variants have at least one amino acid residue in the antigen binding domain removed and a different residue inserted in its place. In some embodiments, sites of interest for substitutional mutagenesis include the hypervariable regions/CDRs, but FR alterations are also contemplated. Conservative substitutions are shown in Table 2 under the heading of “conservative substitutions”. If such substitutions result in a change in biological activity, then more substantial changes, denominated “exemplary substitutions” in Table 2, or as further described below in reference to amino acid classes, can be introduced and the products screened.

(64) TABLE-US-00014 TABLE 2 Amino Acid Substitutions Original Residue (naturally occurring Conservative Exemplary amino acid) Substitutions Substitutions Ala (A) Val Val; Leu; Ile Arg (R) Lys Lys; Gln; Asn Asn (N) Gln Gln; His; Asp, Lys; Arg Asp (D) Glu Glu; Asn Cys (C) Ser Ser; Ala Gln (Q) Asn Asn; Glu Glu (E) Asp Asp; Gln Gly (G) Ala Ala His (H) Arg Asn; Gln; Lys; Arg Ile (I) Leu Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Ile Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg Arg; Gln; Asn Met (M) Leu Leu; Phe; Ile Phe (F) Tyr Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr Tyr; Phe Tyr (Y) Phe Trp; Phe; Thr; Ser Val (V) Leu Ile; Leu; Met; Phe; Ala; Norleucine
III. Methods of Making Anti-Id Antibodies

(65) For cloning of polynucleotides, the vector can be introduced into a host cell (an isolated host cell) to allow replication of the vector itself and thereby amplify the copies of the polynucleotide contained therein. The cloning vectors can contain sequence components generally include, without limitation, an origin of replication, promoter sequences, transcription initiation sequences, enhancer sequences, and selectable markers. These elements can be selected as appropriate by a person of ordinary skill in the art. For example, the origin of replication can be selected to promote autonomous replication of the vector in the host cell.

(66) In certain embodiments, the present disclosure provides isolated host cells containing the vector provided herein. The host cells containing the vector can be useful in expression or cloning of the polynucleotide contained in the vector. Suitable host cells can include, without limitation, prokaryotic cells, fungal cells, yeast cells, or higher eukaryotic cells such as mammalian cells. Suitable prokaryotic cells for this purpose include, without limitation, eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescens, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis, Pseudomonas such as P. aeruginosa, and Streptomyces.

(67) The vector can be introduced to the host cell using any suitable methods known in the art, including, without limitation, DEAE-dextran mediated delivery, calcium phosphate precipitate method, cationic lipids mediated delivery, liposome mediated transfection, electroporation, microprojectile bombardment, receptor-mediated gene delivery, delivery mediated by polylysine, histone, chitosan, and peptides. Standard methods for transfection and transformation of cells for expression of a vector of interest are well known in the art. In a further embodiment, a mixture of different expression vectors can be used in genetically modifying a donor population of immune effector cells wherein each vector encodes a different CAR as disclosed herein. The resulting transduced immune effector cells form a mixed population of engineered cells, with a proportion of the engineered cells expressing more than one different CARs.

(68) In one embodiment, the disclosure provides a method of evaluating genetically engineered cells expressing a CAR which targets a CD19 protein. In some embodiments the engineered cells are evaluated after thawing cryopreserved the immune cells.

(69) In some embodiments, the cells are formulated by first harvesting them from their culture medium, and then washing and concentrating the cells in a medium and container system suitable for administration (a “pharmaceutically acceptable” carrier) in a treatment-effective amount. Suitable infusion media can be any isotonic medium formulation, typically normal saline, Normosol™ R (Abbott) or Plasma-Lyte™ A (Baxter), but also 5% dextrose in water or Ringer's lactate can be utilized. The infusion medium can be supplemented with human serum albumin.

(70) In some aspects, the anti-Id antibodies of the present disclosure are used to quantify desired treatment amounts of cells in a composition of engineered T cells comprising a 4G7 derived CAR, e.g., an anti-CD19 CAR (such as a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof. In some embodiments, the desired treatment amount is generally at least 2 cells (for example, at least 1 CD8+ central memory T cell and at least 1 CD4+ helper T cell subset) or is more typically greater than 10.sup.2 cells, and up to 10.sup.6, up to and including 10.sup.8 or 10.sup.9 cells and can be more than 10.sup.10 cells. The number of cells will depend upon the desired use for which the composition is intended, and the type of cells included therein. The density of the desired cells is typically greater than 10.sup.6 cells/ml and generally is greater than 10.sup.7 cells/ml, generally 10.sup.8 cells/ml or greater. A clinically relevant number of immune cells can be apportioned into multiple infusions that cumulatively equal or exceed 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, or 10.sup.12 cells. In some aspects of the present disclosure, particularly since all the infused cells will be redirected to a particular target antigen (CD19), lower numbers of cells, in the range of 10.sup.6/kilogram (10.sup.6-10.sup.11 per patient) can be administered. CAR treatments can be administered multiple times at dosages within these ranges. The cells can be autologous, allogeneic, or heterologous to the patient undergoing therapy.

(71) The CAR expressing cell populations of the present disclosure can be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as TL-2 or other cytokines or cell populations. Pharmaceutical compositions of the present disclosure can comprise a CAR or TCR expressing cell population, such as T cells, as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions can comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure can be formulated for intravenous administration. The pharmaceutical compositions (solutions, suspensions or the like), can include one or more of the following: sterile diluents such as water for injection, saline solution such as physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono- or diglycerides which can serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. An injectable pharmaceutical composition can be sterile.

(72) IV. Methods of Determining Numbers of Cells Expressing a 4G7 Derived Anti-CD19 CAR

(73) The present disclosure provides a method to determine the number of cells present in a sample that are expressing an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501) or a fragment thereof. For example, it can be desirable to determine the number of immune cells present in a sample obtained from a subject that are expressing an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof. Or it can be desirable to determine the number of cells transfected and expressing an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof, which can be used as a measure of the level of efficiency of the transfection. The disclosed method can be employed in these and other applications in which it is desirable to determine the number of cells present in a sample that are expressing a molecule of interest such as an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof.

(74) Thus, a method of determining a number of cells presenting a molecule in a sample wherein the molecule comprises a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof is provided.

(75) In some embodiments, a sample comprising cells known or suspected to be expressing a molecule of interest comprising a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof is provided.

(76) The sample is then contacted with an antigen binding molecule that specifically binds the molecule of interest, under conditions that permit the formation of a binding complex comprising a cell present in the sample and the antigen binding molecule. The antigen binding molecule can be an antigen binding molecule (or fragment thereof) disclosed herein, e.g., in the Figures, Sequence Listing or the instant section of the disclosure. Any antigen binding molecule that specifically binds a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof can be employed in the disclosed method. Multiple examples of suitable antigen binding molecules are provided herein, e.g., those having one or more of the CDRs shown in Tables 1c and 1d and described herein.

(77) The cell can be of any type, and can be human or non-human (e.g., mouse, rat, rabbit, hamster, etc.). In some embodiments, the cell is an immune cell. An immune cell of the method can be any type of immune cell (e.g., B lymphocytes, monocytes, dendritic cells, Langerhans cells, keratinocytes, endothelial cells, astrocytes, fibroblasts, and oligodendrocytes). In some embodiments, the immune cells are T cells including T cytotoxic, T helper and Treg cells. In specific embodiments, the cells are T cells, which can be obtained as described herein and by methods known in the art. Any type of immune cell can be employed in this embodiment of the disclosed method, and the cell can be a human or non-human cell (including both prokaryotic and eukaryotic cells). Exemplary cells include, but are not limited to, immune cells such as T cells, tumor infiltrating lymphocytes (TILs), NK cells, TCR-expressing cells, dendritic cells, and NK-T cells. The T cells can be autologous, allogeneic, or heterologous. In additional embodiments, the cells are T cells presenting a CAR. The T cells can be CD4+ T cells or CD8+ T cells. When a T cell is employed in the disclosed methods, the T cell can be an in vivo T cell or an in vitro T cell. Moreover, the cells can be disposed in, or isolated from, any environment capable of maintaining the cells in a viable form, such as blood, tissue or any other sample obtained from a subject, cell culture media, tissue grown ex vivo, a suitable buffer, etc.

(78) In some embodiments, the sample comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof is contacted with an anti-Id antibody disclosed herein that specifically binds a 4G7 derived binding molecule. In some embodiments, the anti-Id antibody comprises a detectable label. In some embodiments, the detectable label conjugated anti-Id antibody is contacted with the sample expressing an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A), under conditions that permit the formation of a binding complex comprising a cell present in the sample and the anti-Id antibody. Any anti-Id antibody that specifically binds an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) can be employed in the disclosed method. Multiple examples of suitable anti-Id antibody are provided herein, e.g., those having one or more of the CDRs shown in Table 1c or 1d.

(79) Any detectable label can be employed in the methods, as described herein, and suitable labels can be selected using a desired set of criteria. Examples of types of detectable labels include fluorescent labels (e.g., fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malachite green, stilbene, Lucifer Yellow, Cascade Blue, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cas-cade Yellow and R-phycoerythrin (PE) (Molecular Probes), FITC, Rhodamine, and Texas Red (Pierce), Cy5, Cy5.5, Cy7 (Amersham Life Science). Suitable optical dyes, including fluoro-phores, are described in Johnson, Molecular Probes Handbook: A Guide to Fluorescent Probes and Labeling Techniques, 11.sup.th Edition, Life Technologies, (2010), hereby expressly incorporated by reference, radiolabels (e.g., isotope markers such as .sup.3H, .sup.11C, .sup.14C, .sup.15N, .sup.18F, .sup.35S, .sup.64CU, .sup.90Y, .sup.99Tc, .sup.111In, .sup.124I, .sup.125I, .sup.131I), photochromic compounds, a Halo-tag, Atto dyes, Tracy dyes, proteinaceous fluorescent labels (e.g., proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., (1994) Science 263:802-805), EGFP (Clon-tech Labs., Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc; Stauber, (1998) Biotechniques 24:462-471; Heim et al., (1996) Curr. Biol. 6: 178-182), enhanced yellow fluorescent protein (Clontech Labs., Inc.), luciferase (Ichiki et al., (1993) J. Immunol. 150:5408-5417), magnetic labels (e.g., DYNABEADS), etc. Strategies for the labeling of proteins are well known in the art and can be employed in the disclosed method. See, e.g., Obermaier et al., (2015) Methods MolBiol 1295:153-65; Strack (2016) Nature Methods 13:33; Site-Specific Protein Labeling: Methods and Protocols, (Gautier and Hinner, eds.) 2015, Springer. In some embodiments, the detectable label is a phycoerythrin (PE) or allophycocyanin (APC) fluorescent probe.

(80) The label can be associated with the anti-Id antibody at any position in the molecule, although it can be desirable to associate the label with the antibody at a position (or positions, if multiple labels are employed) at a point such that the binding properties of the molecule are not modified (unless such modified binding activity is desired). Any antigen binding molecule that specifically binds a 4G7 derived binding molecule (or fragment thereof) can be employed, such as those disclosed herein, e.g., those having one or more of the CDRs shown in Table 1c or 1d.

(81) The antigen binding molecule can be disposed on any surface, or no surface at all. For example, the antigen binding molecule can be present in a buffer and the buffer-antigen binding molecule can be contacted with the sample. Alternatively, the antigen binding molecule can be associated with a surface. Suitable surfaces include agarose beads, magnetic beads such as DYNABEADS®, or a plastic, glass or ceramic plate such as a welled plate, a bag such as a cell culture bag, etc. The surface can itself be disposed in another structure, such as a column.

(82) Conditions that permit the formation of a binding complex will be dependent on a variety of factors, however generally aqueous buffers at physiological pH and ionic strength, such as in phosphate-buffered saline (PBS), will favor formation of binding complexes and are desirable in the disclosed method.

(83) The number of cells present in a binding complex in the sample is determined. The specific method employed to determine the number of cells present in a binding complex will be dependent on the nature of the label selected. For example, FACS can be employed when a fluorescent label is selected; when an isotope label is selected mass spectrometry, NMR or other technique can be employed; magnetic-based cell sorting can be employed when a magnetic label is chosen; microscopy can also be employed. The output of these detection methods can be in the form of a number of cells or the output can be of a form that allows the calculation of the number of cells based on the output.

(84) V. Methods of Determining the Presence or Absence of a 4G7 Derived Anti-CD19 CAR

(85) In some embodiments, knowing whether a molecule comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501) or a fragment thereof, is present or absent from a sample is sufficient information. For example, it can be beneficial to know that such a molecule is being expressed, regardless of the level of expression. In other cases, it can be desirable to know if a purification process or step designed to remove such a molecule has been effective. Thus, the qualitative determination of the presence or absence of an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof, can be useful in multiple applications.

(86) In some embodiments, a method of determining the presence or absence in a sample of a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof, in a sample is provided.

(87) In some embodiments, the method comprises providing a sample known or suspected to comprise a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof.

(88) The disclosure provides an antigen binding molecule that specifically binds a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof, which includes a detectable label. Suitable labels can be selected using a desired set of criteria. Examples of types of detectable labels include fluorescent labels (e.g., fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malachite green, stilbene, Lucifer Yellow, Cascade Blue, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cas-cade Yellow and R-phycoerythrin (PE) (Molecular Probes), FITC, Rhodamine, and Texas Red (Pierce), Cy5, Cy5.5, Cy7 (Amersham Life Science)). Suitable optical dyes, including fluorophores, are described in Johnson, Molecular Probes Handbook: A Guide to Fluorescent Probes and Labeling Techniques, 11.sup.th Edition, Life Technologies, (2010), hereby expressly incorporated by reference, radiolabels (e.g., isotope markers such as .sup.3H, .sup.11C, .sup.14C, .sup.15N, .sup.18F, .sup.35S, .sup.64CU, .sup.90Y, .sup.99Tc, .sup.111In, .sup.124I, .sup.125I, .sup.131I). Photochromic compounds, a Halo-tag, Atto dyes, Tracy dyes, proteinaceous fluorescent labels (e.g., proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., (1994) Science 263:802-805), EGFP (Clon-tech Labs, Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc.; Stauber, (1998) Biotechniques 24:462-471; Heim et al., (1996) Curr. Biol. 6: 178-182), enhanced yellow fluorescent protein (Clontech Labs, Inc.), luciferase (Ichiki et al., (1993) J. Immunol. 150:5408-5417), magnetic labels (e.g., DYNABEADS®), etc. can also be employed. Strategies for the labeling of proteins are well known in the art and can be employed in the disclosed methods. The label can be associated with the antigen binding molecule at any position in the molecule, although it can be desirable to associate the label with the molecule at a position (or positions, if multiple labels are employed) at a point such that the binding properties of the molecule are not modified (unless such modified binding activity is desired). Any antigen binding molecule that specifically binds a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof can be employed, such as those disclosed herein, e.g., those having one or more of the CDRs described in Tables 1c and 1d.

(89) Next, the sample is contacted with the antigen binding molecule under conditions that permit the formation of a binding complex comprising a cell present in the sample and the antigen binding molecule.

(90) The sample is contacted with the antigen binding molecule, under conditions that permit the formation of a binding complex between a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof and the antigen binding molecule. Conditions that permit the formation of a binding complex will be dependent on a variety of factors. Since the component parts of a binding complex can be disposed on surfaces as described herein, formed binding complexes can also be disposed on surfaces.

(91) At this stage, no binding complexes can have formed, or a plurality of binding complexes comprising one or more antigen binding molecules bound to a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof can have formed. Unbound molecules comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof and/or unbound antigen binding molecules can also be present in the local environment of any formed binding complexes.

(92) Any molecules not part of a binding complex are then separated from any formed binding complexes. The method of the removal will depend on the structure and/or local environment of the binding complexes. For example, if the antigen binding molecule is disposed on a bead, plate or bag the unbound components of the reaction mixture can be washed away using a solution that leaves formed binding complexes intact. In some embodiments, separation of the binding complex is not required for detection.

(93) The solution used to induce the formation of binding complexes can be used, for example, as a wash solution to remove unbound components. Any suitable buffer or solution that does not disrupt formed binding complexes can also be used. Typically, buffers having high salt concentrations, non-physiological pH, containing chaotropes or denaturants, should be avoided when performing this step of the method.

(94) The presence or absence of a binding complex, which will comprise a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof and an antigen binding molecule, can be detected. The specific method employed to detect the presence or absence of a binding complex will typically be dependent on the nature of the label selected. In some embodiments, the detection method is by colorimetric assay. The result of the method is a qualitative assessment of the presence or absence of the antigen binding molecule comprising the detectable label, and thus, the presence or absence of its binding partner, a polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof.

(95) As is the case with the disclosed methods, the polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof can be disposed in any environment. In some embodiments, the polypeptide comprising an anti-CD19 CAR (e.g., a CAR comprising a 4G7-derived scFv such as UCART19 or ALLO-501 or ALLO-501A) or a fragment thereof is expressed on the surface of a cell. In this embodiment, the cell can be of any type, and can be human or non-human (e.g., mouse, rat, rabbit, hamster, etc.). In some embodiments, the cell is an immune cell. An immune cell of the method can be any type of immune cell (e.g., B lymphocytes, monocytes, dendritic cells, Langerhans cells, keratinocytes, endothelial cells, astrocytes, fibroblasts, and oligodendrocytes). T cells (including T cytotoxic, T helper and Treg cells) are especially suitable. In specific embodiments, the cells are T cells, which can be obtained as described herein and by methods known in the art. Any type of immune cell can be employed in this embodiment of the disclosed method, and the cell can be a human or non-human cell. Exemplary cells include, but are not limited to, immune cells such as T cells, tumor infiltrating lymphocytes (TILs), NK cells, dendritic cells, and NK-T cells. The T cells can be autologous, allogeneic, or heterologous. In additional embodiments, the cells are T cells presenting a TCR. The T cells can be CD4+ T cells or CD8+ T cells. When a T cell is employed in the disclosed methods, the T cell can be an in vivo T cell or an in vitro T cell. Further, cells can be derived from a stem cell, such as an iPSC cell, cord blood cell, or mesenchymal stem cell.

(96) In some embodiments, the cell can be disposed in, or isolated from, any environment capable of maintaining the cell in a viable form, such as blood, tissue or any other sample obtained from a subject, cell culture media, tissue grown ex vivo, a suitable buffer, etc. In some embodiments, the cell is in a formalin-fixed sample. In some embodiments, the sample is a formalin-fixed paraffin embedded tissue (FFPE).

INCORPORATION BY REFERENCE

(97) All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. However, the citation of a reference herein should not be construed as an acknowledgement that such reference is prior art to the present disclosure. To the extent that any of the definitions or terms provided in the references incorporated by reference differ from the terms and discussion provided herein, the present terms and definitions control.

(98) The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the disclosure. The foregoing description and Examples that follow detail certain embodiments of the disclosure and describe the best mode contemplated by the inventors. It will be appreciated, however, that no matter how detailed the foregoing can appear in text, the disclosure can be practiced in many ways and the disclosure should be construed in accordance with the appended claims and any equivalents thereof.

EXAMPLES

Example 1: Generation of Anti-Idiotypic Antibodies to Anti-Human CD19 Antibody Clone 4G7

(99) Balb/c mice were immunized with a 4G7-human Fab-8×His fusion protein (E2153) (“8×His” disclosed as SEQ ID NO: 45). Hybridomas were generated, cloned, and the secreted antibodies were screened for binding specificity to 4G7. Six E2153 generated subclones (E2153.1C4.E2, E2153.1D9.B4, E2153.1G5.H5, E2153.2H8.A8, E2153.3B11.B7, E2153.4D7.E11) were purified for further analysis. Antibody clones were identified and selected based on their ability to specifically bind the 4G7-derived scFv of the UCART19 and ALLO-501 CARs.

Example 2: Kinetic Analysis of Anti-Idiotypic Antibodies to Anti-Human CD19 Antibody Clone 4G7

(100) Anti-m4G7 purified sub-clone antibodies were tested for binding to m4G7-hFab. Blocking effect was determined using a sandwich assay and binding confirmation to m4G7-scFv-Fc was determined using a Biacore assay at 25° C. Five of the purified anti-Ids sub-clones from Fusion E2153 demonstrate bind to m4G7-hFab. Sensor chip CAP (CAPture chip) #505 was used as a surface. After rehydrating the sensor chip CAP with water at 42° C. for 1 hour, the chip was dried with compressed air. The surface of the chip was conditioned using triplicate 1 min injections of regeneration solution at 10 μl/min. The regeneration solution included 3 parts of Regeneration Stock 1 (8 M guanidine-HCl) with 1 part Regeneration Stock 2 (1 M NaOH). Capture of Biotin CAPture reagent for 5 min at 2 μl/min was followed by capture of biotinylated Fusion E2153 anti-m4G7 purified sub-clones antibodies and control antibodies at 10 μg/ml for 1 min at 10 μl/min. As shown in FIG. 1, all biotinylated anti-Ids sub-clones captured well to the CAPture chip.

(101) Blocking was performed with 20 μM amine-PEO-biotin for 1 min at 10 μl/min. Surfaces were regenerated with regeneration solution (mixture of 3 parts of Regeneration Stock 1 (8 M guanidine-HCl) with 1 part of Regeneration Stock 2 (1 M NaOH)) for 2 min at 10 μL/min. The 6 purified anti-Ids subclones from Fusion E2153 Balb/c mouse immunized with m4G7-hFab included E2153.1C4.E2 (0.51 mg/mL), E2153.1D9.B4 (0.41 mg/mL), E2153.1G5.H5 (0.37 mg/mL), E2153.2H8.A8 (0.45 mg/mL), E2153.3B11.B7 (0.49 mg/mL), and E2153.4D7.E11 (0.35 mg/mL).

(102) The following reagents were also used for the kinetic analysis at the indicated concentrations: m4G7-hFab: m4G7 hFab 8×His, 0.92 mg/ml (“8×His” disclosed as SEQ ID NO: 45) m4G7-scFv-Fc: 0.8 mg/ml, assumed M.W. 52 kDa hCD19: hCD19-HIS-AVI 33.386 kDa assumed to be 18.4% active by CFCA (0.736 μM active concentration) Framework ctrl: Framework match control for m4G7—Fab, 0.82 mg/ml a-hKappa: control: biotinylated mouse anti-human kappa IgG1—monoclonal, Southern Biotech, 0.5 mg/ml a-His: control: biotinylated mouse anti-His antibody control. R&D systems Cat. No. MAB050B

(103) For the kinetics assay, the buffer and m4G7-hFab at 1 nM, 10 nM, and 100 nM were injected for 2 min at 30 μL/min followed by 5 min dissociation. A summary of the binding kinetics is shown in Table 3. Kinetic fits for m4G7-hFab binding to 6 purified anti-Ids sub-clones from Fusion E2153 at 25° C. are shown in FIG. 2A. Kinetic fits for m4G7-hFab binding to negative control buffer at 25° C. are shown in FIG. 2B.

(104) TABLE-US-00015 TABLE 3 Kinetics m4G7-hFab binding to 6 purified anti-Ids sub-clones from Fusion E2153 Sample ID k.sub.a (1/Ms) k.sub.d (1/s) t.sub.1/2 (min) K.sub.d (pM) E2153.1C4.E2 7.65 × 10.sup.6 1.28 × 10.sup.−4 90 16.7 E2153.3B11.B7 7.39 × 10.sup.6 9.37 × 10.sup.−5 123 12.7 E2153.2H8.A8 7.35 × 10.sup.6 1.06 × 10.sup.−4 109 14.4 E2153.4D7.E11 very high affinity; outside instrument limits; heterogeneous at top concentration E2153.1D9.B4 very high affinity; outside instrument limits; heterogeneous at top concentration E2153.1G5.H5 no binding

(105) For binding check to the framework match control for m4G7-hFab and m4G7-scFv-Fc, Buffer, framework match control for m4G7-hFab at 100 nM, m4G7-scFv-Fc at 100 nM, and m4G7-hFab at 100 nM were injected for 2 min at 30 μL/min followed by 5 min dissociation. The six purified anti-Ids sub-clones from Fusion E2153 did not bind to the framework match control for m4G7-hFab. In addition, all anti-Ids sub-clones with the exception of E2153.1G5.H5 bind to m4G7-scFv-Fc. Table 4, summarizes binding determinations for the framework match control for m4G7-hFab and m4G7-scFv-Fc to the purified anti-Ids sub-clones from Fusion E2153 at 25° C.

(106) TABLE-US-00016 TABLE 4 Binding of anti-idiotypic antibodies to framework match control for m4G7-hFab and m4G7-scFv-Fc Captured Binds to Binds to Binds to SampleID to CAP Framework m4G7- m4G7- (biotinylated) surface control hFab scFv-Fc E2153.4D7.E11 Y N Y Y E2153.3B11.B7 Y N Y Y E2153.2H8.A8 Y N Y Y E2153.1G5.H5 Y N N N E2153.1D9.B4 Y N Y Y E2153.1C4.E2 Y N Y Y a-His control Y Y Y N

(107) The blocking effect of m4G7-hFab binding to hCD19 by the purified anti-Ids sub-clones from Fusion E2153 was determined by the sandwich assay at 25° C. Sample 1 was injected for 2 min at 30 μL/min followed by 10 sec in buffer then Sample 2 was injected for 2 min at 30 μL/min followed by 3 min dissociation:

(108) TABLE-US-00017 Sample 1 Sample 2 buffer buffer buffer hCD19 (300 nM) m4G7-hFab (100 nM) buffer m4G7-hFab (100 nM) hCD19 (300 nM)

(109) As shown in Table 5, no hCD19 sandwiches were observed with any of the m4G7 anti-Ids purified sub-clones. This data suggests that the anti-Id sub-clones do not bind hCD19.

(110) TABLE-US-00018 TABLE 5 Blocking Effect of m4G7-hFab binding to hCD19 by to 6 purified anti-Ids sub-clones Binds To Sandwiches SampleID m4G7-hFab With hCD19 E2153.4D7.E11 yes no E2153.3B11.B7 yes no E2153.2H8.A8 yes no E2153.1G5.H5 no no E2153.1D9.B4 yes no E2153.1C4.E2 yes no Ms a-human yes yes Kappa (+) control

Example 3: Comparison of Anti-UCART19 Antibodies

(111) Commercially available anti mouse F(ab′)2 antibody from Jackson Immunoresearch and antibodies A8 and E11 antibodies described in Examples 1 and 2, were tested at four UCART19 concentrations (blank, 100,000 cells per mL in blood, 1 million cells per mL in blood and 10 million cells per mL in PBS). Exemplary flow cytometry plots are shown in FIGS. 3A and 3B. Tube A included blood from a healthy volunteer; Tube B: blood from healthy volunteer+100,000 UCART19 transduced cells per mL; Tube C: blood from healthy volunteer+1 million UCART19 transduced cells per mL and Tube D: 10 million UCART19 transduced cells per mL.

(112) The A8 antibody detects the UCART19 positive cells in the absence of aspecific binding. The E11 antibody shows slight aspecific binding. The A8 and E11 antibodies give a strong PE positive signal allowing clear discrimination between UCART19 positive and negative cells. A ten-fold increase in % CAR+ cells is seen between tube B and C both for detection with the A8 and E11 antibody. For tube D, a 20-fold increase is seen rather than the expected 10-fold increase.

Example 4: Blocking UCART19

(113) Fresh UCART19 cells were stained with serial dilutions of unconjugated anti-UCART19 idiotype antibody A8 (E2153.2H8.A8), and unconjugated mouse IgG1 Isotype control. Cells were incubated at 4° C. for 20 min followed by a wash with BD FACS stain buffer. Secondary staining was performed with AF647-conjugated soluble CD19-hFc for 20 min at 4° C. Cells were washed with BD FACS stain buffer followed by flow cytometry. As shown in FIGS. 4A-4C, anti-UCART19 antibody blocks APC-sCD19 binding. FIGS. 4B and 4C show flow cytometry plots of increasing concentration of idiotype Ab A8 (E2153.2H8.A8) (FIG. 4B) and unconjugated mouse IgG1 Isotype control (FIG. 4C).

(114) Blocking of UCART19 cells with anti-idiotype antibody A8 was also assessed on thawed UCART19 cells. Target Raji-Luc-GFP cells were plated at 5000 cells/well in 50 uL. UCART19 cells were thawed and allowed to recover at 37° C. for 1 hour. After recovery, UCART19 concentration was adjusted to 5:1 and 10:1 effector:target ratios (E:T) using Day 13 CAR % data. UCART19 cells were incubated at 37° C. for 30 minutes using various concentrations of antibody (m4G7 anti-Id and IgG1 Isotype). Each ratio was plated in triplicates on the Raji-Luc-GFP. The cell mixture was incubated at 37° C. for about 24 hours. 100 μL of Promega Bright Glo reagent was added to each well, mixed, incubated at room temperature for 3 minutes and then read on a luminometer. Target cells were normalized to be 0% lysed and % lysed was computed using the target alone cells. FIGS. 4D and 4E show blocking ability of anti-Id m4G7 (A8) at 5:1 and 10:1 E:T ratios, respectively.

Example 5: Binding of Anti-Idiotype Antibodies to 4G7 Derived Chimeric Antigen Receptors

(115) This example demonstrates specific binding of anti-idiotype antibodies to CARs to both human h4G7.7 and murine m4G7 CARs. As shown in FIG. 5A, anti-idiotype antibodies described herein bind to Jurkat cells expressing CARs with an scFv derived from murine 4G7 (m4G7) and humanized 4G7 (h4G7.7). Anti-idiotype antibodies of the present disclosure do not bind to CARs with an FMC63 anti-CD19 murine scFv (not related to 4G7) or BC40, an anti-BCMA human scFv. sCD19-Fc binding to all anti-CD19 CARs expressed on Jurkat cells was used as a positive control (FIG. 5B).

(116) Binding of anti-idiotype antibodies to anti-CD19 CARs expressed on primary human T cells. Anti-idiotype antibodies show specific binding to both h4G7.7 and UCART19 expressed on primary human T cells but do not bind to an FMC63-derived CAR (CTL-019) (FIG. 6A). sCD19-Fc binding to all anti-CD19 CARs expressed on primary human T cells was used as a positive control (FIG. 6B).

Example 6: Conjugating Fluorescent Probes for FACS Analysis to Anti-Idiotype Antibodies

(117) As shown in FIG. 7, clone A8 demonstrated a better signal-to-noise ratio at lower test volume than the other anti-idiotype antibodies. Anti-idiotype antibodies were conjugated to phycoerythrin (PE) or allophycocyanin (APC) fluorescent probes for use as a FACS analysis reagent. Both APC conjugation and PE conjugated A8 detected UCART19, however APC-conjugated clone A8 gave a stain index of 102 and PE conjugated A8 gave a stain index of 82 (FIG. 8). When conjugated to a bright fluorochrome (e.g., PE or APC), A8 stains UCART19 or ALLO-501 cells with a high MFI and low background.