ENZYMATIC RNA SYNTHESIS
20220145295 · 2022-05-12
Assignee
Inventors
- George M. CHURCH (Cambridge, MA, US)
- Daniel J. Wiegand (Cambridge, MA, US)
- Richard E. Kohman (Cambridge, MA, US)
- Erkin Kuru (Cambridge, MA, US)
- Jonathan Rittichier (Cambridge, MA, US)
- Nicholas Conway (Cambridge, MA, US)
Cpc classification
C12N2310/3231
CHEMISTRY; METALLURGY
C12N15/111
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
C12P19/34
CHEMISTRY; METALLURGY
International classification
C12N15/113
CHEMISTRY; METALLURGY
C12N9/12
CHEMISTRY; METALLURGY
Abstract
Described herein are methods for the controlled de novo synthesis of RNA oligonucleotides using enzymatic catalysis. For example, provided herein are methods for preparing RNA oligonucleotides via controlled, template-independent addition of nucleotides to an initiator oligonucleotide 3′-terminus via enzymatic catalysis (also known as terminal transferase activity). Single nucleotides can be iteratively added by a compatible polymerase (e.g., a poly(N) polymerase such as a poly(U) polymerase) until a desired RNA oligonucleotide sequence is synthesized. Also provided are nucleotides and polymerases useful in the methods described herein.
Claims
1. A method for template-independent synthesis of an RNA oligonucleotide, the method comprising: (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA; (b) providing a poly(N) polymerase; (c) combining the initiator oligonucleotide, the poly(N) polymerase, and one or more modified nucleotides under conditions sufficient for the addition of at least one modified nucleotide to the 3′ end of the initiator oligonucleotide.
2. The method of claim 1 further comprising: (d) repeating steps (a)-(c) until a desired RNA sequence is obtained.
3. The method of claim 1 or 2 further comprising adding one or more natural or modified nucleotides to the 3′ end of the resulting RNA oligonucleotide until a desired RNA sequence is obtained.
4. The method of any one of claims 1-3, wherein the poly(N) polymerase is a poly(U) polymerase, a poly(A) polymerase, a poly(C) polymerase, or a poly(G) polymerase; or a mutant thereof, or a homolog thereof.
5. The method of any one of claims 1-4, wherein the poly(N) polymerase is a poly(A) polymerase, or a mutant thereof, or a homolog thereof.
6. The method of claim 5, wherein the poly(A) polymerase is wild-type Saccharomyces cerevisiae poly(A) polymerase, or a mutant thereof, or a homolog thereof.
7. The method of claim 5, wherein the poly(A) polymerase is wild-type Saccharomyces cerevisiae poly(A) polymerase.
8. The method of any one of claims 1-4, wherein the poly(N) polymerase is a poly(U) polymerase, or a mutant thereof, or a homolog thereof.
9. The method of claim 8, wherein the poly(U) polymerase is wild-type Schizosaccharomyces pombe poly(U) polymerase, or a mutant thereof, or a homolog thereof.
10. The method of claim 8, wherein the poly(U) polymerase is wild-type Schizosaccharomyces pombe poly(U) polymerase.
11. The method of any one of claims 1-10, wherein at least one of the modified nucleotides is a base-modified nucleotide.
12. The method of claim 11, wherein the base-modified nucleotide comprises a modified base selected from the group consisting of 5-methylcytosine, pyridin-4-one, pyridin-2-one, phenyl, pseudouracil, 3-methyl uracil, dihydrouridine, naphthyl, aminophenyl, 5-alkylcytidines, 5-alkyluridines, 5-halouridines, 6-azapyrimidines, 6-alkylpyrimidines, propyne, quesosine, 2-thiouridine, 4-thiouridine, 4-acetyltidine, 5-(carboxyhydroxymethyl)uridine, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluridine, β-D-galactosylqueosine, 1-methyladenosine, 1-methylinosine, 2,2-dimethylguanosine, 3-methylcytidine, 2-methyladenosine, 2-methylguanosine, N6-methyladenosine, 7-methylguanosine, 5-methoxyaminomethyl-2-thiouridine, 5-methylaminomethyluridine, 5-methylcarbonylmethyluridine, 5-methyloxyuridine, 5-methyl-2-thiouridine, 2-methylthio-N6-isopentenyladenosine, β-D-mannosylqueosine, uridine-5-oxyacetic acid, 2-thiocytidine, N.sup.1-methyl-adenine, N.sup.6-methyl-adenine, 8′-azido-adenine, N,N-dimethyl-adenosine, aminoallyl-adenosine, 5′-methyl-urdine, pseudouridine, N.sup.1-methyl-pseudouridine, 5′-hydroxy-methyl-uridine, 2′-thio-uridine, 4′-thio-uridine, hypoxanthine, xanthine, 5′-methyl-cytidine, 5′-hydroxy-methyl-cytidine, 6′-thio-guanine, and N.sup.7-methyl-guanine, threonine derivatives, pyrimidine derivatives, and purine derivatives.
13. The method of claim 11, wherein the base-modified nucleotide is selected from the group consisting of N.sup.1-methyladenosine-5′-triphosphate, N.sup.6-methyladenosine-5′-triphosphate, N.sup.6-methyl-2-aminoadenosine-5′-triphosphate, 5-methyluridine-5′-triphosphate, N.sup.1-methylpseudouridine-5′-triphosphate, pseudouridine-5′-triphosphate, 5-hydroxymethyluridine-5′-triphosphate, 5-methylcytidine-5′-triphosphate, 5-hydroxymethylcytidine-5′-triphosphate, N.sup.7-methylguanosine-triphosphate, 8′-adizoadenisone-5′-triphosphate, inosine 5′-triphosphate, 2-thiouridine-5′-triphosphate, 6-thioguanosine-5′-triphosphate, 4-thiouridine-5′-triphosphate, and xanthosine-5′-triphosphate.
14. The method of any one of claims 1-13, wherein at least one of the modified nucleotides is a sugar-modified nucleotide.
15. The method of claim 14, wherein the sugar-modified nucleotide is modified at the 2′-position.
16. The method of claim 14, wherein the sugar-modified nucleotide is a 2′-F, 2′-O-alkyl, 2′-amino, or 2′-azido modified nucleotide.
17. The method of claim 16, wherein the sugar-modified nucleotide is a 2′-F modified nucleotide selected from the group consisting of 2′-fluoro-2′-deoxyadenosine-5′-triphosphate, 2′-fluoro-2′-deoxycytidine-5′-triphosphate, 2′-fluoro-2′-deoxyguanosine-5′-triphosphate, and 2′-fluoro-2′-deoxyuridine-5′-triphosphate.
18. The method of claim 16, wherein the sugar-modified nucleotide is a 2′-O-alkyl modified nucleotide selected from the group consisting of 2′-O-methyladenosine-5′-triphosphate, 2′-O-methylcytidine-5′-triphosphate, 2′-O-methylguanosine-5′-triphosphate, 2′-O-methyluridine-5′-triphosphate, and 2′-O-methylinosine-5′-triphosphate.
19. The method of claim 16, wherein the sugar-modified nucleotide is a 2′-O-amino modified nucleotide selected from the group consisting of 2′-amino-2′-deoxycytidine-5′-triphosphate, 2′-amino-2′-deoxyuridine-5′-triphosphate, 2′-amino-2′-deoxyadenosine-5′-triphosphate, and 2′-amino-2′-deoxyguanosine-5′-triphosphate.
20. The method of claim 16, wherein the sugar-modified nucleotide is a 2′-O-azido modified nucleotide selected from the group consisting of 2′-azido-2′-deoxycytidine-5′-triphosphate, 2′-azido-2′-deoxyuridine-5′-triphosphate, 2′-azido-2′-deoxyadenosine-5′-triphosphate, and 2′-azido-2′-deoxyguanosine-5′-triphosphate.
21. The method of any one of claims 1-20, wherein at least one of the modified nucleotide comprises a modified triphosphate.
22. The method of any one of claims 1-21, wherein at least one of the modified nucleotide is a bridged or locked nucleotide.
23. The method of any one of claims 13-22, wherein the sugar-modified nucleotide is a 2′-modified reversible terminator nucleotide.
24. The method of any one of claims 13-22, wherein the sugar-modified nucleotide is a 3′-modified reversible terminator nucleotide.
25. A method for template-independent synthesis of an RNA oligonucleotide, the method comprising: (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA; (b) providing a poly(U) polymerase; (c) combining the initiator oligonucleotide, the poly(U) polymerase, and a 2′- and/or 3′-O-protected reversible terminator nucleotide under conditions sufficient for the addition of the 2′- and/or 3′-O-protected reversible terminator nucleotide to the 3′ end of the initiator oligonucleotide; (d) deprotecting the RNA oligonucleotide formed in step (c) at the protected 2′- and/or 3′-O-position of the 2′- and/or 3′-O-protected reversible terminator nucleotide; (e) optionally, repeating steps (a)-(c) until a desired RNA sequence is obtained.
26. The method of claim 25, wherein the reversible terminator nucleotide is a 2′-O-protected reversible terminator nucleotide protected at the 2′-O position with an oxygen protecting group.
27. The method of claim 26, wherein the 2′-O-protected reversible terminator nucleotide is protected at the 2′-0 position with a photolabile protecting group.
28. The method of claim 26 or 27, wherein the 2′-O-protected reversible terminator nucleotide is a 2′-O-alkyl, 2′-O-silyl, 2′-O-allyl, 2′-O-azidomethyl, 2′-O-benzyl, 2′-O-coumarinyl, or a 2′-O-carbonate modified nucleotide.
29. The method of claim 28, wherein the 2′-O-protected reversible terminator nucleotide is a 2′-O-carbonate modified nucleotide selected from 2′-O-allyloxycarbonyl and 2′-O-(2-oxo-2H-chromen-4-yl)methyloxycarbonyl.
30. The method of claim 25 or 26, wherein the 2′-O-protected reversible terminator nucleotide is 2′-O-allyl-NTP or 2′-O-azidomethyl-NTP.
31. The method of any one of claims 25-30, wherein the 2′-O-protected reversible terminator nucleotide comprises a modified base moiety.
32. The method of any one of claims 25-31, wherein the 2′-O-protected reversible terminator nucleotide comprises one or more additional modifications.
33. The method of claim 25, wherein the reversible terminator nucleotide is a 3′-O-protected reversible terminator nucleotide protected at the 3′-0 position with an oxygen protecting group.
34. The method of claim 33, wherein the 3′-O-protected reversible terminator nucleotide is protected at the 3′-0 position with a photolabile protecting group.
35. The method of claim 32 or 34, wherein the 3′-O-protected reversible terminator nucleotide is a 3′-O-alkyl, 3′-O-silyl, 3′-O-allyl, 3′-O-azidomethyl, 3′-O-benzyl, 3′-O-coumarinyl, or a 3′-O-carbonate modified nucleotide.
36. The method of claim 35, wherein the 3′-O-protected reversible terminator nucleotide is a 3′-O-carbonate modified nucleotide selected from 3′-O-allyloxycarbonyl and 3′-O-(2-oxo-2H-chromen-4-yl)methyloxycarbonyl.
37. The method of claim 25 or 33, wherein the 3′-O-protected reversible terminator nucleotide is 3′-O-allyl-NTP, 3′-O-azidomethyl-NTP, 3′-O-allyl carbonate-NTP, 3′-O-allyl carbonate-dNTP, 3′-O-azidomethyl carbonate-NTP, or 3′-O-azidomethyl carbonate-dNTP.
38. The method of any one of claims 31-37, wherein the 3′-O-protected reversible terminator nucleotide comprises a modified base moiety.
39. The method of any one of claims 31-38, wherein the 3′-O-protected reversible terminator nucleotide comprises one or more additional modifications.
40. The method of claim 25, wherein the 2′- and/or 3′-O-protected reversible terminator nucleotide is of the following formula: ##STR00015## or a salt thereof, wherein: Y is O or S; X is O or S; each instance of R.sup.P is hydrogen, an oxygen protecting group, optionally substituted acyl, or an amino acid, or two R.sup.P are joined together with the intervening atoms to form optionally substituted heterocyclyl; provided that at least one R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid; and “Base” is a natural or non-natural nucleotide base.
41. The method of claim 33, wherein the 3′-O-protected reversible terminator nucleotide is of the following formula: ##STR00016## or a salt thereof, wherein: Y is O or S; X is O or S; R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid; R is hydrogen, halogen, —CN, —NO.sub.2, —N.sub.3, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted acyl, optionally substituted hydroxyl, optionally substituted amino, or optionally substituted thiol; and “Base” is a natural or non-natural nucleotide base.
42. The method of claim 33, wherein the 3′-O-protected reversible terminator nucleotide is of the following formula: ##STR00017## or a salt thereof, wherein: Y is O or S; X is O or S; R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid; and “Base” is a natural or non-natural nucleotide base.
43. A method for template-independent synthesis of an RNA oligonucleotide, the method comprising: (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA; (b) providing a poly(U) polymerase; (c) combining the initiator oligonucleotide, the poly(U) polymerase, one or more nucleotides, and one or more non-hydrolyzable nucleotides under conditions sufficient for addition of at least one hydrolyzable nucleotide to the 3′ end of the initiator oligonucleotide, wherein the concentration of the non-hydrolyzable nucleotides is sufficient to inhibit the rate of addition of the one or more nucleotides by the poly(U) polymerase.
44. The method of claim 43 further comprising: (d) repeating steps (a)-(c) until a desired RNA sequence is obtained.
45. The method of claim 43 or 44, wherein the non-hydrolyzable nucleotide comprises a modified triphosphate group.
46. The method of any one of claims 43-45, wherein the non-hydrolyzable nucleotide is selected from the group consisting of uridine-5′-[(α,β)-imido]triphosphate, adenosine-5′-[(α,β)-imido]triphosphate, guanosine-5′-[(α,β)-methyleno]triphosphate, cytidine-5′-[(α,β)-methyleno]triphosphate, adenosine-5′-[(β,γ)-methyleno]triphosphate, adenosine-5′-[(β,γ)-imido]triphosphate, guanosine-5′-[(β,γ)-imido]triphosphate, and uridine-5′-[(β,γ)-imido]triphosphate.
47. The method of claim 43 or 44, wherein the non-hydrolyzable nucleotide is a 3′-modified nucleotide.
48. The method of claim 47, wherein the non-hydrolyzable nucleotide is selected from the group consisting of 3′-O-methyladenosine-5′-triphosphate and 3′-O-methyluridine-5′-triphosphate.
49. The method of any one of claims 43-48, wherein 1-100 of the nucleotides are incorporated.
50. The method of any one of claims 43-48, wherein 1-50 of the nucleotides are incorporated.
51. The method of any one of claims 43-48, wherein 1-20 of the nucleotides are incorporated.
52. A method for the synthesis of a RNA oligonucleotide, the method comprising: (a) providing a first oligonucleotide, wherein the first oligonucleotide comprises a 5′-triphosphate group; (b) providing a second oligonucleotide; (c) providing a poly(U) polymerase; (d) combining the first and second oligonucleotides and the poly(U) polymerase under conditions sufficient for the ligation of the first oligonucleotide to the 3′ end of the second oligonucleotide.
53. The method of any one of claims 25-52, wherein the poly(U) polymerase is wild-type Schizosaccharomyces pombe poly(U) polymerase, or a mutant thereof.
54. The method of any one of claims 25-52, wherein the poly(U) polymerase is wild-type Schizosaccharomyces pombe poly(U) polymerase.
55. The method of any one of claims 1-54 further comprising a step of: (f) performing reverse transcription on the resulting RNA oligonucleotide using a reverse transcription priming site, primer, and a reverse transcriptase enzyme, thereby producing a complementary single-stranded DNA oligonucleotide or cDNA.
56. The method of claim 55 further comprising a step of: (g) amplifying complementary single-stranded DNA oligonucleotides or cDNA produced in step (f) with a DNA polymerase, thereby producing a double-stranded DNA.
57. The method of any one of claims 1-56, wherein step (c) is carried out in the presence of a crowding agent.
58. The method of claim 57, wherein the crowding agent is polyethylene glycol (PEG).
59. The method of any one of claims 1-58, wherein step (c) is carried out in the presence of one or more additional enzymes.
60. The method of claim 59, wherein step (c) is carried out in the presence of an additional poly(N) polymerase.
61. The method of claim 59, wherein step (c) is carried out in the presence of a yeast inorganic pyrophosphatase (PPI-ase).
62. The method of any one of claims 1-61, wherein step (c) is carried out in the presence of an RNase inhibitor.
63. The method of any one of claims 1-62, wherein step (c) is carried out in the presence of a non-hydrolyzable nucleotide.
64. The method of any one of claims 1-63, wherein the initiator oligonucleotide is covalently linked to a solid support.
65. The method of claim 64, wherein the initiator oligonucleotide is covalently linked to a solid support through a cleavable linker.
66. The method of any one of claims 1-65, wherein the initiator oligonucleotide is 5-20 nucleotides in length.
67. The method of claim 66, wherein the initiator oligonucleotide is poly-rU, poly-rC, poly-rG, or poly-rA.
68. The method of any one of claims 1-67, wherein the initiator oligonucleotide comprises a fluorophore or a handle for bioconjugation.
69. The method of any one of claims 1-68, wherein the initiator oligonucleotide comprises a primer site for reverse transcription or a primer for PCR.
70. The method of any one of claims 1-69, wherein the initiator oligonucleotide comprises a 5′ cap.
71. The method of any one of claims 1-70 further comprising a step of isolating the resulting RNA oligonucleotide.
72. The method of any one of claims 8-71, wherein the poly(U) polymerase is a mutated Schizosaccharomyces pombe poly(U) polymerase.
73. The method of claim 72, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W.
74. The method of claim 73, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336R mutation.
75. The method of claim 74, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes an H336R mutation.
76. The method of any one of claims 72-75, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K.
77. The method of claim 76, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an N171A mutation.
78. The method of claim 77, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes a N171A mutation.
79. The method of any one of claims 72-78, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336 and N171 mutations.
80. The method of claim 79, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336R and N171A mutations.
81. The method of claim 80, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes H336R and N171A mutations.
82. The method of claim 79, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336R and N171T mutations.
83. The method of claim 80, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes H336R and N171T mutations.
84. The method of any one of claims 72-83, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
85. The method of claim 84, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
86. The method of any one of claims 72-85, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336 and T172 mutations.
87. The method of claim 86, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
88. The method of claim 87, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
89. The method of any one of claims 72-88, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336, N171, and T172 mutations.
90. The method of claim 85, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K; and an T172 mutation selected from the group consisting T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
91. The method of claim 79, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase substantially identical to SEQ ID NO:3 and comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K; and a T172 mutation selected from the group consisting T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
92. An RNA oligonucleotide prepared by the method according to any one of claims 1-52.
93. A compound of the following formula: ##STR00018## or a salt thereof, wherein: Y is O or S; X is O or S; each instance of R.sup.P is hydrogen, an oxygen protecting group, optionally substituted acyl, or an amino acid, or two R.sup.P are joined together with the intervening atoms to form optionally substituted heterocyclyl; provided that at least one R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid; and “Base” is a natural or non-natural nucleotide base.
94. A compound of the following formula: ##STR00019## or a salt thereof, wherein: Y is O or S; X is O or S; R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid; R is hydrogen, halogen, —CN, —NO.sub.2, —N.sub.3, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted acyl, optionally substituted hydroxyl, optionally substituted amino, or optionally substituted thiol; and “Base” is a natural or non-natural nucleotide base.
95. A compound of the following formula: ##STR00020## or a salt thereof, wherein: Y is O or S; X is O or S; R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid; and “Base” is a natural or non-natural nucleotide base.
96. The compound of any one of claims 93-95, wherein R.sup.P is an oxygen protecting group.
97. The compound of any one of claims 93-95, wherein R.sup.P is an amino acid.
98. The compound of any one of claims 93-96, wherein R.sup.P is allyl, azidomethyl, allyl carbonate, or azidomethyl carbonate.
99. The compound of any one of claims 93-96, wherein the compound is a 3′-O-allyl-NTP, 3′-O-azidomethyl-NTP, 3′-O-allyl carbonate-NTP, 3′-O-allyl carbonate-dNTP, 3′-O-azidomethyl carbonate-NTP, or 3′-O-azidomethyl carbonate-dNTP.
100. The compound of claim 93, wherein the compound is 2′-O-allyl-NTP or 2′-O-azido-methyl-NTP.
101. The compound of any one of claims 93-100, wherein the compound is of any one of the formulae recited in
102. A polymerase, wherein the polymerase is a mutated Schizosaccharomyces pombe poly(U) polymerase comprising mutations at one or more positions selected from H336, N171, and T172.
103. The polymerase of claim 102, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W.
104. The polymerase of claim 103, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336R mutation.
105. The polymerase of claim 104, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes an H336R mutation.
106. The polymerase of any one of claims 102-105, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K.
107. The polymerase of claim 106, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an N171A mutation.
108. The polymerase of claim 107, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes an N171A mutation.
109. The polymerase of any one of claims 102-108, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336 and N171 mutations.
110. The polymerase of claim 109, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336R and N171A mutations.
111. The polymerase of claim 110, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes H336R and N171A mutations.
112. The polymerase of claim 109, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336R and N171T mutations.
113. The polymerase of claim 112, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes H336R and a N171T mutations.
114. The polymerase of any one of claims 102-113, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
115. The polymerase of claim 114, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
116. The polymerase of any one of claims 102-115, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336 and T172 mutations.
117. The polymerase of claim 116, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
118. The polymerase of claim 117, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
119. The polymerase of any one of claims 102-118, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises H336, N171, and T172 mutations.
120. The polymerase of claim 119, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase comprises an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K; and a T172 mutation selected from the group consisting T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
121. The polymerase of claim 120, wherein the mutated Schizosaccharomyces pombe poly(U) polymerase is identical to SEQ ID NO:3, but includes an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K; and a T172 mutation selected from the group consisting T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
122. A kit comprising a compound of any one of claims 93-101 and/or and a polymerase of any one of claims 102-122.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0059] The accompanying drawings, which constitute a part of this specification, illustrate several embodiments of the invention and together with the description, serve to explain the principles of the invention.
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
[0094] Described herein are methods for the de novo synthesis of RNA oligonucleotides using enzymatic catalysis. For example, provided herein are methods for the synthesis of RNA oligonucleotides wherein a terminal transferase enzyme (e.g., a poly(N) polymerase) incorporates one or more nucleotides onto an initiator oligonucleotide. For example, provided herein are methods for preparing RNA oligonucleotides wherein a poly(U) polymerase incorporates one or more modified nucleotides onto an initiator oligonucleotide via a terminal transferase.
[0095] In one aspect, provided herein are methods wherein modified nucleotides (i.e., 2′- or 3′-modified reversible terminator oligonucleotides) are incorporated that reversibly alter the binding affinity of the polymerase (e.g., a poly(U) polymerase) for the extended initiator oligonucleotide, thereby producing a (n+1) extended RNA oligonucleotide which can be deprotected and then further extended.
[0096] In another aspect, provided herein are methods for RNA oligonucleotide synthesis wherein non-hydrolyzable nucleotides are used to control the rate at which a polymerase (e.g., a poly(U) polymerase) incorporates hydrolyzable nucleotides onto an initiator oligonucleotide.
[0097] In another aspect, provided herein are methods of ligating two oligonucleotides using a poly(N)polymerase described herein (e.g., a wild-type or mutated poly(U) polymerase described herein) to yield a desired RNA oligonucleotide.
[0098] Additionally, RNA oligonucleotides produced by these methods can undergo reverse transcription (RT) to yield complementary DNA (e.g., cDNA) that is amplifiable by a high-fidelity DNA polymerase via the polymerase chain reaction (PCR). Also, provided herein are RNA oligonucleotides and DNA oligonucleotides produced by any method described herein.
[0099] Also provided herein are modified nucleotides that are useful in the methods described herein, as well as poly(N) polymerase enzymes (e.g., mutant poly(U) polymerases) that are useful in the methods described herein.
[0100] Also provided herein are compositions and kits comprising one or more of the poly(N) polymerases and/or nucleotides described herein. In another aspect, provided herein are reaction mixtures and systems for carrying out the methods described herein.
RNA Oligonucleotide Synthesis
[0101] Provided herein are methods for the synthesis of RNA oligonucleotides wherein a poly(N) polymerase incorporates one or more modified nucleotides onto an initiator oligonucleotide via a terminal transferase (e.g., a poly(N) polymerase). In certain embodiments, provided herein is a method for template-independent synthesis of an RNA oligonucleotide, the method comprising:
[0102] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0103] (b) providing a poly(N) polymerase;
[0104] (c) combining the initiator oligonucleotide, the poly(N) polymerase, and one or more modified nucleotides under conditions sufficient for the addition of at least one modified nucleotide to the 3′ end of the initiator oligonucleotide.
[0105] In certain embodiments, the poly(N) polymerase is a poly(U) polymerase. Therefore, in certain embodiments, provided herein is a method for template-independent synthesis of an RNA oligonucleotide, the method comprising:
[0106] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0107] (b) providing a poly(U) polymerase;
[0108] (c) combining the initiator oligonucleotide, the poly(U) polymerase, and one or more modified nucleotides under conditions sufficient for the addition of at least one modified nucleotide to the 3′ end of the initiator oligonucleotide.
[0109] Once the one or more modified nucleotides are added to the initiator oligonucleotide, one or more additional nucleotides (modified or unmodified) can be added subsequently in order to synthesize a desired RNA oligonucleotide. Therefore, in certain embodiments, the method further comprises adding one or more natural or modified nucleotides to the 3′ end of the resulting RNA oligonucleotide (i.e., the RNA oligonucleotide formed in step (c)) until a desired RNA sequence is obtained. In certain embodiments, one or more additional modified nucleotides are added. In certain embodiments, the method further comprises:
[0110] (d) repeating steps (a)-(c) until a desired RNA sequence is obtained.
Poly(N) Polymerases
[0111] As described herein, the enzyme incorporating one or more nucleotides is an RNA polymerase, such as a poly(N) polymerase. Provided herein are poly(N) polymerases, e.g., mutant (i.e., mutated) poly(U) polymerases, that are useful in the methods described herein.
[0112] In certain embodiments, the poly(N) polymerase is a poly(U) polymerase, a poly(A) polymerase, a poly(C) polymerase, or a poly(G) polymerase. The RNA polymerase may be a wild-type polymerase, or a mutant (i.e., mutated), variant, or homolog thereof. In certain embodiments, the poly(N) polymerase is a wild-type polymerase. In certain embodiments, the polymerase is a mutant of a poly(N) polymerase. In certain embodiments, the polymerase is a variant of a poly(N) polymerase. In certain embodiments, a mutant or variant is approximately 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the wild-type polymerase. In certain embodiments, the polymerase is a homolog of a poly(N) polymerase.
[0113] In certain embodiments, the poly(N) polymerase is a poly(U) polymerase. In certain embodiments, the poly(U) polymerase is wild-type Schizosaccharomyces pombe poly(U) polymerase, or a mutant thereof, or a homolog thereof. In certain embodiments, the poly(U) polymerase is wild-type Schizosaccharomyces pombe poly(U) polymerase. In certain embodiments, the poly(U) polymerase is a mutant of Schizosaccharomyces pombe poly(U) polymerase. In certain embodiments, the poly(U) polymerase is a variant of Schizosaccharomyces pombe poly(U) polymerase. In certain embodiments, the poly(U) polymerase is a homolog of Schizosaccharomyces pombe poly(U) polymerase.
[0114] In certain embodiments, the poly(N) polymerase is a poly(A) polymerase. In certain embodiments, the poly(A) polymerase is wild-type Saccharomyces cerevisiae poly(A) polymerase, or a mutant thereof. In certain embodiments, the poly(N) polymerase is wild-type Saccharomyces cerevisiae poly(A) polymerase. In certain embodiments, the poly(N) polymerase is a mutant of Saccharomyces cerevisiae poly(A) polymerase. In certain embodiments, the poly(N) polymerase is a variant of Saccharomyces cerevisiae poly(A) polymerase. In certain embodiments, the poly(N) polymerase is a homolog of Saccharomyces cerevisiae poly(A) polymerase.
Poly(U) Polymerase Mutants
[0115] As described herein, in certain embodiments, the poly(N) polymerase is a mutant of a poly(N) polymerase (i.e., mutated poly(N) polymerase). In certain embodiments, the poly(N) polymerase is an Schizosaccharomyces pombe poly(U) (S. pombe poly(u)) polymerase comprising mutations at one or more positions selected from H336, N171, and T172.
[0116] In certain embodiments, the poly(N) polymerase is an Schizosaccharomyces pombe poly(U) (S. pombe poly(u)) polymerase comprising an H336 mutation (i.e., wherein the amino acid H at position 336 is replaced with another amino acid). In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W. In certain embodiments, the H336 mutation is the only mutation. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W.
[0117] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an H336R mutation. In certain embodiments, the H336R mutation is the only mutation. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one mutation: H336R.
[0118] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an N171 mutation. In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K. In certain embodiments, the N171 mutation is the only mutation. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K.
[0119] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an N171A mutation. In certain embodiments, the N171A mutation is the only mutation. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one mutation: N171A.
[0120] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an N171T mutation. In certain embodiments, the N171T mutation is the only mutation. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one mutation: N171T.
[0121] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an T172 mutation. In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K. In certain embodiments, the T172 mutation is the only mutation. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K.
[0122] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising H336 and N171 mutations. In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K. In certain embodiments, the H336 and N171 mutations are the only mutations. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and one N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K.
[0123] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising H336R and N171A mutations. In certain embodiments, the H336R and N171A mutations are the only mutations. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes two mutations: H336R and N171A.
[0124] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising H336R and N171T mutations. In certain embodiments, the H336R and N171T mutations are the only mutations. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes two mutations: H336R and N171T.
[0125] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising H336 and T172 mutations. In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K. In certain embodiments, the H336 and T172 mutations are the only mutations. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; and one T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K. In certain embodiments, the H336 mutation is H336R.
[0126] In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising H336, N171, and T172 mutations. In certain embodiments, the poly(N) polymerase is an S. pombe poly(u) polymerase comprising an H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; an N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K; and a T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K. In certain embodiments, the H336, N171, and T172 mutations are the only mutations. In certain embodiments, the poly(N) polymerase comprises one or more addition mutations and is about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to SEQ ID NO:3. In certain embodiments, the poly(N) polymerase is identical to SEQ ID NO:3, but includes one H336 mutation selected from the group consisting of H336A H336C, H336D, H336E, H336F, H336G, H336I, H336K, H336L, H336M, H336T, H336V, H336W, H336Y, H336N, H336P, H336Q, H336R, H336S, and H336W; one N171 mutation selected from the group consisting of N171E, N171L, N171Q, N171S, N171M, N171D, N171G, N171C, N171A, N171W, N171T, N171I, N171V, N171P, N171R, N171H, and N171K; and one T172 mutation selected from the group consisting of T172E, T172L, T172Q, T172S, T172M, T172D, T172G, T172C, T172A, T172W, T172T, T172I, T172V, T172P, T172R, T172H, and T172K. In certain embodiments, the H336 mutation is H336R. In certain embodiments, the N171 mutation is N171A or N171T.
Modified RNA Nucleotides
[0127] As described herein, one or more modified nucleotides can be incorporated into an oligonucleotide in order to synthesize a desired RNA oligonucleotide. Modified nucleotides can be incorporated in order to prepare custom RNA or DNA oligonucleotides. In other embodiments, modified nucleotides can be incorporated to block the incorporation of subsequent nucleotides (i.e., via the use of “reversible terminators” as described herein). Provided herein are modified nucleotides that are useful in the methods described herein, as well as in other applications (e.g., chemical oligonucleotide synthesis, therapeutic applications, etc.)
[0128] A “modified nucleotide” is an nucleotide monomer (e.g., comprising a ribose sugar, a phosphate group, and a nucleobase) comprising one or more non-natural modifications. In certain embodiments, for example, the modified nucleotide is the structural equivalent of a naturally occurring RNA or DNA nucleotide (i.e., guanine (G), uracil (U), adenine (A), cytosine (C)) but comprising one or more non-natural modifications. In certain embodiments, the modified nucleotide is the equivalent of a naturally occurring nucleotide, wherein one or more positions are substituted, or wherein one or more substituents or groups are removed or replaced. In certain embodiments, the modified nucleotide comprises a modified sugar, a modified base, a modified phosphate, or any combination thereof. “Modified nucleotides” include the 2′- and 3′-reversible terminator nucleotides described herein.
[0129] The following formula is intended to show possible modification sites on an nucleotide. Other modifications are contemplated. In certain embodiments, a modified nucleotide is of the following formula:
##STR00003##
or a salt thereof, wherein:
[0130] “Base” (also “B” herein) is a natural or non-natural nucleotide base; and
[0131] R and R′ are independently hydrogen or a natural or non-natural sugar substituent.
[0132] In certain embodiments, a modified nucleotide is of the following formula:
##STR00004##
or a salt thereof, wherein:
[0133] X is O or S;
[0134] Y is O or S;
[0135] “Base” (also “B” herein) is a natural or non-natural nucleotide base; and
[0136] R and R′ are independently hydrogen or a natural or non-natural sugar substituents.
[0137] In certain embodiments, Y is O. In certain embodiments, Y is S. In certain embodiments, X is O. In certain embodiments, X is S.
[0138] In certain embodiments, a modified nucleotide is a base-modified nucleotide. “Base-modified” encompasses nucleotides, wherein a G, U, A, or C base is substituted or modified, or wherein a G, U, A, or C base is replaced by a different group (e.g., hypoxanthine).
[0139] Non-limiting examples of modified bases include, but are not limited to, 5-methylcytosine, pyridin-4-one, pyridin-2-one, phenyl, pseudouracil, 3-methyl uracil, dihydrouridine, naphthyl, aminophenyl, 5-alkylcytidines, 5-alkyluridines, 5-halouridines, 6-azapyrimidines, 6-alkylpyrimidines, propyne, quesosine, 2-thiouridine, 4-thiouridine, 4-acetyltidine, 5-(carboxyhydroxymethyl)uridine, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluridine, β-D-galactosylqueosine, 1-methyladenosine, 1-methylinosine, 2,2-dimethylguanosine, 3-methylcytidine, 2-methyladenosine, 2-methylguanosine, N6-methyladenosine, 7-methylguanosine, 5-methoxyaminomethyl-2-thiouridine, 5-methylaminomethyluridine, 5-methylcarbonylmethyluridine, 5-methyloxyuridine, 5-methyl-2-thiouridine, 2-methylthio-N6-isopentenyladenosine, 3-D-mannosylqueosine, uridine-5-oxyacetic acid, 2-thiocytidine, and threonine derivatives.
[0140] Other non-limiting examples of bases include, but are not limited to, natural or non-natural pyrimidine or purine; and may include, but are not limited to, N.sup.1-methyl-adenine, N.sup.6-methyl-adenine, 8′-azido-adenine, N,N-dimethyl-adenosine, aminoallyl-adenosine, 5′-methyl-uridine, pseudouridine, N.sup.1-methyl-pseudouridine, 5′-hydroxy-methyl-uridine, 2′-thio-uridine, 4′-thio-uridine, hypoxanthine, xanthine, 5′-methyl-cytidine, 5′-hydroxy-methyl-cytidine, 6′-thio-guanine, and N.sup.7-methyl-guanine.
[0141] In certain embodiments, the base-modified nucleotide is selected from the group consisting of N.sup.1-methyladenosine-5′-triphosphate, N.sup.6-methyladenosine-5′-triphosphate, N.sup.6-methyl-2-aminoadenosine-5′-triphosphate, 5-methyluridine-5′-triphosphate, N.sup.1-methylpseudouridine-5′-triphosphate, pseudouridine-5′-triphosphate, 5-hydroxymethyluridine-5′-triphosphate, 5-methylcytidine-5′-triphosphate, 5-hydroxymethylcytidine-5′-triphosphate, N.sup.7-methylguanosine-triphosphate, 8′-adizoadenisone-5′-triphosphate, inosine 5′-triphosphate, 2-thiouridine-5′-triphosphate, 6-thioguanosine-5′-triphosphate, 4-thiouridine-5′-triphosphate, and xanthosine-5′-triphosphate.
[0142] In certain embodiments, the modified nucleotide is a sugar-modified nucleotide. “Sugar-modified” nucleotides encompass nucleotides wherein the ribose or deoxyribose moiety is substituted, or wherein the ribose or deoxyribose is replaced by a different sugar moiety. In certain embodiments, the ribose or deoxyribose is modified (e.g., substituted) at the 1′, 2′, 3′, 4′, and/or 5′ position. In some embodiments, a nucleotide may be modified at the 2′ position. In some embodiments, a nucleotide may be modified at the 3′ position.
[0143] In certain embodiments, the 2′ and/or 3′ position of a sugar is substituted with a natural or non-natural “sugar substituent” R or R′. In certain embodiments, R and R′ are independently selected from the group consisting of hydrogen, halogen, —CN, —N02, —N3, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted acyl, optionally substituted hydroxyl, optionally substituted amino, or optionally substituted thiol.
[0144] In certain embodiments, R and/or R′ are independently —OR.sup.P, wherein each instance of R.sup.P is independently an oxygen protecting group, optionally substituted acyl, or an amino acid. In certain embodiments, R and/or R′ comprise a reactive moiety for bioconjugation (e.g., click chemistry handle, e.g., azide or alkyne), a fluorophore, catalytic protein, oligonucleotide, or reporting tag.
[0145] In some embodiments, the 2′ position of a sugar, e.g., ribose, may be modified with a halogen, e.g., a fluorine group; an alkyl group, e.g., methyl or ethyl group; a methoxy group; an amino group; a thio group; an aminopropyl group; a dimethylaminoethyl; a dimethylaminopropyl group; a dimethylaminoethyloxyethyl group; an azido group; a silyl group; a cyclic alkyl group; or a N-methylacetamido group.
[0146] In certain embodiments, the 2′ position of a sugar, e.g., ribose, is modified with a hydroxyl (—OH), hydrogen (—H), fluoro (—F), amine (—NH.sub.3), azido (—N3), thiol (—SH), methoxy (—OCH.sub.3), or methoxyethanol (—OCH.sub.2CH.sub.2OCH.sub.3).
[0147] In certain embodiments, the 2′ position may also be substituted with redox-active, fluorogenic or intrinsically fluorescent moieties, natural and non-natural amino acids, peptides, proteins, mono- or oligosaccharides, functional/ligand binding glycans, and polymers or large molecules such as polyethylene glycol (PEG).
[0148] In some embodiments, the 3′ position of a sugar, e.g., ribose, may be modified with a halogen, e.g., a fluorine group; an alkyl group, e.g., methyl or ethyl group; a methoxy group; an amino group; a thio group; an aminopropyl group; a dimethylaminoethyl; a dimethylaminopropyl group; a dimethylaminoethyloxyethyl group; an azido group; a silyl group; a cyclic alkyl group; or a N-methylacetamido group.
[0149] In certain embodiments, the 3′ position of a sugar, e.g., ribose, is modified with a hydroxyl (—OH), hydrogen (—H), fluoro (—F), amine (—NH.sub.3), azido (—N3), thiol (—SH), methoxy (—OCH.sub.3), or methoxyethanol (—OCH.sub.2CH.sub.2OCH.sub.3).
[0150] In certain embodiments, the 3′ position may also be substituted with redox-active, fluorogenic or intrinsically fluorescent moieties, natural and non-natural amino acids, peptides, proteins, mono- or oligosaccharides, functional/ligand binding glycans, and polymers or large molecules such as polyethylene glycol (PEG).
[0151] In certain embodiments, the sugar-modified nucleotide is modified at the 2′-position. For example, in certain embodiments, the sugar-modified nucleotide is a 2′-F, 2′-O-alkyl, 2′-amino, or 2′-azido modified nucleotide.
[0152] In certain embodiments, the sugar-modified nucleotide is a 2′-F modified nucleotide. In certain embodiments, the sugar-modified nucleotide is selected from the group consisting of 2′-fluoro-2′-deoxyadenosine-5′-triphosphate, 2′-fluoro-2′-deoxycytidine-5′-triphosphate, 2′-fluoro-2′-deoxyguanosine-5′-triphosphate, and 2′-fluoro-2′-deoxyuridine-5′-triphosphate.
[0153] In certain embodiments, the sugar-modified nucleotide is a 2′-O-alkyl modified nucleotide. In certain embodiments, the sugar-modified nucleotide is selected from the group consisting of 2′-O-methyladenosine-5′-triphosphate, 2′-O-methylcytidine-5′-triphosphate, 2′-O-methylguanosine-5′-triphosphate, 2′-O-methyluridine-5′-triphosphate, and 2′-O-methylinosine-5′-triphosphate.
[0154] In certain embodiments, the sugar-modified nucleotide is a 2′-O-amino modified nucleotide. In certain embodiments, the sugar-modified nucleotide is selected from the group consisting of 2′-amino-2′-deoxycytidine-5′-triphosphate, 2′-amino-2′-deoxyuridine-5′-triphosphate, 2′-amino-2′-deoxyadenosine-5′-triphosphate, and 2′-amino-2′-deoxyguanosine-5′-triphosphate.
[0155] In certain embodiments, the sugar-modified nucleotide is a 2′-O-azido modified nucleotide. In certain embodiments, the sugar-modified nucleotide is selected from the group consisting of 2′-azido-2′-deoxycytidine-5′-triphosphate, 2′-azido-2′-deoxyuridine-5′-triphosphate, 2′-azido-2′-deoxyadenosine-5′-triphosphate, and 2′-azido-2′-deoxyguanosine-5′-triphosphate.
[0156] In certain embodiments the modified nucleoside triphosphate is an irreversible terminator, also known as a capping nucleotide, such as 3′-O-methyl-NTP, 3′-O-methyl-dNTP, 3′-azido-dNTP, 3′-azido-NTP, 3′-amine-dNTP, 3′-amine-NTP, etc.
[0157] In certain embodiments, the sugar-modified nucleotide is a 2′-modified reversible terminator RNA nucleotide (e.g., 2′-O-protected reversible terminator nucleotide). 2′-modified reversible terminator nucleotides are described herein. In certain embodiments, the 2′-modified reversible terminator nucleotide also comprises a modified base moiety.
[0158] In certain embodiments, the sugar-modified nucleotide is a 3′-modified reversible terminator RNA nucleotide (e.g., 3′-O-protected reversible terminator nucleotide). 3′-modified reversible terminator nucleotides are described herein. In certain embodiments, the 3′-modified reversible terminator nucleotide also comprises a modified base moiety.
[0159] Other modifications to the sugar are contemplated. These modifications include, but not limited to, replacing the ring's oxygen with a sulfur. In certain embodiments, a bridge is introduced between the 2′-carbon and the 4′-carbon (e.g., to limit ring conformation). In some embodiments, an modified nucleotide is a bridged nucleotide, e.g., locked nucleic acid (LNA); a constrained ethyl nucleotide (cEt), or an ethylene bridged nucleic acid (ENA) nucleotide.
[0160] In some embodiments, a nucleotide, e.g., a nucleotide, may comprise a modified phosphate group, e.g., a phosphorothioate. Non-limiting examples of modified phosphate groups include phosphorothioates, phosphotriesters, methyl phosphonates, alkyl, heterocyclic, amide, morpholino, peptide nucleic acids (PNA), and other known phosphorus-containing groups. In certain embodiments, the modification is to the alpha (α) phosphate of the triphosphate. In certain embodiments, the nucleotide is an (α) thiophosphonate. In certain embodiments, the modifications to the beta (β) and/or gamma (γ) phosphates of the triphosphate.
[0161] In certain embodiments, nucleotide modified with a fluorophore can be used to verify the success of each iterative incorporation event, thereby producing in some embodiments virtually error-free RNA oligonucleotides. In certain embodiments, a modified nucleotide comprises a fluorophore.
[0162] Modified nucleotides may comprise more than one modification. For example, a modified nucleotide may comprise a base modification and a sugar modification.
RNA Oligonucleotide Synthesis with Reversible Terminators
[0163] Also provided herein are methods of synthesizing RNA oligonucleotides using reversible terminator nucleotides. A “reversible terminator nucleotide” is an nucleotide comprising a non-natural chemical moiety at the 2′- and/or 3′-position that is capable of being removed. After addition of the reversible-terminator nucleotide to the initiator oligonucleotide, the non-natural chemical moiety 2′- and/or 3′-position blocks the incorporation of a second nucleotide, e.g., by interfering with the binding of the oligonucleotide to the polymerase. The non-natural chemical moiety 2′- and/or 3′-position can then be removed, leaving the 3′-position open to the addition of an additional nucleotide. In certain embodiments, the method allows for the controlled addition of one nucleotide at a time, also referred to as “(n+1)” addition. In certain embodiments, the reversible terminator nucleotide is protected at the 2′- and/or 3′-hydroxyl groups (i.e., “2′- and/or 3′-O-protected reversible terminator nucleotides”).
[0164] Provided herein are methods for template-independent synthesis of RNA oligonucleotides, the method comprises:
[0165] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0166] (b) providing a poly(N) polymerase;
[0167] (c) combining the initiator oligonucleotide, the poly(N) polymerase, and a reversible terminator nucleotide under conditions sufficient for the addition of the reversible terminator nucleotide to the 3′ end of the initiator oligonucleotide;
[0168] (d) deprotecting the RNA oligonucleotide formed in step (c) at the protected position (e.g., 2′ and/or 3′ position) of the reversible terminator nucleotide; and
[0169] (e) optionally, repeating steps (a)-(c) until a desired RNA sequence is obtained.
[0170] In certain embodiments, the poly(N) polymerase is a poly(U) polymerase. Provided herein is are methods for template-independent synthesis of RNA oligonucleotides, the methods comprising:
[0171] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0172] (b) providing a poly(U) polymerase;
[0173] (c) combining the initiator oligonucleotide, the poly(U) polymerase, and a 2′- and/or 3′-O-protected reversible terminator nucleotide under conditions sufficient for the addition of the 2′- and/or 3′-O-protected reversible terminator nucleotide to the 3′ end of the initiator oligonucleotide;
[0174] (d) deprotecting the RNA oligonucleotide formed in step (c) at the protected 2′- and/or 3′-O-position of the 2′- and/or 3′-O-protected reversible terminator nucleotide;
[0175] (e) optionally, repeating steps (a)-(c) until a desired RNA sequence is obtained.
[0176] As described herein, 2′-O-protected reversible terminator nucleotides can also be used. In certain embodiments, the poly(N) polymerase is a poly(U) polymerase. Provided herein is are methods for template-independent synthesis of RNA oligonucleotides, the methods comprising:
[0177] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0178] (b) providing a poly(U) polymerase;
[0179] (c) combining the initiator oligonucleotide, the poly(U) polymerase, and a 2′-O-protected reversible terminator nucleotide under conditions sufficient for the addition of the 2′-O-protected reversible terminator nucleotide to the 3′ end of the initiator oligonucleotide;
[0180] (d) deprotecting the RNA oligonucleotide formed in step (c) at the protected 2′-O-position of the 2′-O-protected reversible terminator nucleotide;
[0181] (e) optionally, repeating steps (a)-(c) until a desired RNA sequence is obtained.
[0182] As described herein, 3′-O-protected reversible terminator nucleotides can also be used. Provided herein is are methods for template-independent synthesis of RNA oligonucleotides, the methods comprising:
[0183] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0184] (b) providing a poly(U) polymerase;
[0185] (c) combining the initiator oligonucleotide, the poly(U) polymerase, and a 3′-O-protected reversible terminator nucleotide under conditions sufficient for the addition of the 3′-O-protected reversible terminator nucleotide to the 3′ end of the initiator oligonucleotide;
[0186] (d) deprotecting the RNA oligonucleotide formed in step (c) at the protected 3′-O-position of the 3′-O-protected reversible terminator nucleotide;
[0187] (e) optionally, repeating steps (a)-(c) until a desired RNA sequence is obtained.
[0188] Any poly(N) polymerase described herein can be used in the reversible terminator methods described above. In certain embodiments, a mutant poly(U) polymerase described herein is used to incorporate the reversible terminator nucleotide. In certain embodiments, a mutant poly(U) polymerase described herein is used to incorporate a 3′-reversible terminator nucleotide described herein.
[0189] An RNA oligonucleotide of any particular sequence can be synthesized using the methods described herein.
Reversible Terminator RNA Nucleotides
[0190] Some of the methods described herein employ reversible terminator RNA oligonucleotides. A “reversible terminator nucleotide” is a modified nucleotide that comprises a non-natural chemical moiety at the 2′- and/or 3′-position that is capable of being removed. In certain embodiments, the reversible terminator nucleotide is protected at the 2′-O- and/or 3′-O-positions with an oxygen protecting group. Also provided herein are new reversible terminator nucleotides (e.g., 2′-modified reversible terminator nucleotides and 3′-modified reversible terminator nucleotides).
[0191] In certain embodiments, the 2′-modified reversible terminator nucleotide is protected at the 2′-O-position with an oxygen protecting group (“2′-O-protected reversible terminator nucleotide”). In certain embodiments, the 3′-modified reversible terminator nucleotide is protected at the 3′-O-position with an oxygen protecting group (“3′-O-protected reversible terminator nucleotide”).
[0192] For example, in certain embodiments, the reversible terminator nucleotide (i.e., 2′- and/or 3′-O-protected reversible terminator nucleotide) is of the following formula:
##STR00005##
or a salt thereof, wherein:
[0193] each instance of R.sup.P is hydrogen, an oxygen protecting group, optionally substituted acyl, or an amino acid, or two R.sup.P are joined together with the intervening atoms to form optionally substituted heterocyclyl; provided that at least one R.sup.P is an oxygen protecting group optionally substituted acyl, or an amino acid; and
[0194] “Base” (also “B” herein”) is a natural or non-natural nucleotide (e.g., modified) base. Other portions of the nucleotide can be modified as described above and herein.
[0195] For example, in certain embodiments, the reversible terminator nucleotide (i.e., 2′- and/or 3′-O-protected reversible terminator nucleotide) is of the following formula:
##STR00006##
or a salt thereof, wherein:
[0196] Y is O or S;
[0197] X is O or S;
[0198] each instance of R.sup.P is hydrogen, an oxygen protecting group, optionally substituted acyl, or an amino acid, or two R.sup.P are joined together with the intervening atoms to form optionally substituted heterocyclyl; provided that at least one R.sup.P is an oxygen protecting group optionally substituted acyl, or an amino acid; and
[0199] “Base” (also “B” herein) is a natural or non-natural nucleotide (e.g., modified) base.
[0200] In certain embodiments, a 3′-modified reversible terminator nucleotide (i.e., 3′-O-protected reversible terminator nucleotide) is of the following formula:
##STR00007##
or a salt thereof, wherein:
[0201] Y is O or S;
[0202] X is O or S;
[0203] R.sup.P is an oxygen protecting group;
[0204] R is hydrogen or a natural or non-natural sugar substituent described herein; and
[0205] “Base” (also “B” herein) is a natural or non-natural nucleotide (e.g., modified) base.
[0206] Optionally, in certain embodiments, a linking group connects the 2′ carbon to the 4′ carbon (e.g., through the group R′)
[0207] In certain embodiments, a 3′-modified reversible terminator nucleotide is a locked or bridged nucleotide. In certain embodiments, a 3′-modified reversible terminator nucleotide (i.e., 3′-O-protected reversible terminator nucleotide) is of the following formula:
##STR00008##
or a salt thereof, wherein:
[0208] Y is O or S;
[0209] X is O or S;
[0210] R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid;
[0211] R is hydrogen or a natural or non-natural sugar substituent described herein; and
[0212] “Base” (also “B” herein) is a natural or non-natural nucleotide (e.g., modified) base.
[0213] In certain embodiments, Y is O. In certain embodiments, Y is S. In certain embodiments, X is O. In certain embodiments, X is S.
[0214] As described herein, “Base” (also “B” herein) can be any natural or non-naturally occurring nucleobase. Naturally occurring bases include G, U, A, and C. Non-natural (e.g., modified) bases include substituted or modified variants of G, U, A, and C. Non-limiting examples of modified bases include, but are not limited to, 5-methylcytosine, pyridin-4-one, pyridin-2-one, phenyl, pseudouracil, 3-methyl uracil, dihydrouridine, naphthyl, aminophenyl, 5-alkylcytidines, 5-alkyluridines, 5-halouridines, 6-azapyrimidines, 6-alkylpyrimidines, propyne, quesosine, 2-thiouridine, 4-thiouridine, 4-acetyltidine, 5-(carboxyhydroxymethyl)uridine, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluridine, 3-D-galactosylqueosine, 1-methyladenosine, 1-methylinosine, 2,2-dimethylguanosine, 3-methylcytidine, 2-methyladenosine, 2-methylguanosine, N6-methyladenosine, 7-methylguanosine, 5-methoxyaminomethyl-2-thiouridine, 5-methylaminomethyluridine, 5-methylcarbonylmethyluridine, 5-methyloxyuridine, 5-methyl-2-thiouridine, 2-methylthio-N6-isopentenyladenosine, 3-D-mannosylqueosine, uridine-5-oxyacetic acid, 2-thiocytidine, and threonine derivatives.
[0215] Other non-limiting examples of bases include, but are not limited to, natural or non-natural pyrimidine or purine; and may include, but are not limited to, N.sup.1-methyl-adenine, N.sup.6-methyl-adenine, 8′-azido-adenine, N,N-dimethyl-adenosine, aminoallyl-adenosine, 5′-methyl-uridine, pseudouridine, N.sup.1-methyl-pseudouridine, 5′-hydroxy-methyl-uridine, 2′-thio-uridine, 4′-thio-uridine, hypoxanthine, xanthine, 5′-methyl-cytidine, 5′-hydroxy-methyl-cytidine, 6′-thio-guanine, and N.sup.7-methyl-guanine.
[0216] In certain embodiments, the nucleotide sugar is substituted with a natural or non-natural “sugar substituent” R. In certain embodiments, R is hydrogen, halogen, —CN, —NO.sub.2, —N.sub.3, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted acyl, optionally substituted hydroxyl, optionally substituted amino, or optionally substituted thiol. In certain embodiments, R is hydrogen. In certain embodiments, R is halogen. In certain embodiments, R is —CN. In certain embodiments, R is —NO.sub.2. In certain embodiments, R is —N.sub.3. In certain embodiments, R is optionally substituted alkyl. In certain embodiments, R is optionally substituted alkenyl. In certain embodiments, R is optionally substituted alkynyl. In certain embodiments, R is optionally substituted aryl. In certain embodiments, R is optionally substituted heteroaryl. In certain embodiments, R is optionally substituted carbocyclyl. In certain embodiments, R is optionally substituted heterocyclyl. In certain embodiments, R is optionally substituted acyl. In certain embodiments, R is optionally substituted hydroxyl. In certain embodiments, R is optionally substituted amino. In certain embodiments, R is optionally substituted thiol.
[0217] In certain embodiments, R is —OR.sup.P, wherein R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid.
[0218] In certain embodiments, R comprises a reactive moiety for bioconjugation (e.g., click chemistry handle, e.g., azide or alkyne), a fluorophore, catalytic protein, oligonucleotide, or reporting tag.
[0219] In some embodiments, R is halogen, e.g., a fluorine group; an alkyl group, e.g., methyl or ethyl group; a methoxy group; an amino group; a thio group; an aminopropyl group; a dimethylaminoethyl; a dimethylaminopropyl group; a dimethylaminoethyloxyethyl group; an azido group; a silyl group; a cyclic alkyl group; or a N-methylacetamido group.
[0220] In certain embodiments, R is hydroxyl (—OH), hydrogen (—H), fluoro (—F), amine (—NH.sub.3), azido (—N.sub.3), thiol (—SH), methoxy (—OCH.sub.3), or methoxyethanol (—OCH.sub.2CH.sub.2OCH.sub.3).
[0221] In certain embodiments, R comprises redox-active, fluorogenic or intrinsically fluorescent moiety, natural and non-natural amino acids, peptides, proteins, mono- or oligosaccharides, functional/ligand binding glycans, or polymers or large molecules such as polyethylene glycol (PEG).
[0222] As defined herein, each R.sup.P is independently an oxygen protecting group, optionally substituted acyl, or an amino acid. In certain embodiments, R.sup.P is an oxygen protecting group. In certain embodiments, R.sup.P is optionally substituted acyl. In certain embodiments, R.sup.P is an amino acid. In certain embodiments, R.sup.P is an oxygen protecting group, optionally substituted acyl, or an amino acid that can be cleaved by an esterase.
[0223] In certain embodiments, the reversible terminator nucleotide is capable of being deprotected under photochemical conditions. Therefore, the reversible terminator RNA oligonucleotide, in certain embodiments, is protected at the 2′-O- and/or 3′-O-positions with a photolabile oxygen protecting group. In certain embodiments, a 2′-modified reversible terminator nucleotide is protected at the 2′-O position with a photolabile protecting group. In certain embodiments, a 3′-modified reversible terminator nucleotide is protected at the 3′-O position with a photolabile protecting group.
[0224] In certain embodiments a 2′- or 3′-O-protecting group (e.g., R.sup.P) is of one of the following formulae:
##STR00009##
[0225] In certain embodiments a 2′- or 3′-O-protecting group (e.g., R.sup.P) is of one of the following formulae:
##STR00010##
[0226] In certain embodiments a 2′- or 3′-O-protecting group (e.g., R.sup.P) is of one of the following formulae:
##STR00011##
[0227] In certain embodiments a 2′- or 3′-O-protecting group (e.g., R.sup.P) is of the following formulae:
##STR00012##
[0228] In certain embodiments a 2′- or 3′-O-protecting group (e.g., R.sup.P) is an amino acid of the following formula:
##STR00013##
[0229] In certain embodiments, each instance of R.sup.P is independently alkyl, silyl, allyl, azidomethyl, benzyl, coumarinyl, or carbonate.
[0230] In certain embodiments, a 2′-modified reversible terminator nucleotide is a 2′-O-alkyl, 2′-O-silyl, 2′-O-allyl, 2′-O-azidomethyl, 2′-O-benzyl, 2′-O-coumarinyl, or a 2′-O-carbonate modified nucleotide. In certain embodiments, the 2′-modified reversible terminator nucleotide is a 2′-O-carbonate modified nucleotide selected from 2′-O-allyloxycarbonyl and 2′-O-(2-oxo-2H-chromen-4-yl)methyloxycarbonyl.
[0231] In certain embodiments, the 2′-O-protected reversible terminator is a 2′-O-allyl-NTP or 2′-O-azidomethyl-NTP.
[0232] In certain embodiments, a 3′-modified reversible terminator nucleotide is a 3′-O-alkyl, 3′-O-silyl, 3′-O-allyl, 3′-O-azidomethyl, 3′-O-benzyl, 3′-O-coumarinyl, or a 3′-O-carbonate modified nucleotide. In certain embodiments, the 3′-modified reversible terminator nucleotide is a 3′-O-carbonate modified nucleotide selected from 3′-O-allyloxycarbonyl and 3′-O-(2-oxo-2H-chromen-4-yl)methyloxycarbonyl.
[0233] In certain embodiments, the 3′-O-protected reversible terminator is a 3′-O-allyl-NTP, 3′-O-azidomethyl-NTP, 3′-O-allyl carbonate-NTP, 3′-O-allyl carbonate-dNTP, 3′-O-azidomethyl carbonate-NTP, or 3′-O-azidomethyl carbonate-dNTP.
[0234] In certain embodiments, the 3′-O-protected reversible terminator is a 3′-O-allyl-NTP, 3′-(O-allyl-carbonate)-dNTP (e.g., 3′-(O-allyl-carbonate)-dATP, etc.), 3′-(O-azidomethyl carbonate)-dNTP, 3′-(O-acetate)-dNTP, 3′-(O-acyl amino acids)-dNTP, 3′-(O-3-methylcoumarin)-dNTP, 3′-(O-(4-methylcoumarin carbonate)-dNTP, 3′-(O-(2-nitrobenzyl)-dNTP, 3′-(O-(2-nitrobenzyl carbonate)-dNTP, 3′-(O-TMS)-dNTP, or 3′-(O-Teoc)-dNTP.
[0235] Other certain embodiments of reversible terminator nucleotides, including certain embodiments of 3′-protected nucleotides, are shown in
[0236] As described herein, reversible terminator oligonucleotides may be protected with oxygen protecting groups (e.g, R.sup.P groups). Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999, incorporated herein by reference. Exemplary oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2-methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl S,S-dioxide, 1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl (CTMP), 1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl, 1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl, 1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl, p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), p-methoxybenzyl, 3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl, 4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl, p,p′-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, α-naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl, di(p-methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl, 4-(4′-bromophenacyloxyphenyl)diphenylmethyl, 4,4′,4″-tris(4,5-dichlorophthalimidophenyl)methyl, 4,4′,4″-tris(levulinoyloxyphenyl)methyl, 4,4′,4″-tris(benzoyloxyphenyl)methyl, 3-(imidazol-1-yl)bis(4′,4″-dimethoxyphenyl)methyl, 1,1-bis(4-methoxyphenyl)-1′-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl, 1,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS), t-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl, triphenylsilyl, diphenylmethylsilyl (DPMS), t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate (levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p-phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), ethyl carbonate, 2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2-(triphenylphosphonio) ethyl carbonate (Peoc), isobutyl carbonate, vinyl carbonate, allyl carbonate, t-butyl carbonate (BOC or Boc), p-nitrophenyl carbonate, benzyl carbonate, p-methoxybenzyl carbonate, 3,4-dimethoxybenzyl carbonate, o-nitrobenzyl carbonate, p-nitrobenzyl carbonate, S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4-methylphenoxyacetate, 2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate, 2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, α-naphthoate, nitrate, alkyl N,N,N′,N′-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts). In certain embodiments, an oxygen protecting group is silyl. In certain embodiments, an oxygen protecting group is t-butyldiphenylsilyl (TBDPS), t-butyldimethylsilyl (TBDMS), triisoproylsilyl (TIPS), triphenylsilyl (TPS), triethylsilyl (TES), trimethylsilyl (TMS), triisopropylsiloxymethyl (TOM), acetyl (Ac), benzoyl (Bz), allyl carbonate, 2,2,2-trichloroethyl carbonate (Troc), 2-trimethylsilylethyl carbonate, methoxymethyl (MOM), 1-ethoxyethyl (EE), 2-methyoxy-2-propyl (MOP), 2,2,2-trichloroethoxyethyl, 2-methoxyethoxymethyl (MEM), 2-trimethylsilylethoxymethyl (SEM), methylthiomethyl (MTM), tetrahydropyranyl (THP), tetrahydrofuranyl (THF), p-methoxyphenyl (PMP), triphenylmethyl (Tr), methoxytrityl (MMT), dimethoxytrityl (DMT), allyl, p-methoxybenzyl (PMB), t-butyl, benzyl (Bn), allyl, or pivaloyl (Piv).
[0237] In certain embodiments, the 3′-reversible terminator is a 3′-O-amino acid (e.g., comprising any standard or non-standard amino acid). In certain embodiments, the amino acid can be removed using an esterase.
[0238] As generally defined herein, R″ is hydrogen, halogen, —CN, —NO.sub.2, —N.sub.3, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted acyl, optionally substituted hydroxyl, optionally substituted amino, or optionally substituted thiol. In certain embodiments, R″ is hydrogen. In certain embodiments, R″ is halogen. In certain embodiments, R″ is —CN. In certain embodiments, R″ is —NO.sub.2. In certain embodiments, R″ is —N.sub.3. In certain embodiments, R″ is optionally substituted alkyl. In certain embodiments, R″ is optionally substituted alkenyl. In certain embodiments, R″ is optionally substituted alkynyl. In certain embodiments, R″ is optionally substituted aryl. In certain embodiments, R″ is optionally substituted heteroaryl. In certain embodiments, R″ is optionally substituted carbocyclyl. In certain embodiments, R″ is optionally substituted heterocyclyl. In certain embodiments, R″ is optionally substituted acyl. In certain embodiments, R″ is optionally substituted hydroxyl. In certain embodiments, R″ is optionally substituted amino. In certain embodiments, R″ is optionally substituted thiol.
[0239] In certain embodiments, R″ comprises a reactive moiety for bioconjugation (e.g., click chemistry handle, e.g., azide or alkyne), a fluorophore, catalytic protein, oligonucleotide, or reporting tag.
[0240] As generally defined herein, R′″ is hydrogen, halogen, —CN, —NO.sub.2, —N.sub.3, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted acyl, optionally substituted hydroxyl, optionally substituted amino, optionally substituted thiol, or an oxygen protecting group. In certain embodiments, R′″ is hydrogen. In certain embodiments, R′″ is halogen. In certain embodiments, R′″ is —CN. In certain embodiments, R′″ is —NO.sub.2. In certain embodiments, R′″ is —N.sub.3. In certain embodiments, R′″ is optionally substituted alkyl. In certain embodiments, R′″ is optionally substituted alkenyl. In certain embodiments, R′″ is optionally substituted alkynyl. In certain embodiments, R′″ is optionally substituted aryl. In certain embodiments, R′″ is optionally substituted heteroaryl. In certain embodiments, R′″ is optionally substituted carbocyclyl. In certain embodiments, R′″ is optionally substituted heterocyclyl. In certain embodiments, R′″ is optionally substituted acyl. In certain embodiments, R′″ is optionally substituted hydroxyl. In certain embodiments, R′″ is optionally substituted amino. In certain embodiments, R′″ is optionally substituted thiol.
[0241] In certain embodiments, R′″ comprises a reactive moiety for bioconjugation (e.g., click chemistry handle, e.g., azide or alkyne), a fluorophore, catalytic protein, oligonucleotide, or reporting tag.
[0242] As generally defined herein, R.sup.N is hydrogen, optionally substituted alkyl, optionally substituted acyl, or a nitrogen protecting group. In certain embodiments, R.sup.N is hydrogen. In certain embodiments, R.sup.N is optionally substituted alkyl. In certain embodiments, R.sup.N is optionally substituted acyl. In certain embodiments, R.sup.N is a nitrogen protecting group.
[0243] In certain embodiments, R.sup.N comprises a reactive moiety for bioconjugation (e.g., click chemistry handle, e.g., azide or alkyne), a fluorophore, catalytic protein, oligonucleotide, or reporting tag.
RNA Oligonucleotide Synthesis with Non-Hydrolyzable RNA Nucleotides
[0244] Also provided herein are methods for RNA oligonucleotide synthesis employing non-hydrolyzable nucleotides. As described herein, the rate at which a polymerase can incorporate nucleotides (i.e., hydrolyzable nucleotides) at the 3′-terminus of an initiator oligonucleotide can be controlled by introducing a non-hydrolyzable nucleotide that competes for the enzyme's active site. The non-hydrolyzable nucleotide is not incorporated, and the rate of incorporation of the hydrolyzable nucleotide is directly impacted by the ratio of the hydrolyzable nucleotide and the non-hydrolyzable nucleotides through competitive inhibition. Ultimately, the number of incorporations of an nucleotide is determined by the concentration of a non-hydrolyzable nucleotide in the reaction mixture. After a poly(N) polymerase incorporates one or more nucleotides via terminal transferase, the process can be repeated in one or more in iterative steps, optionally with different nucleotides, until a desires RNA oligonucleotide sequence is obtained.
[0245] Provided herein are methods for template-independent synthesis of RNA oligonucleotides, the method comprising:
[0246] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0247] (b) providing a poly(N) polymerase;
[0248] (c) combining the initiator oligonucleotide, the poly(N) polymerase, one or more nucleotides, and one or more non-hydrolyzable nucleotides under conditions sufficient for addition of at least one hydrolyzable nucleotide to the 3′ end of the initiator oligonucleotide, wherein the concentration of the non-hydrolyzable nucleotides is sufficient to inhibit the rate of addition of the one or more nucleotides by the poly(N) polymerase.
[0249] As described herein, the poly(N) polymerase is, in certain embodiments, a poly(U) polymerase. Provided herein are methods for template-independent synthesis of RNA oligonucleotides, the method comprising:
[0250] (a) providing an initiator oligonucleotide, wherein the initiator oligonucleotide is single-stranded RNA;
[0251] (b) providing a poly(U) polymerase;
[0252] (c) combining the initiator oligonucleotide, the poly(U) polymerase, one or more nucleotides, and one or more non-hydrolyzable nucleotides under conditions sufficient for addition of at least one hydrolyzable nucleotide to the 3′ end of the initiator oligonucleotide, wherein the concentration of the non-hydrolyzable nucleotides is sufficient to inhibit the rate of addition of the one or more nucleotides by the poly(U) polymerase.
[0253] In certain embodiments, the concentration of non-hydrolyzable nucleotide is such that 1-100 of the nucleotides are incorporated. In certain embodiments, the concentration of non-hydrolyzable nucleotide is such that 1-50 of the nucleotides are incorporated. In certain embodiments, the concentration of non-hydrolyzable nucleotide is such that 1-20 of the nucleotides are incorporated. In certain embodiments, the concentration of non-hydrolyzable nucleotide is such that less than 100, less than 90, less than 80, less than 70, less than 60, less than 50, less than 40, less than 30, less than 20, less than 10, less than 5, less than 4, less than 3, or less than 2 of the hydrolyzable nucleotides are incorporated.
[0254] Once the one or more nucleotides are added to the initiator oligonucleotide, one or more additional nucleotides can be added subsequently in order to synthesize a desired RNA oligonucleotide. Therefore, in certain embodiments, the method further comprises adding one or more natural or modified nucleotides to the 3′ end of the resulting RNA oligonucleotide (i.e., the RNA oligonucleotide formed in step (c)) until a desired RNA sequence is obtained. In certain embodiments, the method further comprises:
[0255] (d) repeating steps (a)-(c) until a desired RNA sequence is obtained.
Non-Hydrolyzable RNA Nucleotides
[0256] Methods provided herein employ non-hydrolyzable nucleotides. “Non-hydrolyzable” nucleotides are nucleotides capable of binding to an RNA polymerase, but incapable of undergoing the enzyme-catalyzed addition (i.e., terminal transferase reaction) to an initiator oligonucleotide (e.g., to the 3′ end of the initiator oligonucleotide). In certain embodiments, the non-hydrolyzable nucleotide is a phosphate-modified nucleotide (i.e., comprises a modified triphosphate group). Also provided herein are non-hydrolyzable nucleotides useful in the methods described herein.
[0257] For example, in certain embodiments, a non-hydrolyzable nucleotide is of the following formula:
##STR00014##
or a salt thereof, wherein:
[0258] each Y is independently —O—, —NR.sup.N—, —C(R.sup.C).sub.2—, or —S—; provided that at least one Y is not —O—;
[0259] R and R′ are independently hydrogen or sugar substituents as defined herein;
[0260] “Base” is a natural or non-natural (e.g., modified) nucleotide base as defined herein;
[0261] R.sup.N is hydrogen, optionally substituted alkyl, or a nitrogen protecting group;
[0262] and each instance of R.sup.C is independently hydrogen, halogen, or optionally substituted alkyl. In certain embodiments, —NR.sup.N— is —NH—. In certain embodiments, —C(R.sup.C).sub.2— is —CH.sub.2—.
[0263] In certain embodiments, the non-hydrolyzable nucleotide comprises a modified triphosphate group. In certain embodiments, the non-hydrolyzable nucleotide is selected from the group consisting of uridine-5′-[(α,β)-imido]triphosphate, adenosine-5′-[(α,β)-imido]triphosphate, guanosine-5′-[(α,β)-methyleno]triphosphate, cytidine-5′-[(α,β)-methyleno]triphosphate, adenosine-5′-[(β,γ)-imido]triphosphate, guanosine-5′-[(β,γ)-imido]triphosphate, and uridine-5′-[(β,γ)-imido]triphosphate. The triphosphate group may comprise any other modifications.
[0264] In certain embodiments, the non-hydrolyzable nucleotide is a 3′-modified nucleotide. In certain embodiments, the non-hydrolyzable nucleotide is selected from the group consisting of 3′-O-methyladenosine-5′-triphosphate and 3′-O-methyluridine-5′-triphosphate.
[0265] The non-hydrolyzable nucleotide may further comprise any other nucleotide modifications described above and herein.
RNA Oligonucleotide Synthesis Reactions
[0266] The terminal transferase reactions described herein (i.e., step (c) of any of the methods described herein) are carried out in the presence of a polymerase enzyme (e.g., a poly(N) polymerase). In certain embodiments, step (c) is carried out in the presence of one or more additional enzymes. In certain embodiments, step (c) is carried out in the presence of a mixture of two or more different enzymes. The mixture of enzymes may comprise more than one distinct poly(N) polymerases (e.g., 2 or 3 different poly(N) polymerases). The mixture of poly(N) polymerase enzymes may include both wild-type and mutates poly(N) polymerases (e.g., mutated poly(U) polymerases provided herein).
[0267] In certain embodiments, step (c) is carried out in the presence of one or more additional phosphatases in addition to the poly(N) polymerase. In certain embodiments, step (c) is carried out in the presence of a yeast inorganic pyrophosphatase (PPI-ase) in addition to the poly(N) polymerase.
[0268] In certain embodiments, the terminal transferase reaction in step (c) is carried out in the presence of one or more additional additives. In certain embodiments, step (c) is carried out in the presence of a crowding agent. In certain embodiments, the crowing agent is polyethylene glycol (PEG) or Ficoll. In certain embodiments, the crowding agent is polyethylene glycol (PEG). In certain embodiments, step (c) is carried out in the presence of an RNase inhibitor. In certain embodiments, step (c) is carried out in the presence of a non-hydrolyzable nucleotide.
Initiator Oligonucleotides
[0269] The methods described herein use initiator oligonucleotides. The initiator oligonucleotides may be of any sequence and can be any number of nucleotides in length. In certain embodiments, the initiator oligonucleotide is 20 nucleotides or less in length. In certain embodiments, the initiator oligonucleotide is 5-20 nucleotides in length. In certain embodiments, the initiator oligonucleotide is more than 20 nucleotides in length.
[0270] In certain embodiments, the initiator oligonucleotide is a poly-rN oligonucleotide. In certain embodiments, the initiator oligonucleotide is a poly-rU, poly-rC, poly-rG, or poly-rA.
[0271] The initiator oligonucleotide may also be covalently linked to a solid support. In certain embodiments, the oligonucleotide is cleaved from the solid support after a desired RNA oligonucleotide sequence is obtained. Therefore, in certain embodiments, the initiator oligonucleotide is covalently linked to a solid support through a cleavable linker.
[0272] The initiator oligonucleotides can comprise other modification such as fluorophores. In certain embodiments, the initiator oligonucleotide comprises a 5′-fluorophore. In certain embodiments, the fluorophore is Cy5 or FAM. The initiator oligonucleotide may also comprise one or more additional functional groups or handles for bioconjugation. In certain embodiments, the initiator oligonucleotide is functionalized with biotin.
[0273] In certain embodiments, the initiator oligonucleotide comprises a 5′-phosphate (e.g., 5′-mono-, di-, or triphosphate). In certain embodiments, the initiator oligonucleotide comprises a 5′-monophosphate. In certain embodiments, the initiator oligonucleotide comprises a 5′-diphosphate. In certain embodiments, the initiator oligonucleotide comprises a 5′-triphosphate.
[0274] In certain embodiments, the initiator oligonucleotide comprises a 5′-capping group (i.e., 5′ cap).
[0275] In certain embodiments, the 5′ cap can be a mono-nucleotide (1-nt), di-nucleotide (2-nt), tri-nucleotide (3-nt), or N-nucleotide (i.e., of any oligonucleotide length that would be useful). The 5′ cap may also comprise a combination of one or more natural and non-natural (e.g., modified) nucleoside bases, including those described herein.
[0276] In certain embodiments, the 5′ cap is a guanine cap. In certain embodiments, the 5′ cap is a 7-methylguanylate cap (m.sup.7G). A In certain embodiments, the guanine or m.sup.7G cap includes a guanine nucleotide connected to the oligonucleotide via a 5′ to 5′ triphosphate linkage. In certain embodiments, the 5′ cap includes methylation of the 2′ hydroxy-groups of the first and/or second 2 ribose sugars of the 5′ end of the oligonucleotide.
[0277] In certain embodiments, the 5′-cap is a 5′-trimethylguanosine cap or a 5′-monomethylphosphate cap. In other embodiments, the 5′ cap is a NAD.sup.+, NADH, or 3′-dephospho-coenzyme A cap.
[0278] In certain embodiments, the initiator oligonucleotide comprises a primer site for reverse transcription of the synthesized RNA oligonucleotide. In certain embodiments, the initiator oligonucleotide comprises a primer site for PCR amplification.
Splicing RNA Fragments Together with 5′-Triphosphorylated Oligonucleotides
[0279] In certain embodiments, the methods provided herein can be applied to the splicing of oligonucleotide fragments together (i.e., ligation) using a 5′-triphosphate group by a template-independent polymerase to create a long RNA (e.g., >100-nt in length) molecule.
[0280] A 5′-triphosphate oligonucleotide, either synthesized as an initiator oligonucleotide or as the product of controlled, template-independent enzymatic synthesis (e.g., a method described herein), can be a substrate of polymerase such as poly(U) polymerase or mutated variant thereof (e.g., a mutated variant described herein). In certain embodiments, the poly(U) polymerase or mutated variant thereof is accepting of large 3′-modifications. In some instances, the 3′-modification is a series of nucleic acids (i.e., oligonucleotide) instead of a single nucleoside triphosphate or a protecting group.
[0281] Thus, provided herein are methods for the synthesis of RNA oligonucleotides, the methods comprising:
[0282] (a) providing a first oligonucleotide, wherein the first oligonucleotide comprises a 5′-triphosphate group;
[0283] (b) providing a second oligonucleotide;
[0284] (c) providing a poly(U) polymerase;
[0285] (d) combining the first and second oligonucleotides and the poly(U) polymerase under conditions sufficient for the ligation of the first oligonucleotide to the 3′ end of the second oligonucleotide.
[0286] In certain embodiments, the second oligonucleotide is a 3′-OH oligonucleotide.
[0287] In certain embodiments, the 5′-triphosphate oligonucleotide is modified to include phosphorothioate at the alpha (α)-phosphate.
[0288] In certain embodiments, the first oligonucleotide (e.g., 5′-triphosphorylated oligonucleotide includes one or more modifications to the nucleobases, sugars, or backbone of the oligonucleotide. In certain embodiments, the second oligonucleotide includes one or more modifications to the nucleobases, sugars, or backbone of the oligonucleotide.
[0289] In certain embodiments, template-independent ligations occur in reaction conditions that enhance ligation activity, such as the addition of crowding agents, etc. as described herein.
Reverse Transcription and Amplification of RNA Oligonucleotides
[0290] The methods provided herein can be applied to the synthesis of DNA oligonucleotides. After a desired RNA oligonucleotide is obtained via a method described herein, one or more additional steps of reverse transcription and/or amplification can be carried out to yield DNA (e.g., cDNA, ssDNA, double stranded DNA). The end result is a method for controlled, template-independent synthesis of DNA oligonucleotides.
[0291] Therefore, in certain embodiments, a method provided herein further comprises a step of:
[0292] (f) performing reverse transcription on the resulting RNA oligonucleotide using a reverse transcription priming site, primer, and a reverse transcriptase enzyme to produce a complementary single-stranded DNA oligonucleotide. In certain embodiments, the reverse transcriptase enzyme is a high-fidelity reverse transcriptase enzyme.
[0293] In certain embodiments, a method provided herein further comprises a step of:
[0294] (g) amplifying the complementary single-stranded DNA oligonucleotide or cDNA produced from synthesized RNA oligonucleotide via reverse transcription in step (f) with a DNA polymerase to be produce double-stranded DNA. In certain embodiments, the DNA polymerase is a high-fidelity DNA polymerase.
EXAMPLES
Introduction
[0295] Oligonucleotide-based therapeutics are an emerging modality in the rationally-designed and personalized, postgenomic era of medicine (Khvorova et al. 2017). Comprised of short sequences of natural and/or non-natural, modified nucleic acid building blocks, oligonucleotide therapeutics can be specifically tailored to affect a target with maximum efficacy while retaining an optimal pharmacokinetic profile (Deleavey et al. 2012). This is largely defined by the chemical and structural architecture of the oligonucleotide therapeutic, which can include a combination of carefully chosen modifications to the sugar rings, nucleobases, and phosphate backbone as well as the overall three-dimensional structure of the oligonucleotide (Cummins et al. 1995, Eckstein 2014, Watts et al. 2008, Wilson et al. 2006). Both chemical composition and the sequence in which the nucleic acid building blocks are assembled confer the global properties of the oligonucleotide therapeutic; a slight rearrangement or different chemical moiety could potentially improve its therapeutic ability (Khvorova et al. 2017, Koch et al. 2014, Bohr et al. 2017). This is a clear a key advantage over traditional small molecule therapeutics where a major redesign may be necessary for optimization. While there is a diverse array of successful oligonucleotide therapeutics classes, such as short (<50-nt) antisense oligonucleotides (ASOs) (Goyal et al. 2018, Uhlmann et al. 1990), short-interfering RNA (siRNA) (Dana et al. 2017), microRNA (miRNA) (Rupaimoole et al. 2017), etc., as well as longer (>100-nt) messenger RNA (mRNA) (Pardi et al. 2018) and long-noncoding RNA (lncRNA) (Arun et al. 2018), one unifying theme among each is that their production, especially at large scales, is vastly limited by the current state oligonucleotide synthesis technology (Ma et al. 2012).
[0296] The synthesis of DNA and RNA oligonucleotides using the phosphoramidite chemistry has been a staple of scientific research since the 1970s (Beaucage et al. 1992). The phosphoramidite chemistry is exceedingly reliable and inexpensive for the synthesis of short, uncomplicated DNA oligonucleotides comprised of the four natural nucleobases. However, aside from the advent of massively parallelized synthesis and automation technology, there has been only minor, incremental improvements to the core methodologies of phosphoramidite-based oligonucleotide synthesis (Beaucage et al. 1992, Kosuri et al. 2014). This is especially true for the chemical synthesis of RNA and heavily modified oligonucleotides, which is still very costly, low-yielding, and often requires multiple purifications post-synthesis that greatly increases the lead-time to isolate appreciable quantities of the desired product (Baronti et al. 2018). Furthermore, the phosphoramidite chemistry is not particularly conducive to a large repertoire of chemical modifications, a necessity for many current oligonucleotide therapeutics (Khvorova et al. 2017), as organic solvents and harsh conditions complicates synthesis schemes by requiring additional protecting groups for labile moieties that may confer unique properties onto the oligonucleotide for delivery or ligand binding purposes, for example (Baronti et al. 2018). In vitro transcription (IVT) strategies have ameliorated some of these limitations; particularly the production of long RNA oligonucleotides (>120-nt), which is currently impossible with the phosphoramidite chemistry (Pardi et al. 2018, Milligan et al. 1987, Sahin et al. 2014). However, IVT does not allow for site-specific labeling of the oligonucleotide, requiring the user to swap out particular bases in addition to using a DNA template for proper enzymatic catalysis. Unfortunately, the combination of high-costs, difficult synthesis, and inaccessibility to diverse nucleic acid building blocks has stifled researchers from developing innovative oligonucleotide therapeutics to combat debilitating diseases. One potential solution to address the aforementioned limitations of oligonucleotide synthesis and oligonucleotide-based therapeutic development is to completely circumvent the use of the phosphoramidite chemistry. Currently, there is great interest in utilizing a class of polymerases known as nucleotidyl transferases, which catalyze the addition of a nucleoside monophosphate to the 3′-end of a short initiator sequence, to synthesize oligonucleotides de novo (Perkel 2019, Pratt et al., 2008). Many nucleotidyl transferases do not require the use of a template sequence and their reactions can be carried out under aqueous conditions, avoiding many of the negative aspects of chemical oligonucleotide synthesis including nucleobase depurination, unwanted insertions or deletions, and the accumulation of irreversibly capped truncation products. Some notable nucleotidyl transferases capable of template-independent de novo oligonucleotide synthesis include, but are not limited to, Terminal deoxynucleotidyl Transferase (TdT) (Motea et al. 2010), Cid1 poly(U) polymerase (PuP) (Munoz-Tello et al. 2012), poly(A) polymerase (PaP) (Balbo et al. 2007), poly(G) polymerase (PgP), poly(C) polymerase (PcP), CCD-adding enzyme (Cho et al. 2007), polymerase Mu (μ) (Dominguez et al. 2000), and polymerase Theta (Θ) (Thomas et al. 2019). Of the aforementioned nucleotidyl transferases, only terminal deoxynucleotidyl transferase has been used in a successful demonstration of enzymatic oligonucleotide synthesis (Palluk et al. 2019). However, only applications in DNA data storage are so far possible as terminal deoxynucleotidyl transferase is difficult to control, has a strong preference for natural deoxynucleoside triphosphates, and is exceedingly biases toward certain nucleobases and initiator combinations over others—attributes that can be computationally correct post-synthesis to retrieve stored data (Ceze et al. 2019, Anavy et al. 2019, Lee et al. 2019). Thus, the development of an enzymatic oligonucleotide synthesis platform that can (1) extend the growing sequence by a single base (n+1) with a reversible blocked modified nucleoside triphosphate, (2) incorporate an array of modified nucleoside triphosphates that confer therapeutic or other value to the oligonucleotide, and (3) be scaled to industrially relevant outputs is of great importance.
Controlled Enzymatic Synthesis of RNA Oligonucleotides
[0297] Several methods for the controlled de novo synthesis of RNA oligonucleotides via enzymatic catalysis have been developed. Engineered and wild-type polymerases with the ability to efficiently incorporate natural and modified ribonucleotide triphosphates (rNTPs) without a template sequence can be used to iteratively add nucleotides to the 3′-OH of an initiator oligonucleotide sequence. Their addition can be through either single or multiple incorporation events. The biologically compatible reaction conditions needed for enzyme functionality greatly reduces the susceptibility of RNA oligonucleotides to degradation that is normally associated with chemical synthesis. These methods can be integrated into a microfluidic or array-based format to synthesize many RNA oligonucleotides in parallel with high cost efficiency. An RNA oligonucleotide synthesized with this method can be produced with a low error rate and will be biologically compatible for downstream biotechnological applications.
[0298] The DNA/RNA-directed polymerase, polymerase μ, and the RNA-directed polymerases, poly(A) polymerase (PAP) and poly(U) polymerases are three examples of polymerases that are compatible for the aforementioned RNA synthesis schemes. However, any other polymerase or enzyme with the capacity to add nucleotides to the 3′-terminus of an initiator oligonucleotide without the need of a template sequence could be used, such as CCA-adding enzymes. This includes possible functional mutants that display a similar or increased capacity for controlled de novo RNA synthesis.
[0299] Some possible applications of this invention include the following: (1) the cost-efficient and high-fidelity de novo synthesis of RNA oligonucleotides longer than 100-nt, (2) synthesized RNA oligonucleotides can be used as a cheap and high-quality source of biological material such as: synthetic transfer RNA, ribosomal RNA, self-folding RNA structures, novel ribozymes, protein binding complexes, RNA therapeutics, CRISPR/Cas9 Guide RNA, and RNA sequencing probes (such as padlock probes for in situ sequencing), (3) the production of useful, PCR amplifiable, DNA oligonucleotides or gene sequences via conversion by reverse transcription, and (4) enzymes used for RNA synthesis like Pol(p) (a DNA/RNA-directed polymerase) are additionally candidates for controlled enzymatic synthesis of DNA oligonucleotides or gene sequences under biologically compatible reaction conditions.
Controlling rNTP Incorporation Speed with Impeding Reaction Conditions
[0300] RNA oligonucleotide synthesis can be controlled by selecting reaction components that heavily impede natural nucleotide incorporation catalysis rates and maximize desired length products such as the addition of non-hydrolyzable or incompatible nucleotides (
Modified rNTP Incorporation Reversibility Prevents Additional Incorporation Events
[0301] RNA oligonucleotide synthesis can be also controlled by incorporating modified nucleotides that temporarily alter the binding affinity of the polymerase to the initiator oligonucleotide in order to limit the extension reaction to just one incorporation event (n+1) (
polymerase Enzymes for Controlled RNA Synthesis
Family X Polymerases
[0302] polymerases from the Family X such as Terminal deoxynucleotidyl Transferase (TdT), polymerase Mu (Pol μ), polymerase Beta (Pol β), and polymerase Lambda (Pol λ) are candidates for the controlled, template-independent synthesis of RNA oligonucleotides (Fowler and Suo 2006). These highly specialized polymerases have been shown to be key driving forces in critical DNA repair pathways such as non-homologous end joining (NHEJ) and the generation of generation of antibody and T-cell receptor diversity during V(D)J recombination (Moon et al. 2007, 2014; Nick McElhinny and Ramsden 2004; Bertocci et al. 2006). The involvement of Family X polymerases in such biological processes are attributed to their precision in incorporating natural nucleotides in a template-dependent manner while maintaining the ability to indiscriminately add nucleotides to a primer sequence independently of a template when variability is necessary (J. F. Ruiz et al. 2001; Dominguez et al. 2000; Motea and Berdis 2010). This unique capacity is ideal for the enzymatic synthesis of RNA in that there is a large margin of natural flexibility associated with the Family X polymerases without the need for protein evolution schemes. It has been previously shown that TdT has the ability to incorporate natural nucleotides in addition to DNA nucleotides (Roychoudhury 1972). Family X polymerases could be further engineered to be more compatible with the proposed RNA synthesis schemes.
polymerase Mu (Pol μ)
[0303] Pol μ is a Family X polymerase that, under optimal reaction conditions, has been shown to efficiently incorporate both deoxyribonucleotide triphosphates (dNTPS) and rNTPs to DNA, RNA, and DNA-RNA hybrid oligonucleotide substrates (José F. Ruiz et al. 2003; Agrawal et al. 2003). Several studies of the enzyme's primary structure, catalytic pocket, and various catalytic states have determined the amino acid residues associated with rNTP binding and the kinetics of their incorporation (Moon et al. 2014; Jamsen et al. 2017; Moon et al. 2017). Interestingly, wild-type Pol μ has the ability to incorporate a rNTP without distorting the oligonucleotide primer or nucleotide structures as well as keeping the geometry of the active site in a normal configuration; a phenomena that may greatly affect the ability of other Family X polymerases to accommodate rNTPs in any useful capacity or speed (Moon et al. 2017). In addition, it is worth noting that Pol has been cited to be less discriminatory in its preference towards the DNA substrate compared to other Family X polymerases (Moon et al. 2015).
Pol μ Mutagenesis
[0304] In one study, the expression of the two tumor associated human Pol μ point mutations, (G174S) and (R175H), produced enzymes with decreased efficiency and fidelity in NHEJ. These mutants were cited to randomly incorporate nucleotides despite having a template sequence guiding the DNA repair process resulting in significant alterations to the expected error-rates (Sastre-Moreno et al. 2017). Other groups have demonstrated that removing large proportions of Pol μ such as the N-terminal BRCT domain (which is typically associated with other DNA repair pathway core factors) result in active enzymes (Moon et al. 2014). These truncated variants were shown to retain wild-type activity and ability to bind non-hydrolyzable nucleotides, but potentially have more physical space to incorporate modified or bulky nucleotides. Nevertheless, wild-type Pol μ is characterized as a primarily template-dependent polymerase; however, the point mutation (R387K) to human wild-type Pol μ resulted in an enzyme with significant increased template-independent activity (Andrade et al. 2009). This point mutation (R387K) is exceedingly important to the feasibility using Pol in template-independent de novo RNA oligonucleotide synthesis and, again, reiterates the immense value of its flexibility. Pol μ is currently the only known polymerase out of the Family X and beyond that displays both template-dependent and template-independent activities (Domínguez et al. 2000; Juarez et al. 2006). In addition to a wild-type or mutagenized Pol μ, there are other polymerases that could be potentially used to synthesize long RNA oligonucleotides de novo.
Poly(A) Polymerase, Poly(U) Polymerase, & Other RNA Polymerases
[0305] The 3′-tailing of single-stranded RNA with ribonucleotides is important in two different contexts: (1) natural biological or biochemical processes and (2) studying these processes in vivo or in vitro (Proudfoot 2011; Strauss et al. 2012). For the latter, several groups have employed wild-type RNA polymerases such as Saccharomyces cerevisiae and Escherichia coli poly(A) polymerase (PAP), Schizosaccharomyces pombe Cid 1 poly(U) polymerase (PUP) to directly label the 3′-terminus of RNA oligonucleotides in vitro in a template-independent manner (G. Martin and Keller 1998; Munoz-Tello, Gabus, and Thore 2012; Kwak and Wickens 2007; Winz et al. 2012). Under optimal conditions, it was shown that these families of enzymes, in particular, PAP, can accept modified ribonucleotides with modifications at the 2′- and 3′-positions of the sugar as well as the 8′-position of the adenosine base (Winz et al. 2012). While the overall incorporation efficiency varied between the modified position, nucleotide base, and the enzymes tested, 1-3 nucleotide incorporation events took place on average yielding a RNA oligonucleotide with a 3′- or internal azide functional group to be attached with a dye via bioorthogonal click chemistry (Winz et al. 2012).
[0306] In addition to studying the mechanism of modified nucleotide incorporation, other groups have examined both the biochemical and structural mechanisms for substrate binding and catalysis of PAP (Georges Martin et al. 2004; Bard et al. 2000). Through these studies, which included site-directed mutagenesis of many residues in the catalytic pocket and exhaustive analysis of steady-state kinetics, it was clear that there is that incorporation was heavily biased towards ATP over the other nucleotide bases (Georges Martin et al. 2004). However, another group determined that a single point mutation to a bacterial PAP (R215A) resulted in a complete reversal of this bias, allowing for random incorporation of all of nucleotide bases (Just et al. 2008). This result was similar for another template-independent RNA polymerase, CCA-adding enzyme (Just et al. 2008; Xiong and Steitz 2004). These studies make RNA polymerases such as PAP to be exceedingly compatible in the execution of scheme II for controlled de novo RNA oligonucleotide. Both the wild-type and mutagenized RNA polymerases appear to be flexible enough to incorporate U, A, G, or C sugar-modified nucleotides bases (2′-,3′-, or both) that can be deprotected or altered under mild reaction conditions to restore enzyme binding affinity.
Results: Synthesis of RNA Oligonucleotides
1. Purified Human Polymerase μ R387K Displays Template-Independent Terminal Transferase Activity
[0307] Human polymerase μ R387K was expressed and purified as described in the materials and methods. Because it was unknown under which reaction conditions polymerase μ R387K functioned optimally, several reaction parameters were initially evaluated. It was found that an incubation temperature 37° C. and the reaction buffer conditions: 10 mM Magnesium Acetate, 50 mM Potassium Acetate, and 20 mM Tris-Acetate yielded sufficient enzymatic activity in terms of dNTP incorporation. In addition, polymerase p activity was evaluated after reactions were supplemented with common divalent metal cofactors (Mn.sup.2+, Mg.sup.2+, Co.sup.2+, etc.) and it was found that a combination of Mn.sup.2+ and Mg.sup.2+ at a concentration of 0.25 mM yielded the highest rate of ssDNA generation at ˜650 RFU/minute, whereas 0.25 mM Co.sup.2+ yielded the worst rate at ˜100 RFU/minute (
2. S. cerevisiae Poly(A) Polymerase Incorporates 2′-Modified ATP Nucleotides and 2′-Blocked Reversible Terminators
[0308] The efficiency of S. cerevisiae poly(A) polymerase (Thermo 74225Z25KU) for incorporating of several 2′-modified was evaluated. The modified nucleotides evaluated included the following: 2′-F-rATP (Trilink N-1007), 2′-Azido-rATP (Trilink N-1045), 2′-Amino-rATP (Trilink N-1046), and 2′-O-Methyl rATP (Trilink N-1015). Extension reactions were supplemented with the appropriate buffers, which included 0.5 mM Mn.sup.2+, 200 pmol of the initiator RNA oligonucleotide, 2.5 mM modified nucleotide, and 900 units of enzyme. Reactions were incubated at 37° C. for 60 minutes before being analyzed with denaturing gel electrophoresis. According to the gel (
3. S. pombe Cid1 poly(U) polymerase Incorporates Natural Nucleotides Universally
[0309] The efficiency of S. pombe Cid1 poly(U) polymerase (NEB M0337) for incorporating natural ribonucleotides evaluated. For kinetic analysis, extension reactions were supplemented with the appropriate buffers, 10 pmol of the labeled initiator RNA oligonucleotide (5′-Cy5-poly rU-15-mer), 1.0 mM natural nucleotide (either ATP, UTP, GTP, or CTP), 1×SYBR Green II for RNA (Thermo), and 2 units of poly(U) polymerase. Reactions were incubated at 37° C. for 30 minutes and monitored in real time. 2 μL of each extension reaction was then analyzed using a 15% TBE-Urea gel and imaged on a Typhoon FLA 9500 system with EX: 649 nm and EM: 666 nm. It is clear from the gel that poly(U) polymerase has the ability to incorporate all-natural ribonucleotides as compared to the control; however, there is some bias in terms of how many extensions will occur (
4. S. pombe Cid1 poly(U) polymerase Incorporates 2′-Modified Nucleotides Universally
[0310] Knowing that S. pombe Cid1 poly(U) polymerase has the ability to incorporate all four natural ribonucleotides universally, it was sought to determine if this universality can be extended to 2′-modified nucleotides. Using the same reaction parameters, poly(U) polymerase was incubated with 2.5 mM 2′-O-Methyl-rATP, rUTP, rCTP or rGTP at 37° C. for 60 minutes. 2 μL of each extension reaction was then analyzed using a 15% TBE-Urea gel and imaged on a Typhoon FLA 9500 system with EX: 649 nm and EM: 666 nm. The gel indicates S. pombe Cid1 poly(U) polymerase incorporates the 2′-modified nucleotides universally and only extends the initiator oligonucleotide by +1-2 nucleotides with very high efficiently (
5. S. pombe Poly(U) Polymerase is Minimally Affected by Initiator Oligonucleotide Sequence Composition and Secondary Structure/Hairpins
[0311] Many terminal transferases are extremely sensitive to the sequence composition of the initiator oligonucleotide, where a different base at the 3′-OH terminus can greatly affect the rate at which a nucleotide is incorporated. Thus, it was investigated whether S. pombe poly(U)polymerase is affected in this manner by performing extension reactions for all four natural ribonucleotides in the presence of two 5′-labeled initiator oligonucleotides with differing compositions. Reactions were performed with 1 mM ribonucleotide and 10 pmol of the 5′-labeled initiator oligonucleotide. 2 μL of each extension reaction was then analyzed using a 15% TBE-Urea gel and imaged on a Typhoon FLA 9500 system with EX: 649 nm and EM: 666 nm for the 5′-Cy5-poly rA-15-mer and EX: 495 nm and EM: 520 nm. It was found that S. pombe poly(U) polymerase is minimally affected by initiator oligonucleotide sequence composition bias as indicated by denaturing gel electrophoresis (
6. S. pombe Poly(U) Polymerase Activity is Enhanced by the Addition of Inorganic Pyrophosphatase
[0312] A consequence of high terminal transferase activity is the fast accumulation of inorganic pyrophosphate, a known inhibitor of DNA- and RNA-directed polymerases. In order to reduce the accumulation of inorganic pyrophosphate, an inorganic pyrophosphatase (PPi-ase) can be employed to cleave the pyrophosphate into two single phosphates while the reaction progresses. Therefore, it was sought to determine if the supplementation of pyrophosphatase can enhance the terminal transferase activity of S. pombe poly(U) polymerase. Reactions were incubated for 30 minutes at 37° C. with 1 mM of each ribonucleotide, 10 pmol of 5′-Cy5-poly-rU-15-mer initiator oligonucleotide, and 0.1 units of Yeast Inorganic Pyrophosphatase (New England Biolabs M2403). 2 μL of each extension reaction was then analyzed using a 15% TBE-Urea gel and imaged on a Typhoon FLA 9500 system with EX: 649 nm and EM: 666 nm. It was found that the supplementation of inorganic pyrophosphatase enhances the rate at which S. pombe poly(U) polymerase synthesizes RNA and increases the maximum length of the synthesized RNA (
7. S. pombe Poly(U) Polymerase Activity can Naturally Incorporate Base-Modified Ribonucleotides
[0313] An application of the methods provided herein is the synthesis of biologically active molecules such as synthetic transfer RNA (tRNA) or ribosomal RNA (rRNA). Often the ribonucleotide bases that comprise tRNA and rRNA are naturally base modified to, for example, induce secondary structure in vivo for optimal functionality. Additionally, the incorporation of modified bases into RNA oligonucleotides can greatly enhance their stability and protect against unwanted nuclease digestion. Thus, it was sought to determine if S. pombe poly(U) polymerase has the ability to incorporate Pseudouridine, one of the most commonly found modified ribonucleotide bases in tRNA and rRNA. Reactions were incubated for 30 minutes at 37° C. with 2 mM, 1 mM, or 0.5 mM rUTP or Pseudouridine (Trilink N-1019), 10 pmol of 5′-Cy5-poly-rU-15-mer initiator oligonucleotide, and 0.1 units of Yeast Inorganic Pyrophosphatase. 2 μL of each extension reaction was then analyzed using a 15% TBE-Urea gel and imaged on a Typhoon FLA 9500 system with EX: 649 nm and EM: 666 nm. It was found that S. pombe poly(U) polymerase has the innate ability to incorporate Pseudouridine, producing based-modified RNA oligonucleotides approximately 30-45-nt in length (
8. RNA Synthesis by S. pombe Poly(U) Polymerase can be Controlled with Competitive Inhibitor Nucleotides
[0314] As exemplified in
9. RNA Synthesis by S. pombe Poly(U) Polymerase can be Controlled with 2′-O-Blocked Reversible Terminator Nucleoside Triphosphates
[0315] As exemplified by
10. S. pombe Poly(U) Polymerase Efficiently Incorporates 2′-Reversible Terminator Nucleoside Trisphosphates with All Four Natural Nucleobases
[0316] Previously, it was determined that S. pombe poly(U) polymerase has the ability to incorporate 2′-modified nucleoside triphosphates (2′-methoxy) bearing the four natural RNA nucleobases (A, U, G, C) with relatively equal efficiency (
11. Active S. pombe Poly(U) Polymerase can be Expressed in Bacteria with an N-Terminus His.sup.6-Tag for Large-Scale Production and Purification
[0317] The primary sequence for S. pombe poly(U) polymerase (UniProtKB—O13833) was modified by adding the amino acids “MGSSHHHHHHSSGLVPRGSH” to the N-terminus of the enzyme. These amino acids encode for an N-terminus His.sup.6-tag with the appropriate linkers. Using the protocol outlined in the material and methods section, N-terminus His.sup.6-tagged S. pombe poly(U) polymerase was expressed, purified, and concentrated to a small volume. Denaturing gel electrophoresis indicated that N-terminus His.sup.6-tagged S. pombe poly(U) polymerase was properly expressed and isolated from bacterial lysates. With the N-terminus His.sup.6-tag, the expected molecular weight of S. pombe poly(U) polymerase is approximately 45 kDa—which a strong band corresponded to on the gel (
12. Controlled RNA Oligonucleotide Synthesis Using S. pombe Poly(U) Polymerase can be Carried Out on Solid-Phase Surfaces
[0318] Controlled RNA oligonucleotide synthesis can be readily performed using bulk solutions; however, after the extension and deblocking steps in each synthesis cycle the growing oligonucleotide must be purified to remove interfering components. Multiple purifications, while having efficient recovery with modern methods, ultimately lead to major sample loss after several cycles of synthesis. Thus, performing oligonucleotide synthesis on a solid-phase support such as functionalized beads, wells, slides, etc. is significantly more conducive for the synthesis of longer oligonucleotide fragments and large, industrially relevant quantities of material. In order to evaluate the ability for S. pombe poly(U) polymerase to extend oligonucleotides anchored to a surface, an initiator oligonucleotide bearing a 5′-amine group and internal Cy5 dye was first used to attach a 5′-Biotin-PEG-NHS linker (EZ-Link #A35389 Thermo). The efficiency the labeling reaction was determined to be >90% via analysis with a 15% TBE-urea gel (the addition of the bulky PEG group will make the oligonucleotide run differently as compared to the non-labeled oligonucleotide) (
13. A Reusable Solid-Phase Support with Covalent Linker can be Used for S. pombe Poly(U) Polymerase Mediated Controlled Enzymatic RNA Oligonucleotide Synthesis
[0319] A major contributing factor to the overall cost of controlled enzymatic RNA oligonucleotide synthesis is the oligonucleotide initiator sequence. In previous examples of bulk synthesis, the oligonucleotide initiator sequence is consumed and typically non-reusable. Additionally, it is difficult to remove the oligonucleotide initiator sequence from the final product if desired. To overcome this problem, the site-specific cleavage of riboinosines (rI) and/or deoxyinosines (dI) in single stranded RNA, DNA, or combination thereof, by Endonuclease V can be used to remove unwanted initiator sequence from the final oligonucleotide product. Endonuclease V is highly specific for riboinosines (rI) and deoxyinosines (dI) and will not destroy other bases in the oligonucleotide initiator sequence. Expanding this concept to solid-phase oligonucleotide synthesis, which more is conducive for long RNA oligonucleotide synthesis and industrial relevant synthesis scales in comparison to bulk solution synthesis, a reusable set of beads, wells, slides, etc. can be produced for repeated, and potentially unlimited, synthesis runs. A brief overview of this process is given in
[0320] In order to determine if this scheme works as intended, an initiator oligonucleotide was synthesized with a 5′-amine group and a deoxyinosine (dI) that would yield two equally sized fragments under Endonuclease V digestion. The initiator oligonucleotide was anchored onto the surface of amine functionalized silica beads by introducing a dual-NHS-PEG9 linker that would react with the 5′-amine of the oligonucleotide and the amine on the silica beads. Derivatized beads were allowed to incubate with Endonuclease V (expressed and purified as described in the materials and methods section) for 1 hour at 37° C. Additionally, the same digestion reaction was conducted in bulk phase for comparison. For both solid-phase and bulk digestion reactions, control samples were put into place which were reactions that did not contain Endonuclease V. After the 1-hour incubation, digestion reactions were analyzed using a 15% TBE-urea gel under denaturing conditions. Gels were stained with 1×SYBR GelStar nucleic acid stain for 15 minutes shaking at room temperature. It was observed that Endonuclease V worked as intended producing digestion fragments in both the bulk and solid-phase reactions (
[0321] To demonstrate that the described solid-support system is functional for enzymatic synthesis and that initiator oligonucleotide is reusable via the deoxyinosine nucleobase remaining intact on the surface post Endonuclease V digestion, washed silica beads harboring digested initiator oligonucleotide were incubated with S. pombe poly(U) polymerase and natural rNTPs (uncontrolled extension) as well as the 2′-O-allyl-ATP reversible terminator (controlled extension) using optimized reaction conditions. For comparison, beads with newly anchored, undigested initiator oligonucleotide were extended similarly. All beads were then washed with 10 mM Tris-HCl (pH 6.5) and allowed to incubate in the presence of Endonuclease V for 1 hour at 37° C. The efficiency of extension and cleavage from the surface was then analyzed using a 15% TBE-urea gel under denaturing conditions and stained with 1×SYBR GelStar nucleic acid stain for 15 minutes shaking at room temperature. The gel indicated positive extension and cleavage for both the reused and newly derivatized beads under all conditions (
14. Development of 3′-Blocked Reversible Terminator Nucleotides and Use in Oligonucleotide Synthesis
[0322] New nucleoside triphosphates for the enzymatic synthesis of RNA oligonucleotides and modified oligonucleotides have been developed. RNA oligonucleotides and modified oligonucleotides can be used in various applications including oligonucleotide therapeutics. Nucleoside triphosphates are reversibly terminated with a blocking group at the 3′-position of the sugar ring, conferring only (n+1) extension of the growing oligonucleotide; extension reactions do not produce a free hydroxyl group (—OH) at the 3′-position where further extension may be possible. The blocking group can be removed with a mild, biocompatible deprotection agent. This strategy compliments virtual blocking at the 2′ position or base where the growing oligonucleotide is sterically blocked rather than chemically blocked (these are also known as “virtual terminators”).
[0323] In some instances, the 3′-blocking strategy requires a compatible enzyme (e.g., mutagenesized poly(U) polymerase described herein), that accommodates the blocking chemical domain. There are a number of chemical domains that can be used for the 3′-blocking strategy as listed below. Some examples include, but are not limited to, 3′-O-allyl triphosphates (3′-O-allyl-NTP) and 3′-O-azidomethyl triphosphates (3′-O-azidomethyl-NTP).
[0324] The new 3′-reversibly terminated nucleoside triphosphates can have the advantage of including multiple modifications that confer therapeutic or other functional value to the overall oligonucleotide. Nucleoside triphosphates may have single or multiple modifications in addition to the 3′-reversible terminating group. Modifications can be introduced site-specifically into the oligonucleotide, without additional protecting groups. These nucleoside triphosphates require a compatible enzyme for their incorporation, which may hold a unique sequence or set of mutant codons for each modified nucleotide used. Modifications manifest as chemical handles, ligand binding domains, a way to confer oligonucleotide nuclease resistance, stereopure thiophosphonates oligonucleotides, a way to confer a propensity to form desired oligonucleotide secondary structure, or a way to confer resistance to form undesired oligonucleotide secondary structure, etc. This includes:
[0325] i. Modifications to the 2′-domain of the furanose ring, which may be, but limited to, a hydroxyl (—OH), hydrogen (—H), fluoro (—F), amine (—NH.sub.3), azido (—N.sub.3), thiol (—SH), methoxy (—OCH.sub.3), methoxyethanol (—OCH.sub.2CH.sub.2OCH.sub.3), redox-active, fluorogenic or intrinsically fluorescent moieties, natural and non-natural amino acids, peptides, proteins, mono- or oligosaccharides, functional/ligand binding glycans, and large/bulky groups such as poly-ethene-glycol (PEG).
[0326] ii. Modifications to the alpha (α) phosphate of the triphosphate, where either a thiophosphonate R or S isomer is site-specifically introduced into the oligonucleotide to produce a stereopure oligonucleotide.
[0327] iii. Modifications to the beta (β) and gamma (γ) phosphates of the triphosphate: where either and/or both modifications confer value to the enzymatic oligonucleotide synthesis scheme; for example, to prevent or limiting unwanted pyrophosphorolysis as a consequence of pyrophosphate generation,
[0328] iv. Modifications to the furanose ring, which may be, but not limited to, replacing the ring's oxygen with a sulfur or introducing a bridge between the 2′-oxygen and the 4′-carbon that limits ring conformation.
[0329] v. Modifications to the nucleobase, where the base is natural or non-natural pyrimidine or purine, and may include, but not limited to, N.sup.1-methyl-adenine, N.sup.6-methyl-adenine, 8′-azido-adenine, N,N-dimethyl-adenosine, aminoallyl-adenosine, 5′-methyl-urdine, pseudouridine, N.sup.1-methyl-pseudouridine, 5′-hydroxy-methyl-uridine, 2′-thio-uridine, 4′-thio-uridine, hypoxanthine, xanthine, 5′-methyl-cytidine, 5′-hydroxy-methyl-cytidine, 6′-thio-guanine, and N.sup.7-methyl-guanine.
[0330] At the completion of synthesis, oligonucleotides may be irreversibly capped with a final 3′-blocked nucleoside triphosphate that may confer further functional or therapeutic value. This also may require the use of a compatible enzyme (e.g., mutated poly(U) polymerase enzyme) and may be a modification group described herein. Additionally, both the 3′- and 2′-domains for the furanose ring may be irreversibly blocked with the same or different groups.
[0331] In addition to mono-nucleoside triphosphate, di-nucleoside triphosphates, tri-nucleoside triphosphates, and N-nucleoside triphosphates (where N=a triphosphorylated oligonucleotide of N length) can be used as substrates for incorporation using a compatible enzyme catalyst, effectively making an oligonucleotide ligase.
[0332] In some cases, the addition of a new nucleoside triphosphate may introduce a cleavable handle that can be acted upon by chemical or biological means for post-synthesis processing and purification. For example, oligonucleotides bearing a hypoxanthine (inosine) group may be site-specifically cleaved by Endonuclease V. This is particularly useful for solid-phase synthesis of oligonucleotides, where the bound oligonucleotide initiator can be reused indefinitely.
Enzymatic Oligonucleotide Synthesis with Wild-Type and Mutated Poly(N) Polymerases
[0333] Gel electrophoresis analysis of H336 mutants' capacity to incorporate the natural nucleotide GTP—“G” and CTP—“C” is shown in
[0334] Gel electrophoresis analysis of poly(U) polymerase mutant H336R capacity to incorporate an array of natural and analogue nucleotides in comparison to the wild-type poly(U) polymerase is shown in
[0335] Uncontrolled incorporation of 2′-methoxy-adenosine triphosphate (2′-O-Me-ATP) by various S. pombe poly(U) polymerase mutants, specifically at position H336 is shown in
[0336] Uncontrolled incorporation of 2′-fluoro-adenosine triphosphate (2′-F-ATP) by various S. pombe poly(U) polymerase mutants, specifically at position N171 is shown in
[0337] Controlled incorporation (capping) of 3′-methoxy-adenosine triphosphate (3′-O-Me-ATP) by various S. pombe poly(U) polymerase mutants, specifically at position N171 is shown in
[0338] Controlled incorporation of the reversible terminator 3′-O-allyl Adenosine Triphosphate (3′-(O-allyl)-ATP) by various S. pombe Mutants is shown in
[0339] Controlled incorporation of the reversible terminator 3′-O-allyl carbonate deoxyadenosine triphosphate (3′-(0-allyl carbonate)-dATP) by the poly(U) polymerase double mutant H336R-N171A is shown in
[0340] Reaction calibration assessment of purified poly(U) polymerase stock H336R with reversible terminator 3′-O-allyl Adenosine Triphosphate 3′-(O-allyl)-ATP) is shown in
[0341] Demonstration of controlled enzymatic synthesis is shown in
3′-Reversible Terminator Structures & Synthesis
[0342] Exemplary structures of 3′-reversible terminator nucleotides for enzymatic incorporation are shown in
[0343] Select 3′ protecting groups where the furanyl ring bears oxygen are shown in
[0344] Exemplary scheme for the preparation of a 3′ azidomethyl ether for a nucleotide triphosphate is shown in
[0345] Exemplary scheme for the preparation of a 3′ azidomethyl ether for a locked nucleotide triphosphate is shown in
[0346] Exemplary scheme for the preparation of a 3′ allyl ether for a nucleotide triphosphate is shown in
[0347] Exemplary scheme for the preparation of a 3′ azidomethyl ether for a locked nucleotide triphosphate is shown in
TABLE-US-00001 Sequences Human polymerase Mu R387K (SEQ ID NO: 1) MLPKRRRARVGSPSGDAASSTPPSTRFPGVAIYLVEPRMGRSRRAFLTGL ARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALL DISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLT HHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQ GLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKT ADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRSDVDALQQ VVEEAVGQALPGATVTLIGGERRGKLQGHDVDFLITHPKEGQEAGLLPRV MCRLQDQGLILYHQHQHSCCESPTRLAQQSHMDAFEKSFCIFRLPQPPGA AVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRK EKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA Saccharomyces cerevisiae poly(A) polymerase (SEQ ID NO: 2) MSSQKVFGITGPVSTVGATAAENKLNDSLIQELKKEGSFETEQETANRVQ VLKILQELAQRFVYEVSKKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSD IDTLVVVPKHVIREDFFTVEDSLLRERKELDEIAPVPDAFVPIIKIKESG ISIDLICARLDQPQVPLSLTLSDKNLLRNLDEKDLRALNGTRVTDEILEL VPKPNVFRIALRAIKLWAQRRAVYANIFGFPGGVAWAMLVARICQLYPNA CSAVILNRFFIILSEWNWPQPVILKPIEDGPLQVRVWNPKIYAQDRSHRM PVITPAYPSMCATHNITESTKKVILQEFVRGVQIINDIFSNKKSWANLFE KNDEFFRYKFYLEITAYTRGSDEQHLKWSGLVESKVRLLVMKLEVLAGIK IAHPFTKPFESSYCCPTEDDYEMIQDKYGSHKTETALNALKLVTDENKEE ESIKDAPKAYLSTMYIGLDFNIENKKEKVDIHIPCTEFVNLCRSFNEDYG DHKVFNLALRFVKGYDLPDEVFDENEKRPSKKSKRKNLDARHETVKRSKS DAASGDNINGTTAAVDVN Schizosaccharomyces pombe poly(U) polymerase (SEQ ID NO: 3) MNISSAQFIPGVHTVEEIEAEIHKNLHISKSCSYQKVPNSHKEFTKFCYE VYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNS DMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTK NGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQ INSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDV GFDDKLEDIPPSQNYSSLGSLLHGFERFYAYKEEPREKVVTERRPDGYLT KQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRI RGEFMAASRLLNSRSYPIPYDSLFEEAPIPPRRQKKTDEQSNKKLLNETD GDNSE
Materials & Methods
Enzyme Expression and Purification
[0348] The primary sequences of wild-type or mutant enzymes of interest were codon optimized for E. coli expression using a custom optimization algorithm and ordered as gBlocks® (IDT) with 20-nt overlap sequences for Gibson Assembly into the pET-28-c-(+) His-tag expression vector (EMD Millipore 69866-3). Using forward and reverse primers from IDT, the gBlocks® were PCR amplified with Phusion High Fidelity (HF) polymerase (NEB M05030). The PCR thermocycling was performed as follows: initial denature for 98° C. for 30 seconds, denature at 98° C. for 10 seconds, anneal at 68° C. for 10 seconds, and extend at 72° C. for 60 seconds for 18 cycles before a final extension of 5 minutes at 72° C. PCR reactions were purified and concentrated using a QIAquick PCR Purification Kit (Qiagen 28106).
[0349] The pET-28-c-(+) expression vector was prepared for gBlocks® insertion by digesting the circular DNA with 40U of NDeI (NEB R0111) per 500 ng vector at 37° C. for 90 minutes. The linear DNA was separated from undigested material with 2% agarose gel electrophoresis and extracted by incubating agarose containing the bands corresponding to the linear DNA in Buffer QG (Qiagen 19063) at 55° C. rotating at 1000 RPM for 2 hours. The resultant mixture was cleaned and concentrated with the QIAquick PCR Purification Kit. The PCR amplified insert and vector sequences were combined at a ratio of 1:3 with 0.1 pmol of total material and assembled with Gibson Assembly Master Mix (NEB E5510S) at 50° C. for 1 hour. T7 Express chemically competent E. coli (NEB C2566I) were transformed with the fully assembled plasmid as per manufacturer's instructions and positive transformants are selected for on LB-kanamycin plates (50 ug/mL kanamycin).
[0350] Bacterial colonies were sequenced (Genewiz, T7—Forward Primer, T7 Term—Reverse Primer) and those with perfect matches were grown in liquid LB-kanamycin media (50 μg/mL kanamycin) overnight, diluted 1:400 in fresh liquid LB-kanamycin, and induced with 1 mM IPTG (Sigma 16758) at approximately OD.sub.600=0.8. The induced liquid cultures were incubated overnight at 15° C., shaking at 250 RPM. Cultures were then pelleted at 3500×g for 10 minutes and then His-Tag purified using a HisTalon Resin Kit as per manufacturer's instructions (Clontech 635654). The eluted enzyme samples were then buffer exchanged into an optimal 2× protein storage buffer using 15-mL filter columns (Millipore) at the appropriate MWCO by centrifugation at 5000×G for 15 minutes at 4° C. This process was repeated twice. On the third spin, samples were spun for 30 minutes in order to concentrate the protein into a smaller volume.
[0351] Two small aliquots were taken for to determine the overall protein concentration using a Reducing Agent Compatible MicroBCA kit (Thermo 23252) and to determine the size of the His-Tag purified protein using a 16% Tris-Gly denaturing gel (Thermo XP00165) with a 10-250 kDa protein ladder (Thermo 26619). Post gel-electrophoresis, gels were stained with Coomassie Orange Fluor (Thermo C33250) for 20 minutes at room temperature under gentle agitation and visualized using a GelDoc Image Station (Biorad). The remaining concentrated stock of protein was diluted 1:2 with sterile glycerol and stored at −20° C.
Site-Directed Mutagenesis of Target Proteins to Improve RNA Synthesis
[0352] Single or multiple amino acids may be mutagenized for improvement in either of the RNA oligonucleotide synthesis schemes by rational design or by high-throughput methods such as error-prone PCR. Plasmids carrying the target protein were harvested and purified from a sequence verified liquid bacterial cultures grown overnight in LB-kanamycin media at 37° C. using a MiniPrep Kit (Qiagen 27104). Oligonucleotide primers were ordered from IDT and were designed to PCR amplify the protein expression plasmid while simultaneously mutagenizing the plasmid at the predetermined location, yielding linearized DNA. Using the reagents from the Q5 Site-Directed Mutagenesis Kit (NEB E0554S), the protein expression plasmid was PCR amplified using the Q5 Hot Start High-Fidelity 2x Master Mix with the following thermocycling conditions: initial denature for 98° C. for 30 seconds, denature at 98° C. for 10 seconds, anneal at 68° C. for 10 seconds, and extend at 72° C. for 120 seconds for 25 cycles before a final extension of 2 minutes at 72° C. 1 μL of the resulting PCR amplification reaction was then treated with the kit's enzyme reaction cocktail to re-circularize the protein expression plasmid while digesting away the unsubstituted plasmid sequences remaining in the reaction mixture. After bacterial transformation and sequence verification, colonies with perfect sequence matches were used to express and analyze the site-directed mutant protein with methods previously outlined. The resultant purified mutagenized protein was concentrated and buffer exchanged into the appropriate 2× storage buffer as previously mentioned and diluted 1:2 with sterile glycerol and stored at −20° C.
Initial Activity Screen with Natural rNTPs
[0353] Expressed proteins with terminal transferase activity were screened by determining the rate of RNA generation in terms of total RNA concentration and the length/distribution of RNA produced by the protein after incubation with natural rNTPs. In order to measure the rate of RNA generation, a 10 μL bulk extension reaction consisting of 10 pmol of a short 5′-Cy5 labeled initiator oligonucleotide (15-20-nt), 100 μM of rNTPs, 0.25 mM divalent cation cofactor (such as Co.sup.2+, Mg.sup.2+, Mn.sup.2+, Zn.sup.2+, or combinations thereof), 1x Reaction Buffer, 1x SYBR Dye (GelStar (Lonza 50535), Qubit ssDNA Dye (Thermo Q10212), or SYBR Green II RNA gel stain (Thermo S7564), and 1 μL of purified enzyme was monitored on a plate reader (EX:598 nm, EM:522 nm) over 30 minutes at 37° C., taking signal reads every 1 minute in triplicate (N=3). Using a custom R script, the rate of RNA generation and, subsequently enzyme initial activity (V.sub.o), was determined from the slope of the best fit curve of the average RFU plotted as a function of time. The length of the RNA produced in these reactions was determined by comparing products to a 100-nt ssDNA ladder (Simplex Biosciences) using a 15% TBE-Urea denaturing gel (Thermo EC6885) following the manufacturer's protocol. Approximately 8 μL of the initial activity screen reaction volume was loaded onto the gels and run at 185V for 60 minutes unless otherwise specified. Gels were then stained with a solution of 1× GelStar Nucleic Acid stain or SYBR Green II RNA gel stain for 15 minutes with gentle agitation. The resultant gel was then imaged on a Typhoon FLA 9500 system (GE Healthcare Life Sciences) using imaging parameters for SYBR Gold. For extension reactions using initiator oligonucleotides labeled with a 5′-fluorophore such as FAM, Cy5, Cy3, etc., gels were not stained and imaged directly using the appropriate parameters.
Enzyme Activity Assay—Uncontrolled Extension with Natural & Analogue Nucleotides
[0354] Uncontrolled extension reactions were comprised of 5 pmol of initiator oligonucleotide, 1 mM natural or analogue nucleotide, 1× poly(U) polymerase reaction buffer (10 mM NaCl, 10 mM Tris-HCl, 10 mM MgCl.sub.2, 1 mM DTT, pH 7.9 at 25 C), and 1 μg of purified enzyme. Natural and analogue nucleotides were either purchased from commercial sources or custom synthesized in-house. Reactions were incubated at 37° C. for 30 minutes and immediately analyzed by gel electrophoresis using a 15% TBE-Urea denaturing gel (Thermo EC6885) as per manufacturer's instructions. The length of the oligonucleotide produced in these reactions was determined by comparing products to a 100-nt ssDNA ladder (Simplex Biosciences). Gels were then stained with a solution of 1x GelStar Nucleic Acid stain or SYBR Green II RNA gel stain for 15 minutes with gentle agitation. The resultant gel was then imaged on a Typhoon FLA 9500 system (GE Healthcare Life Sciences) using imaging parameters for SYBR Gold. For extension reactions using initiator oligonucleotides labeled with a 5′-fluorophore such as FAM, Cy5, Cy3, etc, gels were not stained and imaged directly using the appropriate parameters.
Enzyme Activity Assay—Controlled Extension with Natural & Analogue Reversible Terminator Nucleotides
[0355] Controlled extension reactions were comprised of 5 pmol of initiator oligonucleotide, 1 mM blocked reversible terminator nucleotides, 1× poly(U) polymerase reaction buffer (10 mM NaCl, 10 mM Tris-HCl, 10 mM MgCl.sub.2, 1 mM DTT, pH 7.9 at 25 C), and 1 μg of purified enzyme. Reactions were incubated at 37° C. for 1 minute and immediately analyzed by gel electrophoresis using a 15% TBE-Urea denaturing gel (Thermo EC6885) as per manufacturer's instructions. Success of the (N+1) event was determined by running a blank extension reaction in which no nucleotide or enzyme was supplemented. Gels were then stained with a solution of 1× GelStar Nucleic Acid stain or SYBR Green II RNA gel stain for 15 minutes with gentle agitation. The resultant gel was then imaged on a Typhoon FLA 9500 system (GE Healthcare Life Sciences) using imaging parameters for SYBR Gold. For extension reactions using initiator oligonucleotides labeled with a 5′-fluorophore such as FAM, Cy5, Cy3, etc, gels were not stained and imaged directly using the appropriate parameters.
Enzyme Activity Assay—Uncontrolled or Controlled Extension Reactions on a Surface
[0356] Both uncontrolled and controlled extension reactions can be performed using surface bound initiator oligonucleotide. The surface bound initiator oligonucleotide was obtained from IDT with a 5′-amine C.sub.6 spacer group and an internal Cy5 fluorophore. This oligonucleotide was then biotinylated and PEG-ylated using an EZ Link NHS-PEG12-Biotin kit (Thermo A35389) as per manufacturer's instructions and then clean and concentrated using an Oligonucleotide Clean and Concentrator Spin-column Kit (Zymo D4060). Derivatized initiator oligonucleotide was then bound to the surface of a streptavidin coated PCR plate (BioTez, Germany) by incubating oligonucleotide in 2× Binding and Wash buffer (10 mM Tris-HCl, 2M NaCl, 1 mM EDTA, pH 7.5 at 25° C.) for 1 hour with gentle agitation (300 RPM) in the plate wells. Wells were then aspirated and then washed once with 1× Binding and Wash Buffer. Extension reaction cocktails were made up as previously described and incubated with surface bound oligonucleotide for a predetermined time (30 minutes for uncontrolled & 1 minutes for controlled) shaking at 900 RPM at 37° C. Wells were then washed again using 1× Binding and Wash Buffer. To remove the extended oligonucleotide from the surface, wells were incubated with stripping solution (95% formamide, 10 mM EDTA, pH 6.0 at 25° C.) at 65° C. for 5 minutes. Oligonucleotide suspended in the stripping solution were then cleaned and purified using an oligonucleotide spin-column and eluted into 6 μL diH.sub.20. Surface extension reactions were then analyzed using gel electrophoresis as previously described.
REFERENCES
[0357] Agrawal, Neema, P. V. N. Dasaradhi, Asif Mohmmed, Pawan Malhotra, Raj K. Bhatnagar, and Sunil K. Mukherjee. 2003. “RNA Interference: Biology, Mechanism, and Applications.” Microbiology and Molecular Biology Reviews: MMBR 67 (4): 657-85. [0358] Anavy, L., Vaknin, I., Atar, O., Amit, R. & Yakhini, Z. Data storage in DNA with fewer synthesis cycles using composite DNA letters. Nat. Biotechnol. (2019). doi:10.1038/s41587-019-0240-x [0359] Andrade, Paula, Maria Jos6 Martin, Raquel Juirez, Francisco López de Saro, and Luis Blanco. 2009. “Limited Terminal Transferase in Human DNA polymerase μ Defines the Required Balance between Accuracy and Efficiency in NHEJ.” Proceedings of the National Academy of Sciences of the United States of America 106 (38): 16203-8. [0360] Balbo, P. B. & Bohm, A. Mechanism of poly(A) polymerase: structure of the enzyme-MgATP-RNA ternary complex and kinetic analysis. Structure 15, 1117-1131 (2007). [0361] Bard, J., A. M. Zhelkovsky, S. Helmling, T. N. Earnest, C. L. Moore, and A. Bohm. 2000. “Structure of Yeast poly(A) polymerase Alone and in Complex with 3′-dATP.” Science 289 (5483): 1346-49. [0362] Baronti, L., Karlsson, H., Marusic, M. & Petzold, K. A guide to large-scale RNA sample preparation. Anal. Bioanal. Chem. 410, 3239-3252 (2018). [0363] Beaucage, S. L. & Iyer, R. P. Advances in the Synthesis of Oligonucleotides by the Phosphoramidite Approach. Tetrahedron 48, 2223-2311 (1992). [0364] Bertocci, Barbara, Annie De Smet, Jean-Claude Weill, and Claude-Agnes Reynaud. 2006. “Nonoverlapping Functions of DNA polymerases Mu, Lambda, and Terminal Deoxynucleotidyltransferase during Immunoglobulin V(D)J Recombination in Vivo.” Immunity 25 (1): 31-41. [0365] Bohr, H. G. et al. Electronic Structures of LNA Phosphorothioate Oligonucleotides. Mol. Ther. Nucleic Acids 8, 428-441 (2017). [0366] Carlson, Robert. 2018. “Competition and the Future of Reading and Writing DNA.” In Synthetic Biology: Parts, Devices and Applications, edited by Christina Smolke Sang Yup Lee Jens Nielsen Gregory Stephanopoulos. [0367] Ceze, L., Nivala, J. & Strauss, K. Molecular digital data storage using DNA. Nat. Rev. Genet. 20, 456-466 (2019). [0368] Cho, H. D., Verlinde, C. L. M. J. & Weiner, A. M. Reengineering CCA-adding enzymes to function as (U,G)- or dCdCdA-adding enzymes or poly(C,A) and poly(U,G) polymerases. Proc. Natl. Acad. Sci. U.S.A 104, 54-59 (2007). [0369] Cummins, L. L. et al. Characterization of fully 2′-modified oligoribonucleotide hetero- and homoduplex hybridization and nuclease sensitivity. Nucleic Acids Res. 23, 2019-2024 (1995). [0370] Dana, H. et al. Molecular Mechanisms and Biological Functions of siRNA. Int. J. Biomed. Sci. 13, 48-57 (2017). [0371] Deleavey, G. F. & Damha, M. J. Designing chemically modified oligonucleotides for targeted gene silencing. Chem. Biol. 19, 937-954 (2012). [0372] Domínguez, Orlando, José F. Ruiz, Teresa Laín de Lera, Miguel García-Díaz, Manuel A. González, Tomas Kirchhoff, Carlos Martinez-A, Antonio Bernad, and Luis Blanco. 2000. “DNA polymerase Mu (Pol), Homologous to TdT, Could Act as a DNA Mutator in Eukaryotic Cells.” The EMBO Journal 19 (7): 1731-42. [0373] Eckstein, F. Phosphorothioates, essential components of therapeutic oligonucleotides. Nucleic Acid Ther. 24, 374-387 (2014). [0374] Fowler, Jason D., and Zucai Suo. 2006. “Biochemical, Structural, and Physiological Characterization of Terminal Deoxynucleotidyl Transferase.” Chemical Reviews 106 (6): 2092-2110. [0375] Goyal, N. & Narayanaswami, P. Making sense of antisense oligonucleotides: A narrative review. Muscle Nerve 57, 356-370 (2018). [0376] Hughes, Randall A., and Andrew D. Ellington. 2017. “Synthetic DNA Synthesis and Assembly: Putting the Synthetic in Synthetic Biology.” Cold Spring Harbor Perspectives in Biology 9 (1). https://doi.org/10.1101/cshperspect.a023812. [0377] Jamsen, Joonas A., William A. Beard, Lars C. Pedersen, David D. Shock, Andrea F. Moon, Juno M. Krahn, Katarzyna Bebenek, Thomas A. Kunkel, and Samuel H. Wilson. 2017. “Time-Lapse Crystallography Snapshots of a Double-Strand Break Repair polymerase in Action.” Nature Communications 8 (1): 253. [0378] Juarez, Raquel, Jose F. Ruiz, Stephanie A. Nick McElhinny, Dale Ramsden, and Luis Blanco. 2006. “A Specific Loop in Human DNA polymerase Mu Allows Switching between Creative and DNA-Instructed Synthesis.” Nucleic Acids Research 34 (16): 4572-82. [0379] Just, Andrea, Falk Butter, Michelle Trenkmann, Tony Heitkam, Mario Mörl, and Heike Betat. 2008. “A Comparative Analysis of Two Conserved Motifs in Bacterial poly(A) polymerase and CCA-Adding Enzyme.” Nucleic Acids Research 36 (16): 5212-20. [0380] Kaczmarek, James C., Piotr S. Kowalski, and Daniel G. Anderson. 2017. “Advances in the Delivery of RNA Therapeutics: From Concept to Clinical Reality.” Genome Medicine 9 (1): 60. [0381] Khvorova, A. & Watts, J. K. The chemical evolution of oligonucleotide therapies of clinical utility. Nat. Biotechnol. 35, 238-248 (2017). [0382] Koch, T., Shim, I., Lindow, M., Orum, H. & Bohr, H. G. Quantum mechanical studies of DNA and LNA. Nucleic Acid Ther. 24, 139-148 (2014). [0383] Kosuri, S. & Church, G. M. Large-scale de novo DNA synthesis: technologies and applications. Nat. Methods 11, 499-507 (2014). [0384] Kwak, Jae Eun, and Marvin Wickens. 2007. “A Family of poly(U) polymerases.” RNA 13 (6): 860-67. [0385] Lee, H. H., Kalhor, R., Goela, N., Bolot, J. & Church, G. M. Terminator-free template-independent enzymatic DNA synthesis for digital information storage. Nat. Commun. 10, 2383 (2019). [0386] Lunde, Bradley M., Iris Magler, and Anton Meinhart. 2012. “Crystal Structures of the Cid1 poly (U) polymerase Reveal the Mechanism for UTP Selectivity.” Nucleic Acids Research 40 (19): 9815-24. [0387] Ma, S., Tang, N. & Tian, J. DNA synthesis, assembly and applications in synthetic biology. Curr. Opin. Chem. Biol. 16, 260-267 (2012). [0388] Martin, Georges, Andreas Möglich, Walter Keller, and Sylvie Doublié. 2004. “Biochemical and Structural Insights into Substrate Binding and Catalytic Mechanism of Mammalian poly(A) polymerase.” Journal of Molecular Biology 341 (4): 911-25. [0389] Martin, G., and W. Keller. 1998. “Tailing and 3′-End Labeling of RNA with Yeast poly(A) polymerase and Various Nucleotides.” RNA 4 (2): 226-30. [0390] Milligan, J. F., Groebe, D. R., Witherell, G. W. & Uhlenbeck, O. C. Oligoribonucleotide synthesis using T7 RNA polymerase and synthetic DNA templates. Nucleic Acids Res. 15, 8783-8798 (1987). [0391] Moon, Andrea F., Miguel Garcia-Diaz, Vinod K. Batra, William A. Beard, Katarzyna Bebenek, Thomas A. Kunkel, Samuel H. Wilson, and Lars C. Pedersen. 2007. “The X Family Portrait: Structural Insights into Biological Functions of X Family polymerases.” DNA Repair 6 (12): 1709-25. [0392] Moon, Andrea F., Rajendrakumar A. Gosavi, Thomas A. Kunkel, Lars C. Pedersen, and Katarzyna Bebenek. 2015. “Creative Template-Dependent Synthesis by Human polymerase Mu.” Proceedings of the National Academy of Sciences of the United States of America 112 (33): E4530-36. [0393] Moon, Andrea F., John M. Pryor, Dale A. Ramsden, Thomas A. Kunkel, Katarzyna Bebenek, and Lars C. Pedersen. 2014. “Sustained Active Site Rigidity during Synthesis by Human DNA polymerase μ.” Nature Structural & Molecular Biology 21 (3): 253-60. [0394] “Structural Accommodation of Ribonucleotide Incorporation by the DNA Repair Enzyme polymerase Mu.” Nucleic Acids Research 2017 45 (15): 9138-48. [0395] Motea, Edward A., and Anthony J. Berdis. 2010. “Terminal Deoxynucleotidyl Transferase: The Story of a Misguided DNA polymerase.” Biochimica et Biophysica Acta 1804 (5): 1151-66. [0396] Munoz-Tello, Paola, Caroline Gabus, and Stéphane Thore. 2012. “Functional Implications from the Cid1 poly(U) polymerase Crystal Structure.” Structure 20 (6): 977-86. [0397] Nick McElhinny, Stephanie A., and Dale A. Ramsden. 2004. “Sibling Rivalry: Competition between Pol X Family Members in V(D)J Recombination and General Double Strand Break Repair.” Immunological Reviews 200 (August): 156-64. [0398] Palluk, S. et al. De novo DNA synthesis using polymerase-nucleotide conjugates. Nat. Biotechnol. 36, 645-650 (2018). [0399] Pardi, N., Hogan, M. J., Porter, F. W. & Weissman, D. mRNA vaccines—a new era in vaccinology. Nat. Rev. Drug Discov. 17, 261-279 (2018). [0400] Perkel, J. M. The race for enzymatic DNA synthesis heats up. Nature 566, 565 (2019). [0401] Pratt, C. W., Voet, D. & Voet, J. G. Fundamentals of biochemistry: life at the molecular level. Jonh Wiley and Sons (2008). [0402] Proudfoot, Nick J. 2011. “Ending the Message: poly(A) Signals Then and Now.” Genes & Development 25 (17): 1770-82. [0403] Roychoudhury, Ranajit. 1972. “Enzymic Synthesis of polynucleotides: OLIGODEOXYNUCLEOTIDES WITH ONE 3′-TERMINAL RIBONUCLEOTIDE AS PRIMERS FOR POLYDEOXYNUCLEOTIDE SYNTHESIS.” The Journal of Biological Chemistry 247 (12): 3910-17. [0404] Ruiz, J. F., O. Domínguez, T. Laín de Lera, M. Garcia-Díaz, A. Bernad, and L. Blanco. 2001. “DNA polymerase Mu, a Candidate Hypermutase?” Philosophical Transactions of the Royal Society of London. Series B, Biological Sciences 356 (1405): 99-109. [0405] Ruiz, José F., Raquel Juirez, Miguel Garcia-Diaz, Gloria Terrados, Angel J. Picher, Sergio González-Barrera, Antonio R. Fernindez de Henestrosa, and Luis Blanco. 2003. “Lack of Sugar Discrimination by Human Pol μ Requires a Single Glycine Residue.” Nucleic Acids Research 31 (15): 4441-49. [0406] Rupaimoole, R. & Slack, F. J. MicroRNA therapeutics: towards a new era for the management of cancer and other diseases. Nat. Rev. Drug Discov. 16, 203-222 (2017). [0407] Sahin, U., Karikó, K. & Tureci, O. mRNA-based therapeutics—developing a new class of drugs. Nat. Rev. Drug Discov. 13, 759-780 (2014). [0408] Sastre-Moreno, Guillermo, John M. Pryor, Alberto Díaz-Talavera, José F. Ruiz, Dale A. Ramsden, and Luis Blanco. 2017. “Pol Tumor Variants Decrease the Efficiency and Accuracy of NHEJ.” Nucleic Acids Research 45 (17): 10018-31. [0409] Strauss, Benjamin, Alexander Nierth, Marco Singer, and Andres Jaschke. 2012. “Direct Structural Analysis of Modified RNA by Fluorescent in-Line Probing.” Nucleic Acids Research 40 (2): 861-70. [0410] Thomas, C. et al. One-step enzymatic modification of RNA 3′ termini using polymerase θ. Nucleic Acids Res. 47, 3272-3283 (2019). [0411] Uhlmann, E. & Peyman, A. Antisense oligonucleotides: a new therapeutic principle. Chem. Rev. 90, 543-584 (1990). [0412] Watts, J. K., Deleavey, G. F. & Damha, M. J. Chemically modified siRNA: tools and applications. Drug Discov. Today 13, 842-855 (2008). [0413] Wilson, C. & Keefe, A. D. Building oligonucleotide therapeutics using non-natural chemistries. Curr. Opin. Chem. Biol. 10, 607-614 (2006). [0414] Winz, Marie-Luise, Ayan Samanta, Dirk Benzinger, and Andres Jäschke. 2012. “Site-Specific Terminal and Internal Labeling of RNA by poly(A) polymerase Tailing and Copper-Catalyzed or Copper-Free Strain-Promoted Click Chemistry.” Nucleic Acids Research 40 (10): e78. [0415] Xiong, Yong, and Thomas A. Steitz. 2004. “Mechanism of Transfer RNA Maturation by CCA-Adding Enzyme without Using an Oligonucleotide Template.” Nature 430 (7000): 640-45.
EQUIVALENTS AND SCOPE
[0416] In the claims articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
[0417] Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein.
[0418] It is also noted that the terms “comprising” and “containing” are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[0419] This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.
[0420] Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.