Targeting Vector, Nucleic Acid Composition, and Method for Constructing Liver-injured Mouse Model
20220142130 · 2022-05-12
Assignee
Inventors
Cpc classification
A01K67/0275
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A01K2217/203
HUMAN NECESSITIES
A01K2217/206
HUMAN NECESSITIES
C12N2830/008
CHEMISTRY; METALLURGY
A01K2267/0393
HUMAN NECESSITIES
A01K2217/072
HUMAN NECESSITIES
International classification
Abstract
Provided are a targeting vector, a nucleic acid composition, and a method for constructing a liver-injured mouse model. The targeting vector includes a first expression cassette and a second expression cassette located downstream of the first expression cassette, the first expression cassette has the following elements connected in series in sequence: a liver-specific promoter, a tetracycline transcription activation regulating factor, and a first polyA; and the second expression cassette has the following elements connected in series in sequence: a second polyA, a mouse prourokinase activator encoding gene, and a tetracycline-inducible promoter. The liver-injured mouse model constructed with this targeting vector has the phenotype of spontaneously generating the liver injury and aggravating the liver injury by induction, which provides liver-injured mouse models for studies of liver diseases.
Claims
1. A targeting vector for constructing a liver-injured mouse model, wherein the targeting vector contains a target sequence, and a 5′ end homologous arm sequence and a 3′ end homologous arm sequence for mediating insertion of the target sequence into a target site in a mouse genome, wherein the target sequence comprises a first expression cassette and a second expression cassette located downstream of the first expression cassette, wherein the first expression cassette has following elements connected in series in sequence: a liver-specific promoter, a tetracycline transcription activation regulating factor and a first polyA; and the second expression cassette has following elements connected in series in sequence: a second polyA, a mouse prourokinase activator encoding gene and a tetracycline-inducible promoter, wherein the liver-specific promoter drives expression of the tetracycline transcription activation regulating factor in a direction from upstream to downstream, and the tetracycline-inducible promoter drives expression of the mouse prourokinase activator encoding gene in a direction from downstream to upstream, wherein the target site is Rosa26 site.
2. The targeting vector according to claim 1, wherein the first expression cassette further has an enhancer sequence, wherein the enhancer sequence is located upstream of the liver-specific promoter.
3. The targeting vector according to claim 2, wherein the liver-specific promoter is any one selected from the group consisting of albumin promoter, apolipoprotein E promoter, phosphoenolpyruvate carboxykinase promoter, α-1-antitrypsin promoter, thyroxin binding globulin promoter, α-fetoprotein promoter, alcohol dehydrogenase promoter, IGF-II promoter, factor VIII promoter, HBV core protein promoter, HBV pre-s2 protein promoter, thyroxine-binding globulin promoter, HCR-ApOCII hybrid promoter, HCR-hAAT hybrid promoter, AAT promoter combined with enhancer element of mouse albumin gene, low-density lipoprotein promoter, pyruvate kinase promoter, lecithin-cholesterol acyltransferase promoter, apolipoprotein H promoter, transferrin promoter, transthyretin promoter, α-fibrinogen and β-fibrinogen promoter, α-I-antichymotrypsin promoter, α-2-HS glycoprotein promoter, haptoglobin promoter, ceruloplasmin promoter, plasminogen promoter, complement protein promoter, promoter of complement C3 activator, hemopexin promoter and α-I-acid glycoprotein promoter.
4. The targeting vector according to claim 2, wherein the liver-specific promoter is an albumin promoter.
5. The targeting vector according to claim 2, wherein the enhancer sequence is an albumin enhancer.
6. The targeting vector according to claim 2, wherein the tetracycline transcription activation regulating factor is any one selected from the group consisting of tTA, rtTA and Tet-On 3G.
7. The targeting vector according to claim 6, wherein the tetracycline transcription activation regulating factor is Tet-On 3G.
8. The targeting vector according to claim 2, wherein the first polyA is selected from the group consisting of HGH polyA, SV40 polyA, BGH polyA, rbGlob polyA, SV40 late polyA and rbGlob polyA.
9. The targeting vector according to claim 1, wherein in the second expression cassette, a Kozak sequence is further inserted between the mouse prourokinase activator encoding gene and the tetracycline-inducible promoter.
10. The targeting vector according to claim 9, wherein the tetracycline-inducible promoter is any one selected from the group consisting of TRE3G and TetO6.
11. (canceled)
12. The targeting vector according to claim 9, wherein an amino acid sequence of a mouse prourokinase activator encoded by the mouse prourokinase activator encoding gene is represented by SEQ ID NO. 7.
13. The targeting vector according to claim 12, wherein a nucleotide sequence of the mouse prourokinase activator encoding gene is represented by sites 1-1302 in SEQ ID NO. 6 or a complementary sequence thereof.
14. The targeting vector according to claim 9, wherein the second polyA is selected from the group consisting of rabbit polyA, SV40 polyA, hGH polyA, BGH polyA, rbGlob polyA, SV40 late polyA and rbGlob polyA.
15. (canceled)
16. The targeting vector according to claim 1, wherein the 5′ end homologous arm sequence is represented by SEQ ID NO. 4 or a complementary sequence thereof; and the 3′ end homologous arm sequence is represented by SEQ ID NO. 5 or a complementary sequence thereof.
17. A nucleic acid composition for constructing a liver-injured mouse model, comprising the targeting vector according to claim 1 and a CRISPR/Cas9 composition for double-strand breakage of a mouse genome sequence at the target site.
18. The nucleic acid composition according to claim 17, wherein the CRISPR/Cas9 composition comprises: Cas9 protein and sgRNA.
19. The nucleic acid composition according to claim 18, wherein a target sequence of the sgRNA is represented by SEQ ID NO. 9.
20. (canceled)
21. (canceled)
22. A method for constructing a liver-injured mouse model, wherein the target sequence is inserted into the target site on a genome of a target mouse using the targeting vector according to claim 1.
23. The method according to claim 22, wherein the target mouse is a mouse having immunodeficiency.
24. The method according to claim 23, wherein the method comprises: injecting the nucleic acid composition into fertilized eggs from mice having immunodeficiency, then transplanting the fertilized eggs into bodies of pseudo-pregnant female mice, and screening out, from offspring of the pseudo-pregnant female mice, positive mice with a genome inserted with the target sequence, to obtain the liver-injured mouse model.
25. (canceled)
26. (canceled)
27. (canceled)
28. (canceled)
29. (canceled)
30. (canceled)
Description
BRIEF DESCRIPTION OF DRAWINGS
[0044] In order to more clearly illustrate technical solutions of examples of the present disclosure, accompanying drawings which need to be used in the examples will be introduced below briefly, and it should be understood that the accompanying drawings below merely show some examples of the present disclosure, and therefore should not be considered as limitation on the scope, and a person ordinarily skilled in the art still could obtain other relevant accompanying drawings according to these accompanying drawings, without using any creative efforts.
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
DETAILED DESCRIPTION OF EMBODIMENTS
[0070] In order to make the objectives, technical solutions, and advantages of the examples of the present disclosure clearer, the technical solutions in the examples of the present disclosure will be described below clearly and completely. If no specific conditions are specified in the examples, they are carried out under normal conditions or conditions recommended by manufacturers. If manufacturers of reagents or apparatuses used are not specified, they are conventional products commercially available.
[0071] Objectives of one or more embodiments of the present disclosure include, for example, providing a targeting vector, a nucleic acid composition, and a method for constructing a liver-injured mouse model. The liver-injured mouse model constructed using the targeting vector provided in the present disclosure can generate liver injury without induction of an inducer, it can spontaneously generate the liver injury, and the degree of liver injury can be enhanced with use of the inducer. In addition, the degree of spontaneous liver injury of the liver-injured mouse model not only can satisfy the transplantation requirements of exogenous hepatocytes, but also the reconstruction rate is high after hepatocytes transplantation. Besides, the liver-injured mouse model can breed offspring liver-injured mice by crossbreeding, and the mortality of offspring mice is low, facilitating large-scale breeding. The present disclosure provides a reliable liver-injured mouse model for studies of liver diseases.
[0072] The present disclosure provides a targeting vector for constructing a liver-injured mouse model, wherein the targeting vector contains a target sequence and a 5′ end homologous arm sequence and a 3′ end homologous arm sequence for mediating insertion of the target sequence into a target site in a mouse genome; and the target sequence includes a first expression cassette and a second expression cassette located downstream of the first expression cassette;
[0073] the first expression cassette has the following elements connected sequentially in series: a liver-specific promoter, a tetracycline transcription activation regulating factor, and a first polyA; the second expression cassette has the following elements connected sequentially in series: a second polyA, a mouse prourokinase activator encoding gene, and a tetracycline-inducible promoter;
[0074] in the above, the liver-specific promoter drives the expression of the tetracycline transcription activation regulating factor in a direction from upstream to downstream, and the tetracycline-inducible promoter drives the expression of the mouse prourokinase activator encoding gene in a direction from downstream to upstream.
[0075] In one or more embodiments, the first expression cassette and the second expression cassette of the target sequence are linked through the ligation between respective polyA, i.e., constituting tail-to-tail ligation.
[0076] In one or more embodiments, the first expression cassette and the second expression cassette of the target sequence are linked through the ligation between respective polyA, and a transcription direction of the first expression cassette is opposite to that of the second expression cassette.
[0077] In one or more embodiments, the first expression cassette and the second expression cassette of the target sequence are linked through the ligation between respective promoters, i.e. constituting head-to-head ligation.
[0078] In one or more embodiments, the first expression cassette and the second expression cassette of the target sequence are linked through the ligation between respective promoters, and a transcription direction of the first expression cassette is opposite to that of the second expression cassette.
[0079] In one or more embodiments, the first expression cassette and the second expression cassette of the target sequence are linked through the ligation between respective promoters, and a transcription direction of the first expression cassette is the same as that of the second expression cassette, i.e. constituting tail-to-head ligation.
[0080] In one or more embodiments, the target sequence includes a liver-specific promoter, a tetracycline transcription activation regulating factor, a first polyA, a second polyA, a mouse prourokinase activator encoding gene, and a tetracycline-inducible promoter arranged in sequence.
[0081] As used herein, “polyA” is also called as a polyadenine nucleotide, and generally refers to a chain consisting of a plurality of adenine nucleotides. In general, the number of adenine nucleotides in polyA is 50-200.
[0082] The above target sequence can be inserted into the target site in the mouse genome using the targeting vector provided in the present disclosure. The ligation relationship between the first expression cassette and the second expression cassette in the above target sequence may be construed as tail-to-tail ligation. The inventors have surprisingly found that mice having the genome inserted with the target sequence having the first expression cassette and the second expression cassette with the above ligation manner and elements have the following unexpected phenotypes or characteristics, and can be used as a relatively ideal liver-injured mouse models.
[0083] (1) The liver injury may be generated without induction of an inducer, the liver injury can spontaneously generated, and the degree of liver injury can be enhanced with use of the inducer, therefore, users may make selective induction or no induction according to transplantation requirement, then the transplantation procedure is simplified. This spontaneous liver injury phenotype breaks the conventional knowledge of characteristics for the Tet on system to regulate protein expression, and this phenotype greatly goes beyond the expected range of the inventors.
[0084] (2) The degree of spontaneously generated liver injury of the liver-injured mouse model is sufficient to meet the transplantation requirements of exogenous hepatocytes; and if the induction is further performed, the degree of liver injury is more severe, then the reconstruction rate after transplantation of exogenous hepatocytes is higher.
[0085] (3) The liver-injured mouse model may breed more offspring liver-injured mice by crossbreeding, and the mortality of the offspring mice is much lower than that of the same type of mouse model with spontaneous liver injury, which facilitates large-scale breeding of liver-injured mouse models, and the phenotype also greatly goes beyond the expected range of the inventors.
[0086] It should be noted that, in some other examples, positions of the first expression cassette and the second expression cassette may be exchanged, i.e. the second expression cassette is upstream, the first expression cassette is downstream, the sequence of positions of the elements are correspondingly adjusted, the second expression cassette is driven downstream, i.e. in a direction towards the first expression cassette, and the first expression cassette is driven upstream, i.e. in a direction towards the second expression cassette. This configuration can also achieve similar effects. That is, no matter what direction is arranged, it is feasible as long as the polyAs of the two expression cassettes are adjacent, and the two expression cassettes are driven in a direction from two ends to the middle to express.
[0087] In an optional embodiment, the first expression cassette further has an enhancer sequence; and the enhancer sequence is located upstream of the liver-specific promoter.
[0088] In an optional embodiment, the liver-specific promoter includes, but is not limited to, any one selected from the group consisting of albumin promoter, apolipoprotein E promoter, phosphoenolpyruvate carboxykinase promoter, α-I-antitrypsin promoter, thyroxin binding globulin promoter, α-fetoprotein promoter, alcohol dehydrogenase promoter, IGF-II promoter, factor VIII promoter, HBV core protein promoter, HBV pre-s2 protein promoter, thyroxine-binding globulin promoter, HCR-ApOCII hybrid promoter, HCR-hAAT hybrid promoter, AAT promoter combined with enhancer element of mouse albumin gene, low-density lipoprotein promoter, pyruvate kinase promoter, lecithin-cholesterol acyltransferase promoter, apolipoprotein H promoter, transferrin promoter, transthyretin promoter, α-fibrinogen and β-fibrinogen promoter, α-I-antichymotrypsin promoter, α-2-HS glycoprotein promoter, haptoglobin promoter, ceruloplasmin promoter, plasminogen promoter, complement protein promoter, promoter of complement C3 activator, hemopexin promoter, and α-I-acid glycoprotein promoter.
[0089] In an optional embodiment, the liver-specific promoter is an albumin promoter.
[0090] In an optional embodiment, the enhancer sequence includes, but is not limited to, an albumin enhancer.
[0091] In an optional embodiment, the tetracycline transcription activation regulating factor is any one selected from the group consisting of tTA, rtTA, and Tet-On 3G.
[0092] In an optional embodiment, the tetracycline transcription activation regulating factor is Tet-On 3G.
[0093] In an optional embodiment, the first polyA includes, but is not limited to, HGH polyA, SV40 polyA, BGH polyA, rbGlob polyA, SV40 late polyA, and rbGlob polyA.
[0094] In an optional embodiment, the tetracycline-inducible promoter is any one selected from the group consisting of TRE3G and TetO6.
[0095] In an optional embodiment, the tetracycline-inducible promoter is TRE3Gp.
[0096] In an optional embodiment, an amino acid sequence of the mouse prourokinase activator encoded by the mouse prourokinase activator encoding gene is represented by SEQ ID NO. 7.
[0097] In an optional embodiment, a nucleotide sequence of the mouse prourokinase activator encoding gene is represented by sites 1-1302 in SEQ ID NO. 6 or a complementary sequence thereof.
[0098] In an optional embodiment, the second polyA includes, but is not limited to, rabbit polyA, SV40 polyA, hGH polyA, BGH polyA, rbGlob polyA, SV40 late polyA, and rbGlob polyA.
[0099] In an optional embodiment, in the second expression cassette, a Kozak sequence is further inserted between the mouse prourokinase activator encoding gene and the tetracycline-inducible promoter.
[0100] In an optional embodiment, the target site is Rosa26 site.
[0101] Inserting the above target sequence at the Rosa26 site can avoid interference effects of adjacent sequences on the genome, and will not disrupt any endogenous genes, thereby ensuring normal growth and development and normal function of mice; in addition, compared with other common insertion sites (e.g., H11), inserting the above target sequence at the Rosa26 site also enables the liver-injured mouse model to exhibit a unique phenotype, i.e., the degree of liver injury spontaneously generated can satisfy the implantation of exogenous hepatocytes. In addition, the liver-injured mouse model has more sensitive response to inducer (e.g., Dox), and after induction, the degree of liver injury is aggravated. Inserting the target sequence at other sites does not have similar technical effects, and the effect is unexpected to the inventors of the present disclosure.
[0102] In an optional embodiment, the 5′ end homologous arm sequence is represented by SEQ ID NO. 4 or a complementary sequence thereof; and the 3′ end homologous arm sequence is represented by SEQ ID NO. 5 or a complementary sequence thereof.
[0103] In an optional embodiment, a skeleton of the targeting vector can be selected according to actual needs, and no matter what kind of skeleton vector is selected to carry the above target sequence, it belongs to the scope of protection of the present disclosure.
[0104] The present disclosure provides a recombinant cell containing the above targeting vector.
[0105] In an optional embodiment, the recombinant cell includes, but is not limited to, E. coli. A person skilled in the art could choose a suitable host cell to transform the above targeting vector so as to facilitate storage or amplification of the above targeting vector, and no matter which host cell is selected, they all belong to the scope of protection of the present disclosure.
[0106] The present disclosure provides a nucleic acid composition for constructing a liver-injured mouse model, including the targeting vector according to any one of the above and a CRISPR/Cas9 composition for occurring double-strand breakage of a mouse genome sequence at the target site.
[0107] In an optional embodiment, the CRISPR/Cas9 composition includes: Cas9 protein and sgRNA.
[0108] In an optional embodiment, the target sequence of the sgRNA is represented by SEQ ID NO. 9.
[0109] As used herein, “CRISPR/Cas9 composition” refers to a gene editing system based on clustered regularly interspaced short palindromic repeats (CRISPR) and nuclease. Generally, the CRISPR/Cas9 composition includes sgRNA (small guide RNA) and Cas9 protein, then specific genetic modification can be realized.
[0110] The present disclosure provides a kit for constructing a liver-injured mouse model, wherein the kit includes the targeting vector according to any one of the above, or a nucleic acid composition according to any one of the above.
[0111] The present disclosure provides a method for constructing a liver-injured mouse model, wherein the target sequence is inserted into the target site on the genome of a target mouse using the targeting vector according to any one of the above or the nucleic acid composition according to any one of the above.
[0112] The present disclosure provides use of the targeting vector described herein for constructing the liver-injured mouse model. In one or more embodiments, the use involves inserting the target sequence at the target site on the genome of a target mouse.
[0113] The present disclosure provides use of the nucleic acid composition described herein for constructing a liver-injured mouse model. In one or more embodiments, the use involves inserting the target sequence at the target site on the genome of a target mouse.
[0114] The present disclosure provides the targeting vector described herein, which is used for constructing a liver-injured mouse model. In one or more embodiments, the use involves inserting the target sequence at the target site on the genome of a target mouse.
[0115] The present disclosure provides the nucleic acid composition described herein, which is used for constructing a liver-injured mouse model. In one or more embodiments, the use involves inserting the target sequence at the target site on the genome of a target mouse.
[0116] In one or more embodiments, the above use involves mating the liver-injured mouse model obtained by the construction method described herein with a wild-type mouse having immunodeficiency.
[0117] The liver-injured mouse model constructed using the construction method provided in the present disclosure can generate liver injury without induction of an inducer, it can spontaneously generate the liver injury, and the degree of liver injury can be enhanced with use of the inducer. In addition, the degree of spontaneous liver injury of the liver-injured mouse model not only can satisfy the transplantation requirements of exogenous hepatocytes, but also the reconstruction rate is high after transplantation. Besides, the liver-injured mouse model can breed offspring liver-injured mice by crossbreeding, and the mortality of offspring mice is low, facilitating large-scale breeding.
[0118] In the method for constructing a liver-injured mouse model of the present disclosure, an inducer is further used to treat a target mouse. In one or more embodiments, the inducer is Dox.
[0119] In an optional embodiment, the target mouse is a mouse having immunodeficiency (NCG mouse).
[0120] In an optional embodiment, the method includes: injecting the nucleic acid composition into fertilized eggs from mice having immunodeficiency, then transplanting the fertilized eggs into pseudo-pregnant female mouse bodies, and screening out, from the offspring of the pseudo-pregnant female mice, positive mice with the genome inserted with the target sequence, to thus obtain the liver-injured mouse model.
[0121] In an optional embodiment, the fertilized eggs are developed for 0.5 days.
[0122] In an optional embodiment, the pseudo-pregnant female mice are pseudo-pregnant female mice 0.5 days after successful mating.
[0123] The present disclosure provides a breeding method of a liver-injured mouse model, including: the liver-injured mouse model obtained by the construction method described above mating with a wild-type mouse having immunodeficiency.
[0124] The liver-injured mouse model obtained by the above construction method can reduce the mortality of offspring mice by mating with wild-type mice having immunodeficiency, and offspring liver-injured mice with the same phenotype as the parental liver-injured mice may be obtained on a large scale. In this way, a person skilled in the art could obtain an ideal liver-injured mouse models in large batches by means of a simpler hybridization breeding method, without the need of repeating the above construction method, thus greatly improving the breeding efficiency, and effectively satisfying the requirement for the number of liver-injured mouse models in the art.
[0125] The present disclosure provides use of the liver-injured mouse model obtained by the construction method or breeding method as described above in screening drugs for the treatment of liver diseases. In an optional embodiment, the use is for the purpose of non-disease diagnosis or treatment. In another optional embodiment, the use is for the purpose of disease diagnosis or treatment.
[0126] The present disclosure provides use of the liver-injured mouse model obtained by the construction method or breeding method as described above in screening drugs for the treatment of liver diseases.
[0127] In an optional embodiment, the use includes: implanting human hepatocytes into the liver-injured mouse model for liver humanization, and then using the liver-injured mouse model having undergone the liver humanization for screening drugs.
[0128] In an optional embodiment, the liver diseases include, but are not limited to, viral hepatitis (e.g. Hepatitis B and hepatitis C), liver fibrosis, cirrhosis, fatty liver diseases (e.g. alcoholic and non-alcoholic fatty liver diseases), pharmaceutical liver injury, and liver cancer.
[0129] The liver-injured mouse model obtained by the targeting vector and the construction method of the present disclosure, after having undergone the implantation of exogenous hepatocytes, for example, human hepatocytes, i.e., liver humanization, can be used to screen drugs for the treatment of liver diseases, for example, evaluating whether candidate drugs are effective or safe for human hepatocytes, and it can reflect the metabolic condition of the candidate drugs in the human body more realistically, and screen out more reliable drugs.
[0130] The features and performances of the present disclosure are further described below in detail in combination with examples.
EXAMPLES
Example 1
[0131] A targeting vector for constructing a liver-injured mouse model provided in the present example included: a target sequence, and a 5′ end homologous arm sequence (Rosa26 arm1) and a 3′ end homologous arm sequence (Rosa26 arm2) for mediating insertion of the target sequence into a target site (Rosa26) in a mouse genome (see
[0132] In the above, the target sequence included a first expression cassette and a second expression cassette located downstream of the first expression cassette in sequence in a direction from upstream to downstream;
[0133] the first expression cassette included the following elements connected sequentially in series: albumin enhancer (Alb enhancer), albumin promoter (Alb promoter), tetracycline transcription activation regulating factor (Tet-On 3G), and a first polyA (HGH polyA); as for the direction in
[0134] The second expression cassette included the following elements connected sequentially in series: a second polyA (rabbit polyA, indicated by pA in
[0135] Rosa26 arm1 was located upstream of the target sequence, and Rosa26 arm2 was located downstream of the target sequence.
[0136] The albumin promoter (Alb promoter) drove the expression of the tetracycline transcription activation regulating factor (Tet-On 3G) in a direction from upstream to downstream (see broken line arrow on the left of
[0137] Through combined use of the targeting vector provided in the present example and the CRISPR/Cas9 composition, the target sequence could be inserted at sites corresponding to the 5′ end homologous arm sequence and the 3′ end homologous arm sequence in the mouse genome (see
Example 2
[0138] The present example provides a method for constructing a targeting vector of Example 1, including the following steps:
[0139] 1.1 Preparing Alb enhancer-Alb promoter fragment
[0140] Alb enhancer-Alb promoter target fragment was amplified using primers in Table 1 and recovered for later use. Conditions of PCR amplification were set according to common knowledge in the art.
TABLE-US-00001 TABLE 1 List of Primers for Amplifying Alb Enhancer-Alb Promoter Name of primer Primer sequence (5′-3′) enhancer- GTGATCTGCAACTCCAGTCTTTGGCGCGCCTAGC promoter-R TTCCTTAGCATGACGTTCCA enhancer- CCAGTCTAGACATGGTGGCGGCTTTGCCAGAGGC promoter-F TAGTGGGGTTG Product size 2403 bp Template Alb-uPA-teton-final (provided by GemPharmatech, Co., Ltd., Jiangsu)
[0141] A nucleotide sequence (SEQ ID NO. 1) of one of the chains of the Alb enhancer-Alb promoter target fragment was as follows (5′-3′):
TABLE-US-00002 ggtggttctcctgtcagtttcgagggggtacagcttgggctgcaggtcga ctctagatcgaattcctgcagcccgggggatcccggggttgataggaaag gtgatctgtgtgcagaaagactcgctctaatatacttctttaaccaataa ctgtagatcattaaccatacttacctcgcatttcattggttcctacccca ttacaaaatcataccatctttgccaaaaagttgtttgactaaatcccttg cgtatgtttgccatctggagctgttcccctctaaccccacccccaccccc atgcacaagactttgtccattcattaaagttatgtaaaacagcaaatttt acataagagcttaatctctttgtctcccatttgaccatttcactctccgc cttcccatccaaccatgcctgcaggtcgatcccaagctggagaacgagtt caagccaagctgcaccactgcttttcacacactcttcactctgcatcagc ttagtatttcttaagaaattaaaagatggcaaaacacatctaaactgtat taataaagtgcttctttcatatttaatgtttttccagataaagaaaacta tgatgaatgcctgcatgcttatctatgtttcatagatcagcaagtagaat gtataaaatggaagtgtcagtaattctgctcataattattgctgcagatt gaattcacccctaagcaaatatacctctgaacatctgctcacagtctgta tgttctccagacacaatccaaaagacttattatctgaaagattaatgtca caaagccagagctttataatctcttataaaacatagattgtagccaggca gtggtggcacatgcttttaatcctagcacttgcaaggcagaggcaagcag atctctgagttcaagaccaacctggtctacagagcaaggtccaggacagc caaagctagacagaaaaaactgtatctcaaaagaaaatagacaacaaatt acattgttacagctaaaattatcttatgttgaaatttctgtagctcaact ttggaatattttcattagagggtaatatttgattatgatcacttctaaaa ctttagaatttattgttttataatctcttggtttcagtacttacctaaaa ttttccaaccagtcacccagctaaaacttaaaatatttaagtcctagaat tccagttagttttgcaagtaactataaatggtattacagtgagaaatgga gcatctgatgtctactcacatgtaaactttacacatatcaaatagatgat tgtctatggtctttcttcttttttagagtatatagagtatatagagatag attcatccataataagctcaataaacaaatgtttaaaaatgattgttaga tattattgggtatataagtacctaattattaaaattgacttttttataac attgagataaattaaaattcatttattaaaataatatatatgaatttgaa ggggttttttttgcaaaacaatttcagcaagcaataccatgacaaaagtg tgtattcaaatggaatgggaaacgaatgtcagtaacttatggtccccgtg tactcattcccagacatgcctgattggtagctgtgacagctccagcgtac ttaacaccaagactttaaataagctgccaaaaatgtgtaagactgccatt tcattagttttaatttttatatctataccctttctacagccacatactaa acgtagacaagttggccttttcctattgctttaaaggcagaggactgtat tgatcagtccaaacttctttctgcatgtacatggaaaactggccaaggca aacacgtccggaatgatggtatttaagaacaaacattccctggtatcagc aagtacagtgccctgctgacagagcaggagacacaaagtaccatctcgtc cctatgttaagtagtgtcacctcatgctcaagggatactgagtggatgct gtaacgcaggttattttctaggctgtgaggatacaagaaaatgaaagtaa ttaaagtagaacattgctctgtgctatgcttgcagaatgtgtagtgtagt ctaggaacagagaggggaaggttctaaatcaaaaaaaatcaagctcatgc ctaaggatgtgtgggttgccacctctttagctacctatgcgatccaaaca actataaaacttagaatttattttctctggatgaatttgtgcttgtggag caatgttggtagggggcagggtcagctggaaaagtggaatgagcaagcag aaaactgagagaagcagaagcttaggaagatgggtaatttccaaaagttt cacaaaagatcaaatcaaagaagtaagctccaccttagaaaaaagtggaa cgtcatgctaaggaagcta.
[0142] The underlined part was the Alb promoter, and the non-underlined part was the Alb enhancer.
[0143] 1.2 Preparation of Tet-On 3G-HGH polyA fusion fragment
[0144] 1.2.1 Preparation of Tet-On 3G fragment. Tet-On 3G target fragment was amplified using the primers in Table 2 with pCMV-Tet3G as template and recovered for later use.
TABLE-US-00003 TABLE 2 List of Primers for Amplifying Tet-On 3G Fragment Name of primer Primer sequence (5′-3′) TetOn3G-F AAGCCGCCACCATGTCTAGACTGGACAAGAGCAA A TetOn3G-R TCACAGGGATGCCACCCATCTTACCCGGGGAGCA TGTCAAGGTCA Product size 802 bp Template pCMV-Tet3G (provided by GemPharmatech, Co., Ltd., Jiangsu)
[0145] A nucleotide sequence (SEQ ID NO. 2) of one of the chains of the Tet-On 3G target fragment was as follows (5′-3′), and a complementary chain thereof was the encoding sequence:
TABLE-US-00004 ttacccggggagcatgtcaaggtcaaaatcgtcaagagcgtcagcaggca gcatatcaaggtcaaagtcgtcaagggcatcggctgggagcatgtctaag tcaaaatcgtcaagggcgtcggtcggcccgccgctttcgcactttagctg tttctccaggccacatatgattagttccaggccgaaaaggaaggcaggtt cggctccctgccggtcgaacagctcaattgcttgtttcagaagtgggggc atagaatcggtggtaggtgtctctctttcctcttttgctacttgatgctc ctgttcctccaatacgcagcccagtgtaaagtggcccacggcggacagag cgtacagtgcgttctccagggagaagccttgctgacacaggaacgcgagc tgattttccagggtttcgtactgtttctctgttgggcgggtgccgagatg cactttagccccgtcgcgatgtgagaggagagcacagcggtatgacttgg cgttgttccgcagaaagtcttgccatgactcgccttccagggggcaggag tgggtatgatgcctgtccagcatctcgattggcagggcatcgagcagggc ccgcttgttcttcacgtgccagtacagggtaggctgctcaactcccagct tttgagcgagtttccttgtcgtcaggccttcgataccgactccattgagt aattccagagcagagtttatgactttgctcttgtccagtctagacat.
[0146] 1.2.2 Preparation of HGH polyA fragment. HGH polyA target fragment was amplified using the primers in Table 3 with pRosa26-Cas-CAG HGH as template and recovered for later use.
TABLE-US-00005 TABLE 3 List of Primers for Amplifying HGH polyA Fragment Name of primer Primer sequence (5′-3′) Note HGH polyA-F TTGACATGCTCCCCGGGTAAGATGGGT GGCATCCCTGTGA HGH polyA-R- CCTGCAGGACAACGCCCACACAGGATC BamHI BamHI CGGCTGCAGGAATTCAACAGGCATCT site Product size 677 bp Template pRosa26-Cas-CAG HGH (provided by GemPharmatech, Co., Ltd., Jiangsu)
[0147] A nucleotide sequence (SEQ ID NO. 3) of one of the chains of the HGH polyA target fragment was as follows (5′-3′):
TABLE-US-00006 ggctgcaggaattcaacaggcatctactgagtggacccaacgcatgagag gacagtgccaagcaagcaactcaaatgtcccaccggttgggccatggcag gtagcctatgctgtgtctggacgtcctcctgctggtatagttattttaaa atcagaaggacagggaagggagcagtggttcacgcctgtaatcccagcaa tttgggaggccaaggtgggtagatcacctgagattaggagttggagacca gcctggccaatatggtgaaaccccgtctctaccaaaaaaacaaaaattag ctgagcctggtcatgcatgcctggaatcccaacaactcgggaggctgagg caggagaatcgcttgaacccaggaggcggagattgcagtgagccaagatt gtgccactgcactccagcttggttcccaatagaccccgcaggccctacag gttgtcttcccaacttgccccttgctccataccacccccctccaccccat aatattatagaaggacacctagtcagacaaaatgatgcaacttaatttta ttaggacaaggctggtgggcactggagtggcaacttccagggccaggaga ggcactggggaggggtcacagggatgccacccatc.
[0148] 1.2.3 Preparation of Tet-On 3G-HGH polyA fragment. The target fragment Tet-On 3G-HGH polyA was amplified in a manner of fusion PCR using primers in Table 4 with Tet-On 3G and HGH polyA as templates and recovered.
TABLE-US-00007 TABLE 4 List of Primers for Fusion PCR for Tet-On 3G-HGH polyA Fragment Name of primer Primer sequence (5′-3′) Note TetOn3G-F AAGCCGCCACCATGTCTAGACTGGACA AGAGCAAA HGH polyA- CCTGCAGGACAACGCCCACACAGGATC BamHI R-BamHI CGGCTGCAGGAATTCAACAGGCATCT site Product size 1439 bp Template Tet On3G and HGH polyA
[0149] A nucleotide sequence (SEQ ID NO. 10) of one of the chains of the Tet-On 3G-HGH polyA fusion target fragment was as follows (5′-3′):
TABLE-US-00008 ggctgcaggaattcaacaggcatctactgagtggacccaacgcatgagag gacagtgccaagcaagcaactcaaatgtcccaccggttgggccatggcag gtagcctatgctgtgtctggacgtcctcctgctggtatagttattttaaa atcagaaggacagggaagggagcagtggttcacgcctgtaatcccagcaa tttgggaggccaaggtgggtagatcacctgagattaggagttggagacca gcctggccaatatggtgaaaccccgtctctaccaaaaaaacaaaaattag ctgagcctggtcatgcatgcctggaatcccaacaactcgggaggctgagg caggagaatcgcttgaacccaggaggcggagattgcagtgagccaagatt gtgccactgcactccagcttggttcccaatagaccccgcaggccctacag gttgtcttcccaacttgccccttgctccataccacccccctccaccccat aatattatagaaggacacctagtcagacaaaatgatgcaacttaatttta ttaggacaaggctggtgggcactggagtggcaacttccagggccaggaga ggcactggggaggggtcacagggatgccacccatcttacccggggagcat gtcaaggtcaaaatcgtcaagagcgtcagcaggcagcatatcaaggtcaa agtcgtcaagggcatcggctgggagcatgtctaagtcaaaatcgtcaagg gcgtcggtcggcccgccgctttcgcactttagctgtttctccaggccaca tatgattagttccaggccgaaaaggaaggcaggttcggctccctgccggt cgaacagctcaattgcttgtttcagaagtgggggcatagaatcggtggta ggtgtctctctttcctcttttgctacttgatgctcctgttcctccaatac gcagcccagtgtaaagtggcccacggcggacagagcgtacagtgcgttct ccagggagaagccttgctgacacaggaacgcgagctgattttccagggtt tcgtactgtttctctgttgggcgggtgccgagatgcactttagccccgtc gcgatgtgagaggagagcacagcggtatgacttggcgttgttccgcagaa agtcttgccatgactcgccttccagggggcaggagtgggtatgatgcctg tccagcatctcgattggcagggcatcgagcagggcccgcttgttcttcac gtgccagtacagggtaggctgctcaactcccagcttttgagcgagtttcc ttgtcgtcaggccttcgataccgactccattgagtaattccagagcagag tttatgactttgctcttgtccagtctagacat.
[0150] The underlined part was HGH polyA, and the non-underlined part was Tet-On 3G.
[0151] 1.3 Preparation of intermediate vector (containing Rosa26 arm1-Alb enhancer-Alb promoter-Tet-On 3G-HGH polyA-Rosa26 arm2 fragment).
[0152] 1.3.1 The pRosa26-Cas plasmid was digested with Ascl enzyme (provided by GemPharmatech, Co. Ltd., Jiangsu, wherein the vector itself contains Rosa26 arm1 and Rosa26 arm2, see
[0153] A nucleotide sequence (SEQ ID NO. 4) of one of the chains of the Rosa26 arm1 was as follows:
TABLE-US-00009 ttggccggtgcgccgccaatcagcggaggctgccggggccgcctaaagaa gaggctgtgctttggggctccggctcctcagagagcctcggctaggtagg ggatcgggactctggcgggagggcggcttggtgcgtttgcggggatgggc ggccgcggcaggccctccgagcgtggtggagccgttctgtgagacagccg ggtacgagtcgtgacgctggaaggggcaagcgggtggtgggcaggaatgc ggtccgccctgcagcaaccggagggggagggagaagggagcggaaaagtc tccaccggacgcggccatggctcgggggggggggggcagcggaggagcgc ttccggccgacgtctcgtcgctgattggcttcttttcctcccgccgtgtg tgaaaacacaaatggcgtgttttggttggcgtaaggcgcctgtcagttaa cggcagccggagtgcgcagccgccggcagcctcgctctgcccactgggtg gggcgggaggtaggtggggtgaggcgagctggacgtgcgggcgcggtcgg cctctggcggggcgggggaggggagggagggtcagcgaaagtagctcgcg cgcgagcggccgcccaccctccccttcctctgggggagtcgttttacccg ccgccggccgggcctcgtcgtctgattggctctcggggcccagaaaactg gcccttgccattggctcgtgttcgtgcaagttgagtccatccgccggcca gcgggggcggcgaggaggcgctcccaggttccggccctcccctcggcccc gcgccgcagagtctggccgcgcgcccctgcgcaacgtggcaggaagcgcg cgctgggggcggggacgggcagtagggctgagcggctgcggggcgggtgc aagcacgtttccgacttgagttgcctcaagaggggcgtgctgagccagac ctccatcgcgcactccggggagtggagggaaggagcgagggctcagttgg gctgttttggaggcaggaagcacttgctctcccaaagtcgctctgagttg ttatcagtaagggagctgcagtggagtaggcggggagaaggccgcaccct tctccggaggggggaggggagtgttgcaatacctttctgggagttctctg ctgcctcctggcttctgaggaccgccctgggcctgggagaatcccttccc cctcttccctcgtgatctgcaactccagtctttgcagtctggtacttcca agctcattagatgccatcatgctctcactgcctcctcagcttcaagagga atctggaaaaagcagtcccactggtcaggaaaggaacactagtgcactta tc.
[0154] A nucleotide sequence (SEQ ID NO. 5) of one of the chains of the Rosa26 arm2 was as follows:
TABLE-US-00010 tgtgtgggcgttgtcctgcaggggaattgaacaggtgtaaaattggaggg acaagacttcccacagattttcggttttgtcgggaagttttttaataggg gcaaataaggaaaatgggaggataggtagtcatctggggttttatgcagc aaaactacaggttattattgcttgtgatccgcctcggagtattttccatc gaggtagattaaagacatgctcacccgagttttatactctcctgcttgag atccttactacagtatgaaattacagtgtcgcgagttagactatgtaagc agaattttaatcatttttaaagagcccagtacttcatatccatttctccc gctccttctgcagccttatcaaaaggtattttagaacactcattttagcc ccattttcatttattatactggcttatccaacccctagacagagcattgg cattttccctttcctgatcttagaagtctgatgactcatgaaaccagaca gattagttacatacaccacaaatcgaggctgtagctggggcctcaacact gcagttcttttataactccttagtacactttttgttgatcctttgccttg atccttaattttcagtgtctatcacctctcccgtcaggtggtgttccaca tttgggcctattctcagtccagggagttttacaacaatagatgtattgag aatccaacctaaagcttaactttccactcccatgaatgcctctctccttt ttctccatttataaactgagctattaaccattaatggtttccaggtggat gtctcctcccccaatattacctgatgtatcttacatattgccaggctgat attttaagacattaaaaggtatatttcattattgagccacatggtattga ttactgcttactaaaattttgtcattgtacacatctgtaaaaggtggttc cttttggaatgcaaagttcaggtgtttgttgtctttcctgacctaaggtc ttgtgagcttgtattttttctatttaagcagtgctttctcttggactggc ttgactcatggcattctacacgttattgctggtctaaatgtgat.
[0155] 1.3.2 SLIC ligation conversion method was adopted, ligation 2×HIFI Mix, linearized vector pRosa26-Cas, and the Alb enhancer-Alb promoter fragment, and Tet-On 3G-HGH polyA fragment prepared in the preceding steps were added to a sterile tube, which was supplemented with sterile water to 20 μL; the resultant was reacted at 50° C. for 30 min to obtain an intermediate vector containing the Rosa26 arm1-Alb enhancer-Alb promoter-Tet-On 3G-HGH polyA-Rosa26 arm2 fragment, after the reaction was ended, Top 10 chemical competence transformation was performed, LB solid agar medium with Spec resistance was coated after Top 10 chemical competence transformation was finished, followed by inverted culturing at 37° C. overnight.
[0156] 1.3.3 Identification of Intermediate Vector.
[0157] The monoclonal was picked from a plate into test tubes containing 4 mL LB with Spec resistance and cultured. The bacterial solution was subjected to PCR identification using the primers in Table 5 (see
TABLE-US-00011 TABLE 5 Primers for PCR Verification for Alb-pro Bacterial Solution Name of primer Primer sequence (5′-3′) Note Alb-seq-F1 GGTGCAAGCACGTTTCCGACTT Alb-seq-R1 TCTGTGCTATGCTTGCAGAATG Product size 698 bp Alb-seq-F6 ATCATATGTGGCCTGGAGAAAC Alb-seq-R7 GGAGCGGGAGAAATGGATATGA Product size 1167 bp
TABLE-US-00012 TABLE 6 Expected Band Sizes of Enzyme Digestion Identification for Intermediate Vectors Name of restriction enzyme Band size HindIII 4546, 4363 PvuII 4904, 2514, 1491 ScaI 6112, 2797
[0158] 1.4 Preparation of uPA-TRE3G fusion fragment
[0159] 1.4.1 Preparation of uPA-rabbit polyA fragment. The uPA-rabbit polyA fragment was amplified using the primers in Table 7 with Alb-uPA-teton-final as template and recovered for later use.
TABLE-US-00013 TABLE 7 List of Primers for Amplifying uPA-rabbit polyA Fragment Name of primer Primer sequence (5′-3′) Note uPA-rabbit GTGATCTGCAACTCCAGTCTTTGGATCC BamHI polyA-R-BamHI AGTAGTCAGGAGAGGAGGAA site uPA-rabbit TCTTATACCAACTTTCCGTACCACTTCC polyA-F TACCCTCGTAAAGCCGCCACCATGAAAG TCTGGCTGGCGAGC Product size 1785 bp Template Alb-uPA-teton-final
[0160] In the above, the bold underlined part of the uPA-rabbit polyA-F primer is Kozak sequence.
[0161] A nucleotide sequence (SEQ ID NO. 6) of one of the chains of the uPA-rabbit polyA target fragment is as follows:
TABLE-US-00014 atgaaagtctgctgcgagcctgttcctctgcgccttgtgtgaaaaactct gaaggtgcagtgtacttggagctcctgatgaatcaaactgtgctgtcaga acggaggtgtatgcgtgtcctacaagtacttctccagaattcgccgatgc agctgcccaaggaaattccagggggagcactgtgagatagatgcatcaaa aacctgctatcatggaaatggtgactcttaccgaggaaaggccaacactg ataccaaaggtamccctgcctggcctggaatgcgcctgctgtccttcaga aaccctacaatgcccacagacctgatgctattagcctaggcctggggaaa cacaattactgcaggaaccctgacaaccagaagcgaccctgtgctatgtg cagattgcctaaggcagtttgtccaagaatgcatggtgcatgactgctct cttagcaaaaagccttcttcgtctgtagaccaacaaggcttccagtgtgg ccagaaggctctaaggccccgctttaagattgttgggggagaattcactg aggtggagaaccagccctggttcgcagccatctaccagaagaacaaggga ggaagtcctccctcctttaaatgtggtgggagtctcatcagtccttgctg gtgccagtgccgcacactgcttcattcaactcccaaagaaggaaaactac gttgtctacctgggtcagtcgaaggagagctcctataatcctggagagat gaagtttgaggtggagcagctcatcttgcacgaatactacagggaagaca gcctgcctaccataatgatattgccttgctgaagatacgtaccagcacgg gccaatgtgcacagccatccaggtccatacagaccatctgcctgccccca aggtttactgatgctccgtttgttcagactgtgagatcactggctttgga aaagagtctgaaagtgactatctctatccaaagaacctgaaaatgtccgt cgtaaagcttgtttctcatgaacagtgtatgcagccccactactatggct ctgaaattaattataaaatgctgtgtgctgcggacccagagtggaaaaca gattcctgcaagggcgattctggaggaccgcttatctgtaacatcgaagg ccgcccaactctgagtgggattgtgagctggggccgaggatgtgcagaga aaaacaagcccggtgtctacacgagggtctcacacttcctggactggatt caatcccacattggagaagagaaaggtctgccttctgagatctttttccc tctgccaaaaattatggggacatcatgaagccccttgagcatctgacttc tggctaataaaggaaatttattttcattgcaatagtgtgttggaattttt tgtgtctctcactcggaaggacatatgggagggcaaatcatttaaaacat cagaatgagtatttggtttagagtttggcaacatatgcccatatgctggc tgccatgaacaaaggttggctataaagaggtcatcagtatatgaaacagc cccctgctgtccattccttattccatagaaaagccttgacttgaggttag attttttttatattttgttttgtgttatttttttctttaacatccctaaa attttccttacatgttttactagccagatttttcctcctctcctgactac t.
[0162] The underlined part was an encoding sequence of uPA; and the non-underlined part was a rabbit polyA sequence. An amino acid sequence of uPA was represented by SEQ ID NO. 7 as follows:
TABLE-US-00015 mkvwlaslflcalwknseggsvlgapdesncgcqnggvcvsykyfsrirr cscprkfqgehceidasktcyhgngdsyrgkantdtkgrpclawnapavl qkpynahrpdaislglgkhnycrnpdnqkrpwcyvqiglrqfvqecmvhd cslskkpsssvdqqgfqcgqkalrprfkivggeftevenqpwfaaiyqkn kggsppsfkcggslispcwvasaahcfiqlpkkenyvvylgqskessynp gemkfeveglilheyyredslayhndiallkirtstgqcaqpsrsiqtic lpprftdapfgsdceitgfgkesesdylypknlkmswklvsheqcmqphy ygseinykmLcaadpewktdsckgdsggplicniegrptlsgivswgrgc aeknkpgvytrvshfldwiqshigeekglaf.
[0163] 1.4.2 Preparation of TRE3G fragment. TRE3G fragment was amplified using the primers in Table 8 with pTRE3G as template and recovered for later use.
TABLE-US-00016 TABLE 8 List of Primers for Amplifying TRE3G Fragment Name of primer Primer sequence (5′-3′) TRE3G-F GAACGTCATGCTAAGGAAGCTAGAGTT TACTCCCTATCAGTGATAGAGAACGTA TGAAGAG TRE3G-R AAGGCGCAGAGGAACAGGCTCGCCAGC CAGACTTTCATGGTGGCGGCTTTACGA GGGTAGGAAGTGGTACG Product size 448 bp Template pTRE3G
[0164] A nucleotide sequence (SEQ ID NO. 8) of the TRE3G fragment is as follows:
TABLE-US-00017 gagtttactccctatcagtgatagagaacgtatgaagagtttactcccta tcagtgatagagaacgtatgcagactttactccctatcagtgatagagaa cgtataaggagtttactccctatcagtgatagagaacgtatgaccagttt actccctatcagtgatagagaacgtatctacagtttactccctatcagtg atagagaacgtatatccagtttactccctatcagtgatagagaacgtata agctttaggcgtgtacggtgggcgcctataaaagcagagctcgtttagtg aaccgtcagatcgcctggagcaattccacaacacttttgtcttataccaa ctttccgtaccacttcctaccctcgtaaa.
[0165] 1.4.3 Preparation of TRE3G-uPA-rabbit polyA fusion fragment. The fragments uPA-rabbit polyA and TRE3G were fused through fusion PCR using the primers in Table 9, and target bands were recovered for later use.
TABLE-US-00018 TABLE 9 List of Primers for Amplifying uPA-TRE3GP Fusion Fragment Name of primer Primer sequence (5′-3′) Note TRE3G-F GAACGTCATGCTAAGGAAGCTAGAGTT TACTCCCTATCAGTGATAGAGAACGTA TGAAGAG uPA-rabbit GTGATCTGCAACTCCAGTCTTTGGATC BamHI polyA-R- CAGTAGTCAGGAGAGGAGGAA site BamHI Product 2147 bp size Template uPA rabbit polyA and TRE3G
[0166] A nucleotide sequence (SEQ ID NO. 11) of one of the chains of the TRE3G-uPA-rabbit polyA fusion fragment was as follows:
TABLE-US-00019 gagtttactccctatcagtgatagagaacgtatgaagagtttactcccta tcagtgatagagaacgtatgcagactttactccctatcagtgatagagaa cgtataaggagtttactccctatcagtgatagagaacgtatgaccagttt actccctatcagtgatagagaacgtatctacagtttactccctatcagtg atagagaacgtatatccagtttactccctatcagtgatagagaacgtata agctttaggcgtgtacggtgggcgcctataaaagcagagctcgtttagtg aaccgtcagatcgcctggagcaattccacaacacttttgtcttataccaa ctttccgtaccacttcctaccctcgtaaaatgaaagtctggctggcgagc ctgttcctctgcgccttggtggtgaaaaactctgaaggtggcagtgtact tggagctcctgatgaatcaaactgtggctgtcagaacggaggtgtatgcg tgtcctacaagtacttctccagaattcgccgatgcagctgcccaaggaaa ttccagggggagcactgtgagatagatgcatcaaaaacctgctatcatgg aaatggtgactcttaccgaggaaaggccaacactgataccaaaggtcggc cctgcctggcctggaatgcgcctgctgtccttcagaaaccctacaatgcc cacagacctgatgctattagcctaggcctggggaaacacaattactgcag gaaccctgacaaccagaagcgaccctggtgctatgtgcagattggcctaa ggcagtttgtccaagaatgcatggtgcatgactgctctcttagcaaaaag ccttcttcgtctgtagaccaacaaggcttccagtgtggccagaaggctct aaggccccgctttaagattgttgggggagaattcactgaggtggagaacc agccctggttcgcagccatctaccagaagaacaagggaggaagtcctccc tcctttaaatgtggtgggagtctcatcagtccttgctgggtggccagtgc cgcacactgcttcattcaactcccaaagaaggaaaactacgttgtctacc tgggtcagtcgaaggagagctcctataatcctggagagatgaagtttgag gtggagcagctcatcttgcacgaatactacagggaagacagcctggccta ccataatgatattgccttgctgaagatacgtaccagcacgggccaatgtg cacagccatccaggtccatacagaccatctgcctgcccccaaggtttact gatgctccgtttggttcagactgtgagatcactggctttggaaaagagtc tgaaagtgactatctctatccaaagaacctgaaaatgtccgtcgtaaagc ttgtttctcatgaacagtgtatgcagccccactactatggctctgaaatt aattataaaatgctgtgtgctgcggacccagagtggaaaacagattcctg caagggcgattctggaggaccgcttatctgtaacatcgaaggccgcccaa ctctgagtgggattgtgagctggggccgaggatgtgcagagaaaaacaag cccggtgtctacacgagggtctcacacttcctggactggattcaatccca cattggagaagagaaaggtctggccttctgagatctttttccctctgcca aaaattatggggacatcatgaagccccttgagcatctgacttctggctaa taaaggaaatttattttcattgcaatagtgtgttggaattttttgtgtct ctcactcggaaggacatatgggagggcaaatcatttaaaacatcagaatg agtatttggtttagagtttggcaacatatgcccatatgctggctgccatg aacaaaggttggctataaagaggtcatcagtatatgaaacagccccctgc tgtccattccttattccatagaaaagccttgacttgaggttagatttttt ttatattttgttttgtgttatttttttctttaacatccctaaaattttcc ttacatgttttactagccagatttttcctcctctcctgactact.
[0167] In the above, the underlined sequence was TRE3G sequence, the wavy-line part was uPA nucleotide sequence, and the italic part was rabbit polyA sequence.
[0168] 1.5 Preparation of targeting vector
[0169] 1.5.1 The intermediate vector (Alb-pro) prepared in the preceding step was linearized with Ascl enzyme digestion as a ligation vector.
[0170] 1.5.2 SLIC method was adopted, ligation 2×HIFI Mix, TRE3G-uPA-rabbit polyA fusion fragment, and linearized intermediate vector (Alb-pro) fragment were added to a sterile tube, which was supplemented with sterile water to 20 μL; the resultant was reacted at 50° C. for 30 min to obtain the targeting vector containing the Rosa26 arm1-Alb enhancer-Alb promoter-Tet-On 3G-HGH polyA-rabbit polyA-uPA-TRE3G-Rosa26 arm2 fragment (named as Alb final vector); after the reaction was ended, Top 10 chemical competence transformation was performed, LB solid agar medium with Spec resistance was coated after Top 10 chemical competence transformation was finished, followed by inverted culturing at 37° C. overnight.
[0171] 1.5.3 Identification of targeting vector
[0172] The monoclonal was picked from a plate into test tubes containing 4 mL LB with Spec resistance and cultured. The bacterial solution was subjected to PCR identification using the primers in Table 10, positive clones (see
[0173] Upon PCR, enzyme digestion identification, and sequencing, the results show that 3#, 7#, and 10# are correct targeting vectors as described in Example 1.
TABLE-US-00020 TABLE 10 Primers for Identifying Bacterial Solution Containing Targeting Vector Name of primer Primer sequence (5′-3′) Alb-seq-F1 GGTGCAAGCACGTTTCCGACTT Alb-seq-R8 CCCCTTGAGCATCTGACTTCTG Product size 715 bp
TABLE-US-00021 TABLE 11 Enzyme Digestion Identification Scheme of Targeting Vector Restriction enzyme Band size PvuII 4904, 2902, 2514, 290 ApaLI 6799, 2318, 1019, 874
TABLE-US-00022 TABLE 12 Primers for Sequencing Rosa26 Alb-tet3G-upA- enhancer-pro-tetOn3G Name of primer Primer sequence (5′-3′) Alb-seq-F1 GGTGCAAGCACGTTTCCGACTT Alb-seq-F2 CCTAGACTACACTACACATTCT Alb-seq-R3 AGATTGAATTCACCCCTAAGCA Alb-seq-F4 TGCCACCACTGCCTGGCTACAA Alb-seq-F5 GAGGTAAGTATGGTTAATGATC Alb-seq-F6 ATCATATGTGGCCTGGAGAAAC Alb-seq-R7 GGAGCGGGAGAAATGGATATGA Alb-seq-F8 TCCAACACACTATTGCAATGAA Alb-seq-F9 TGACCCAGGTAGACAACGTAGT Alb-seq-F10 AGGCTCGCCAGCCAGACTTTCA
[0174] The positional relationships of various elements on the targeting vector after successful construction is as shown in
Example 3
[0175] A control targeting vector with mouse genome H11 site as a target insertion site was constructed, and a structural diagram of the elements thereof is shown in
[0176] A method for constructing the control targeting vector was as follows:
[0177] 1 preparation of a vector skeleton: amplification was performed using primers in Table 13 with PMD18T-H11-CAG-FLPo (provided by GemPharmatech, Co. Ltd., Jiangsu, see
TABLE-US-00023 TABLE 13 Primers for Amplifying Skeleton Vector Name of primer Primer sequence (5′-3′) Note H11-F-BgIII GAAGATCTGGCGCGCCGTAAGG BgIII, GCAGGATGTGTCAAAC AscI enzyme digestion site H11-R-BgIII GAAGATCTGGCGCGCCCTCAGC BgIII, AGACACCCAGGATAAG AscI enzyme digestion site Product size 4965 bp Template PMD18T-H11-CAG-FLPo
[0178] 2 The correctly sequenced targeting vectors of Example 1 were subjected to BamHI enzyme digestion, the sizes of the digested fragments were 5851 bp and 5159 bp, respectively, and the 5851 bp fragment was recovered.
[0179] 3 The above skeleton vector and 5851 bp fragment were ligated using T4 ligase, transformed by Top 10 chemical competence, and coated with Amp-resistant LB solid agar medium after the Top 10 chemical competence transformation was finished, followed by inverted culturing at 37° C. overnight.
[0180] The monoclonal was picked from a plate into test tubes containing 4 mL LB with Amp resistance and cultured. The bacterial solution was subjected to PCR identification using the primers in Table 14. See
TABLE-US-00024 TABLE 14 Primers for PCR Verification for Alb-H11 Bacterial Solution Primer sequence Product Name of primer (5′-3′) size Note Alb-H11-seq-F1 TGCAAGGCGATTAAGTTGGGTA 1652 bp H1 Alb-seq-R8 CCCCTTGAGCATCTGACTTCTG Alb-H11-seq-F2 TTGCTGGGATTACAGGCGTGAA 1474 bp H2 Alb-H11-seq-R2 GCGGGCAGTGAGCGCAACGCAA
TABLE-US-00025 TABLE 15 Enzyme Digestion Verification Scheme for Alb-H11 Plasmid Name of Restriction enzyme Band size HindIII 4013/3391/1895/1156/351 PvuII 4902/2364/1770/708/690/372
[0181] In the control targeting vector:
[0182] a nucleotide sequence (SEQ ID NO. 12) of one of the chains of the H11 arm1 was as follows:
TABLE-US-00026 ctcagcagacacccaggataagtgcactagtgttcctttcctgaccagtg ggactgctttttccagattcctcttgaagctgaggaggcagtgagagcat gatggcatctaatgagcttggaagtaccagactgccctgatccacagcca ggttttgctgaaaagtgaccagtttgtcctcctccagtagagtgggcagc tgaaggattataatctactgtcaagacttggaggcccctgcagtcaaagt ccaatagaatattatgaaatggagaatggcttattttaatctctatagtg gaattaaaatagcatttatggccccagatccataattaatccaatgactg gtcaaattagcttgaacctgactgaaaaacctgcaatcagtatagtatct ttcagaatgctttacattcaatttataataccagacttcaagttgtaagt taacaattttgagagaaactaatgcagcagaggcaagggaaagacttaaa ttaatgtgaccattaattagttggagtcaggctggattaacattgtgcca gtaaatttcagaaaaattactatatgacttctctgtaaactttgattttg tagagtataatattgattccttgatacttgccacaagctactttcagggt tagtccagcttaaactaatgctatcagaactttatgtgcagaagaaattc cagaagtcctaaggtaaaattaaaacgtgaaaggaactcatttagactgt cttagttcatggaagaaataaacacagtaccagccatatcgttcacacac gtggcatatgtaacttttaataaaccaaaagaaaaagtcccaaatattca agtgaaaaaaatccaaacagttgacacaagcctaactgatagttacttta tgtacagctgtatgtataagttcaaaaaaagctaccctatttgtatgtac aaaagtttatacacaggtctgtacataagggtctatacattttatttttt cagaacccttaggtgtcacctctagaagacaccaacacttcattcacata ttttataaaagaaagacttccaggactgacaatcttgtatcccttgtatt tgaaccatgtaggttcattcgatttaacagccttctgtca.
[0183] A nucleotide sequence (SEQ ID NO. 13) of one of the chains of the H11 arm2 was as follows:
TABLE-US-00027 tagctcaccttgaaaatggaaacatgtctgacaagagccttgagctgaat atcatccagagtatttgctagagacagggtcttaagtctcattaaattgc ttagaagtgtgtttagtcctataaactatgtctcatttgtgtgtccttca caaagagcgctagtgtcgatcatccattagcctagcctataaaggtgaca caacctggtcagtccctctgtatgtctactatttccccttctgatttcta ctatcttctcaagaactggttcttcagcttcctttgggaaatgtcacttt ttaatgatgtgtgttttgcttatgtatatgtctacatactacccatgtgc ttggtcactgcagaggccagaagacggtgtcaggtgcactggaactagag ttaatgacagatgtgagccatagggtgctttgttcacatctttccagtcc caaatgcgtctaaacttatgtgatacatactagattaccacaaaattgct ccaaagacacctttctccctctgagatgaatctctggctggccttgctct aggcaatcctgtgttcaattcaaggactgaatttgattacatcggtaatc cagtgccccaggcatttctgctttttctgtaaggttcttatcccctggaa gactgtttacgtattcatttttttttgagactaagtttcaggtagaaaaa gcttgccttgaacttcactatatagggcttatcttgaactcttgtgggtc ttccacctttcttcagttagcttctgtacactgccagacatgaaaatcag atccatttatagatagatggtcatgagccaccatgtgggtgtctaaaatt gatctcaggacctctgaaagaccagctagttctcttaactgctgagccat ctctctagcgtgtctatacacatttaatatccccttgttccctttctgct tcatcttgctgatcatgattagtgtttgcctttgttacctgttccatcag cttcagcctgaagagtaagtagttctctattggcagtttgacacatcctg cccttac.
Example 4
[0184] The constructed vector (targeting vector or control targeting vector) and the Cas9 system formed an injection system. See the following table:
TABLE-US-00028 Final Component Volume (μl) concentration Targeting vector 2.6 100 ng/μl Cas9-Protein 1 2.5 μg/μl sgRNA 1 1000 ng/μl Injection Buffer 15.4
[0185] The target sequence of sgRNA used for the targeting vector was:
TABLE-US-00029 (SEQ ID NO. 9) AGTCTTCTGGGCAGGCTTAA.
[0186] The target sequence of sgRNA used for the control targeting vector was:
TABLE-US-00030 (SEQ ID NO. 14) CTGAGCCAACAGTGGTAGTA.
[0187] The injection system was injected into 0.5-day (12 h from the time when sperm was added to an egg culture dish) fertilized eggs (1-2 PL/embryo) of NCG wild-type mice by microinjection, and embryos were transplanted (embryos were implanted by means of oviduct transplantation) into 0.5-day (12 h from the time when the female mice successfully mated with ligated male mice (vaginal plug was successfully detected)) pseudo-pregnant female mice. After the birth of mice, targeted mice were screened out through gene identification, and positive mice were named as: H11-alb-Tet On3G-uPA (constructed using the control targeting vector of Example 3) and Rosa26-alb-Tet-On3G-uPA (constructed using the targeting vector of Example 1). The positive F0 mice were backcrossed with background mice (NCG mice) to obtain F1, and tails of F1 generation mice were subjected to gene identification. The positive F1 mice were bred and established for verification experiments.
TABLE-US-00031 TABLE 16 List of Primers for Identification of H11-alb-Tet On3G-uPA Mouse Serial Name of No. primer Primer sequence Band size 1 H11-tF3 GGGCAGTCTGGTACTTCCA KI: 398 bp AGCT Alb-tet3G- GTGTGGGTTGCCACCTCTT Wt: none TRE3G-TR1 TAG 2 H11-tF3 GGGCAGTCTGGTACTTCCA KI: none AGCT H11-tR3 ATATCCCCTTGTTCCCTTT Wt: 285 bp CTGC 3 H11-tF2 ATGCCCACCAAAGTCATCA KI: 1594 bp GTGTAG Alb-tet3G- GTGTGGGTTGCCACCTCTT Wt: none TRE3G-5TR1 TAG 4 Alb-tet3G- GCGATCTGACGGTTCACTA KI: 1595 bp TRE3G-3tF2 AACGAG H11-tR2 TCACAGAAACCATATGGCG Wt: none CTCC
[0188] Identification results in
TABLE-US-00032 TABLE 17 List of Primers for Identification of Rosa26- alb-Tet-On3G-uPA F1 Generation Mouse Serial Name of Product No. primer Primer sequence size 5′ upA-tF1 TGGAGCTCCTGATGAATCAA WT: 0 bp arm ACT ypA-tR1 ATAGCACCAGGGTCGCTTCT Targeted: 1979 bp
3′ Tet on3G- ACAGGCATCATACCCACTCC WT: 0 bp arm F1 Tet on3G- GCGTCAGCAGGCAGCATA Targeted: R2 1749 bp
[0189] Identification results in
Example 5
[0190] Detection of Liver Injury Law of Mice
[0191] 1 Detection of Liver Injury Law of H11-Alb-Tet On3G-uPA Mice
[0192] Background mice (WT), H11-alb-Tet On3G-uPA heterozygous mice and homozygous mice of 6-8 weeks of age were intragastrically administered or administered by drinking water with 2.0 mg/mL Dox, and orbital blood was sampled at different time points to detect ALT activity levels in serum.
[0193] Experimental results in
[0194] 2 Detection of Liver Injury Law of Rosa26-Alb-Tet-On3G-uPA Mice
[0195] NCG background mice and Rosa26-alb-Tet-On3G-uPA heterozygote mice of 2 weeks of age were subjected to orbital blood sampling at 2, 4, 6, 8, 10, 12, 14, and 16 weeks of age, respectively, and ALT activity in serum was detected. Surprisingly, the Rosa26-alb-Tet-On3G-uPA heterozygous mice had elevated ALT activity at 3-4 weeks of age, and the ALT activity increased with increasing weeks of age, and declined sharply at 8-10 weeks of age (see
[0196] The livers of Rosa26-alb-Tet-On3G-uPA mice of 4 weeks of age were taken, and fixed by paraformaldehyde, followed by paraffin embedding, sectioning, and HE staining analysis. Compared with NCG background mice, Rosa26-alb-Tet-On3G-uPA mice at 4 weeks of age exhibited severe liver injury, hepatocyte ballooning degeneration, localized necrosis, and cytosolic lysis (see
[0197] From the above results, it is obtained that the Rosa26-alb-Tet-On3G-uPA heterozygous mice can have spontaneous liver injury, and the degree of liver injury can meet the implantation requirements of exogenous hepatocytes. Rosa26-alb-Tet-On3G-uPA homozygous mice also might have spontaneous liver injury (see
[0198] 3 Rosa26-Alb-Tet-On3G-uPA Mice of Different Weeks of Age all Responded to Dox.
[0199] 3-4-week-old and 6-8-week-old Rosa26-alb-Tet-On3G-uPA mice were taken, and administered with drinking water containing 1-2 mg/mL Dox. Blood was sampled on days 0, 3, 5, and 7 (3-4 weeks old) and days 0, 2, 4, 6, and 8 (6-8 weeks old), to detect the ALT activity in serum. The mice were euthanized on day 7 or 8, and the livers of the mice were taken, fixed, paraffin-embedded, sectioned, and HE-stained, to analyze the situation of hepatocyte injury.
[0200] Results are shown in
[0201] Combining the above results, it can be seen that: compared with the H11-alb-Tet On3G-uPA mice, Rosa26-alb-Tet-On3G-uPA mice had more sensitive responses to Dox, and might have spontaneous injury. Therefore, the Rosa26-alb-Tet-On3G-uPA mice can be used for liver reconstruction after liver injury.
Example 6
[0202] Hepatocyte Transplantation Test
[0203] 1 Green Fluorescent Hepatocyte Isolation
[0204] Male B6-G/R (provided by GemPharmatech, Co. Ltd., Jiangsu, strain No.
[0205] T006163) mice of 5-6 weeks of age were chosen. After the mice were anaesthetized, abdomens were washed with alcohol. The abdominal cavities were cut open to expose inferior vena cava and portal vein, and a retention needle was inserted from the inferior vena cava. After successful pre-perfusion, portal vein was cut open. Pre-heated Preperfusion buffer-P1 (HBSS formulated EDTA solution with a final concentration of 5 mM) and Enzyme buffer-P2 (HBSS formulated CaCl.sub.2 solution (pH7.2) with a final concentration of 5 mM, with Collagenase added prior to use) were perfused in sequence. After the perfusion was finished, the whole liver was removed, washed by PBS, and then put into a P2 solution, a liver capsule was scraped, to let the hepatocytes enter P2, and the cell suspension was filtered. To the filtrate DMEM with 10% FBS was added, followed by centrifugation at 400 rpm for 3 min at 4° C., and the supernatant was removed.
[0206] To the above precipitation, a percoll mixture (10 mL DMEM+1 mL 10×PBS+9 mL percoll) was added to resuspend the cells, followed by centrifugation at 1100 rpm for 3 min at 4° C., and the supernatant was removed.
[0207] The cells were washed with precooled DMEM, the cell viability was detected, and the cells were diluted to a proper concentration according to a counting result for later use.
[0208] 2 Mouse Spleen In Situ Hepatocyte Transplantation
[0209] The Rosa26-alb-Tet-On3G-uPA mice and the NCG mice were randomly divided into the following groups (see Table 18). Each mouse was injected with fresh green fluorescent hepatocytes by intrasplenical transplantation. After completing the transplantation procedure, the mice were incubated on a hot stage at 37° C. After natural awakening, the mice were injected with antibiotics, and the mice were returned to a feeding cage, and administered with normal drinking water or Dox drinking water according to the requirements in the following table. 10 weeks after hepatocyte transplantation of the mice was completed, all the mice were subjected to end-point sampling. The livers were fixed and embedded, and the distribution of the mouse green fluorescent cells was observed through frozen sections. See
TABLE-US-00033 TABLE 18 Mouse Hepatocyte Transplantation and Condition Treatment Grouping Drinking water condition Number in 1 week after Group Mouse genotype Weeks of age of mice transplantation experiment G1 NCG 3-4 weeks of age 8 Normal drinking water G2 Rosa26-alb-Tet-On3G-uPA 3-4 weeks of age 8 Normal drinking water G3 NCG 3-4 weeks of age 8 DOX drinking water G4 Rosa26-alb-Tet-On3G-uPA 3-4 weeks of age 8 DOX drinking water G5 NCG 6-8 weeks of age 8 Normal drinking water G6 Rosa26-alb-Tet-On3G-uPA 6-8 weeks of age 8 Normal drinking water G7 NCG 6-8 weeks of age 8 DOX drinking water G8 Rosa26-alb-Tet-On3G-uPA 6-8 weeks of age 8 DOX drinking water
[0210] Results in
[0211] (1) After the 3-4-week-old and 6-8-week-old Rosa26-alb-Tet-On3G-uPA mice were subjected to hepatocyte transplantation, the mice were administered with normal drinking water for one week, the exogenous hepatocytes could be uniformly distributed on the liver surface of the mice, and the reconstruction rate might reach 50%.
[0212] (2) After 3-4-week-old and 6-8-week-old Rosa26-alb-Tet-On3G-uPA mice were subjected to hepatocyte implantation, the mice were administered with Dox drinking water for one week, the green fluorescent hepatocytes might be uniformly distributed on the liver surface, and the reconstruction rate might reach 90%; compared with the normal drinking water group, giving the mice Dox drinking water might obviously improve the colonization of exogenous hepatocytes in the mouse bodies.
Example 7
[0213] Detecting the survival rate of Rosa26-alb-Tet-On3G-uPA mice
[0214] Offspring Rosa26-alb-Tet-On3G-uPA heterozygote mice were obtained by mating the Rosa26-alb-Tet-On3G-uPA heterozygote mice with NCG background mice for experiments. 1335 Rosa26-alb-Tet-On3G-uPA heterozygote mice were obtained, 1299 mice survived at the perinatal period, with a survival rate up to 97%, the survival rate of the Rosa26-alb-Tet-On3G-uPA homozygous mice was similar to that of the Rosa26-alb-Tet-On3G-uPA heterozygote mice, and compared with the survival rate (70%-75%) of uPA-SCID mice in the perinatal period, the method of the examples of the present disclosure greatly improves the survival rate of mice.
[0215] To sum up the results, it can be seen that:
[0216] an example of the present disclosure provides a vector (Example 1) carrying Tet on system with Rosa26-site homologous arm and regulating specific expression of uPA in liver. The vector can be integrated into the Rosa26 site at a fixed site, and the mouse model Rosa26-alb-Tet-On3G-uPA constructed using the vector combined by such elements avoids interference effect of adjacent sequences on the genome, and will not destroy any endogenous gene, thus ensuring the normal growth and development, and normal function of mice.
[0217] Surprisingly, the mouse model Rosa26-alb-Tet-On3G-uPA constructed using the vector could have spontaneous liver injury (liver injury appeared at 2-3 weeks of age, and the ALT value might be up to 300 IU/L at 8 weeks of age), and the level of spontaneous liver injury completely satisfies the implantation requirements of the exogenous hepatocytes, that is, colonization of the exogenous hepatocytes can be achieved without Dox induction, so that the transplantation procedure is more simplified. This spontaneous liver injury phenotype breaks the conventional knowledge of characteristics for the Tet on system to regulate protein expression.
[0218] In addition, on the basis of spontaneous liver injury, Rosa26-alb-Tet-On3G-uPA can respond to Dox at different growth stages, that is, with Dox induction, the liver injury level of mice might be aggravated, and the colonization rate of exogenous hepatocytes can be improved.
[0219] In combination with the characteristics that the Rosa26-alb-Tet-On3G-uPA mice could have spontaneous liver injury and the liver injury might be aggravated by Dox induction, mice of different weeks of age could be selected at will for liver reconstruction using the characteristic of spontaneous liver injury; or the colonization rate of exogenous hepatocytes can be improved by Dox induction. Using Rosa26-alb-Tet-On3G-uPA mice for liver reconstruction, the transplantation window is no longer limited by the weeks of age, and the condition of transplantation and reconstitution is more flexible.
[0220] In addition, it also should be noted that the mortality of the heterozygote offspring of the Rosa26-alb-Tet-On3G-uPA mice provided by the example of the present disclosure is much lower than that of existing spontaneously liver-injured mouse models, which lays a foundation for large-scale use of liver-injured mouse models.
Example 8
[0221] The present example provides the influence of different ligation relationships between the first expression cassette and the second expression cassette on the hepatoma cell line HepG2, including the following steps:
[0222] preparing expression vectors with different ligation relationships (tail-to-tail (A), tail-to-head (B), and head-to-head (C)) between the first expression cassette and the second expression cassette with the Rosa26 arm1-Alb enhancer-Alb promoter-Tet-On 3G-HGH polyA-rabbit polyA-uPA-RE3G-Rosa26 arm2 in Example 1 as template, respective target sequences, and a 5′ end homologous arm sequence (Rosa26 arm1) and a 3′ end homologous arm sequence (Rosa26 arm2) for mediating insertion of the target sequence into a target site (Rosa26) in a mouse genome (see
[0223] (1) Resuscitation of HepG2 cells and amplification.
[0224] (2) Electrotransformation of HepG2 cells, including adding DPBS to a petri dish to wash the cells and removing the supernatant, digesting and obtaining HepsG2 cells, counting the cells and then equally dividing the cells into 20 equal parts (1.5×10.sup.6/part), adding an electrotransformation solution and plasmids with different ligation relationships to the cells, respectively, mixing the same uniformly, and transferring the resultant to an electrode cup for electrotransformation, after the end of the electrotransformation, quickly sucking out the cell suspension, and placing the cell suspension in the petri dish for culturing.
[0225] (3) 12 h after the electrotransformation, removing the medium and suspended dead cells, and adding a normal medium to continue the culturing for 12 h.
[0226] (4) 24 h after the electrotransformation, changing to a normal medium or medium adding with Dox according to the processing manner in Table 19, to continue the culturing.
TABLE-US-00034 TABLE 19 Influence of Vectors Having Two Expression Cassettes in Different Ligation Relationships on HepG2 Hepatoma Cells and Condition Treatment Grouping Observation Time Name of Vector Point after Group Transferred Culture Condition Electrotransformation G1 Tail-to-tail plasmid normal medium 24h; 48h; G2 Tail-to-tail plasmid normal 24h; 48h; medium + Dox G3 Tail-to-head normal medium 24h; 48h; plasmid G4 Tail-to-head normal 24h; 48h; plasmid medium + Dox G5 head-to-head normal medium 24h; 48h; plasmid G6 head-to-head normal 24h; 48h; plasmid medium + Dox G7 GFP plasmid normal medium 24h; 48h; G8 GFP plasmid normal 24h; 48h; medium + Dox
[0227] Microscopic imaging observation was performed 24 h and 48 h after cell electrotransformation was completed, respectively, and results are shown in
[0228] (1) It can be seen from
[0229] (2)
[0230] (3)
Example 9
[0231] Influence of different ligation relationships between the first expression cassette and the second expression cassette on mouse liver injury
[0232] The hydrodynamic-based method can efficiently introduce an exogenous gene into the liver, has been widely applied to gene function research, and is selected for treating diseases of liver and other organs. Rapid injection of large amounts of DNA at tail vein under the high pressure results in extremely high expression levels of endogenous genes in vivo, particularly in hepatocytes. However, at the same time, high hydraulic pressure also will cause serious injury to the liver (increase of ALT).
[0233] The present example provides the influence of different ligation relationships between the first expression cassette and the second expression cassette on the mouse liver injury, including the following steps.
[0234] The expression vectors with different ligation relationships prepared in the above were injected into mouse bodies in a manner of high-pressure tail-vein rapid injection, meanwhile GFP (Pmax-GFP) plasmids that can express green fluorescence and normal saline were injected as control. After the mice were injected with the plasmid, Dox drinking water (2 mg/L) was administered, orbital blood was sampled on days 1, 3, 5, and 7, respectively, and ALT activity in serum was detected. A specific procedure is as shown in Table 20. On Day 1 after the injection was completed, the livers of the mice in the group injected with GFP plasmid and normal saline were taken, fixed, and embedded, and the distribution of mouse green fluorescent cells was observed through frozen sections. See
TABLE-US-00035 TABLE 20 Condition Treatment Grouping of Experiment for Influence of Vectors with Different Ligation Relationships on Mouse Liver Injury Ligation Number Amount of Blood Relentionship between of plasmids sampling Group Two Expression Cassettes animals injected time 1 tail-to-tail ligation of two 6 20 μg D-1/1/3/5/7 expression cassettes 2 tail-to-head ligation of two 6 20 μg D-1/1/3/5/7 expression cassettes 3 head-to-head ligation of two 6 20 μg D-1/1/3/5/7 expression cassettes 4 GFP plasmid 6 20 μg D-1/1/3/5/7 5 none 6 normal D-1/1/3/5/7 saline
[0235] Results in
[0236] (1) After GFP plasmid was injected, the mouse liver can express green fluorescence, indicating that plasmid DNA injected through tail vein can be expressed in hepatocytes.
[0237] (2) After the plasmids with different ligation relationships and GFP plasmid were injected and when Dox drinking water was administered to the mice, only the ALT of the mice injected with the plasmids with tail-to-tail ligation relationship was obviously increased. Therefore, the vector with the first expression cassette and the second expression cassette in a tail-to-tail ligation relationship can cause the mice to generate liver injury under Dox induction, which is superior to other ligation relationships.
[0238] In conclusion, the two expression cassettes in the tail-to-tail ligation relationship can clearly respond to Dox, which is superior to other ligation relationships.
[0239] The above-mentioned are merely for preferred examples of the present disclosure and not intended to limit the present disclosure. For one skilled in the art, various modifications and variations may be made to the present disclosure. Any modifications, equivalent substitutions, improvements and the like made within the spirit and principle of the present disclosure are intended to be included within the scope of protection of the present disclosure.
INDUSTRIAL APPLICABILITY
[0240] The present disclosure provides a targeting vector, a nucleic acid composition, and a method for constructing a liver-injured mouse model. The liver-injured mouse model constructed using the targeting vector provided in the present disclosure can generate liver injury without induction of an inducer, it can spontaneously generate the liver injury, and the degree of liver injury can be enhanced with use of the inducer. In addition, the degree of spontaneous liver injury of the liver-injured mouse model not only can satisfy the transplantation requirements of exogenous hepatocytes, but also the reconstruction rate is high after hepatocyte transplantation. Besides, the liver-injured mouse model can breed offspring liver-injured mice by crossbreeding, and the mortality of offspring mice is low, facilitating large-scale breeding. The present disclosure provides reliable liver-injured mouse models for studies of liver diseases.