ANTIBODY OF IL-11 AND USE THEREOF

20230257458 · 2023-08-17

Assignee

Inventors

Cpc classification

International classification

Abstract

An antibody or an antigen-binding fragment can specifically recognize IL-11 thereof. The antibody contains CDR sequence(s) selected from at least one of the following or an amino acid sequence having at least 95% identity thereto: heavy chain variable region CDR sequences: SEQ ID NOs: 1-33 and light chain variable region CDR sequences: SEQ ID NOs: 34-66. The antibody can specifically target and bind to IL-11, so as to block binding of IL-11 and an IL-11 receptor.

Claims

1.-28. (canceled)

29. An antibody or an antigen-binding fragment thereof that can specifically recognize IL-11, wherein the antibody comprises: a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:1, 2 and 3 or an amino acid sequence having at least 95% identity to SEQ ID NO:1, 2 and 3, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:4, 5 and 6 or an amino acid sequence having at least 95% identity to SEQ ID NO:4, 5 and 6, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:7, 8 and 9 or an amino acid sequence having at least 95% identity to SEQ ID NO:7, 8 and 9, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:10, 11 and 12 or an amino acid sequence having at least 95% identity to SEQ ID NO:10, 11 and 12, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:13, 14 and 15 or an amino acid sequence having at least 95% identity to SEQ ID NO:13, 14 and 15, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:16, 17 and 18 or an amino acid sequence having at least 95% identity to SEQ ID NO:16, 17 and 18, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:19, 20 and 21 or an amino acid sequence having at least 95% identity to SEQ ID NO:19, 20 and 21, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:22, 23 and 24 or an amino acid sequence having at least 95% identity to SEQ ID NO:22, 23 and 24, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:25, 26 and 27 or an amino acid sequence having at least 95% identity to SEQ ID NO:25, 26 and 27, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:28, 29 and 30 or an amino acid sequence having at least 95% identity to SEQ ID NO:28, 29 and 30, respectively; or a heavy chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:31, 32 and 33 or an amino acid sequence having at least 95% identity to SEQ ID NO: 31, 32 and 33, respectively; and a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:34, 35 and 36 or an amino acid sequence having at least 95% identity to SEQ ID NO:34, 35 and 36, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:37, 38 and 39 or an amino acid sequence having at least 95% identity to SEQ ID NO:37, 38 and 39, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:40, 41 and 42 or an amino acid sequence having at least 95% identity to SEQ ID NO:40, 41 and 42, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:43, 44 and 45 or an amino acid sequence having at least 95% identity to SEQ ID NO:43, 44 and 45, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:46, 47 and 48 or an amino acid sequence having at least 95% identity to SEQ ID NO:46, 47 and 48, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:49, 50 and 51 or an amino acid sequence having at least 95% identity to SEQ ID NO:49, 50 and 51, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:52, 53 and 54 or an amino acid sequence having at least 95% identity to SEQ ID NO:52, 53 and 54, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:55, 56 and 57 or an amino acid sequence having at least 95% identity to SEQ ID NO:55, 56 and 57, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:58, 59 and 60 or an amino acid sequence having at least 95% identity to SEQ ID NO:58, 59 and 60, respectively; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:61, 62 and 63 or an amino acid sequence at least 95% identity to SEQ ID NO: 61, 62 and 63; or a light chain variable region comprising CDR1, CDR2, CDR3 as shown in SEQ ID NO:64, 65 and 66 or an amino acid sequence at least 95% identity to SEQ ID NO: 64, 65 and 66.

30. The antibody or antigen-binding fragment thereof of claim 29, wherein the heavy chain variable region has the amino acid sequence shown in any one of SEQ ID NO: 67-77.

31. The antibody or antigen-binding fragment thereof of claim 29, wherein the light chain variable region has the amino acid sequence shown in any one of SEQ ID NO: 78-88.

32. The antibody or antigen-binding fragment thereof of claim 29, wherein the antibody comprises at least one of a heavy chain constant region and a light chain constant region, and at least a part of at least one of the heavy chain constant region and the light chain constant region is derived from at least one of a murine antibody, a human antibody, a primate antibody, or a mutant thereof.

33. The antibody or antigen-binding fragment thereof of claim 29, wherein both the light chain constant region and the heavy chain constant region of the antibody are derived from a human IgG antibody or a mutant thereof.

34. The antibody or antigen-binding fragment thereof of claim 29, wherein the light chain constant region of the antibody is derived from the light chain constant region of human Kappa; the heavy chain constant region is derived from the heavy chain constant region of human IgG1.

35. The antibody or antigen-binding fragment thereof of claim 34, wherein the full-length sequence of the antibody constant region is shown in SEQ ID NO: 89 or 90.

36. The antibody or antigen-binding fragment thereof of claim 29, wherein the heavy chain has the amino acid sequence shown in any one of SEQ ID NO: 91-101 and the light chain has the amino acid sequence shown in any one of SEQ ID NO: 102-112.

37. The antibody or antigen-binding fragment thereof of claim 29, wherein the antibody is a single-chain antibody, a multimeric antibody, a CDR-grafted antibody or a small molecule antibody.

38. The antibody or antigen-binding fragment thereof of claim 37, wherein the single-chain antibody comprises a heavy chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 67-77 and a light chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 78-88, wherein the C-terminus of the heavy chain variable region is connected to the N-terminus of the light chain variable region through a connecting peptide linker, or the C-terminus of the light chain variable region is connected to the N-terminus of the heavy chain variable region through a connecting peptide linker.

39. The antibody or antigen-binding fragment thereof of claim 37, wherein the small molecule antibody comprises at least one of Fab antibody, Fv antibody, single domain antibody and minimum recognition unit.

40. A nucleic acid molecule encoding the antibody or antigen-binding fragment thereof of claim 29.

41. The nucleic acid molecule of claim 40, wherein the nucleic acid molecule has a nucleotide sequence shown in any one of SEQ ID NO: 113-123 or a nucleotide sequence shown in any one of SEQ ID NO: 124-134.

42. An expression vector carrying the nucleic acid molecule of claim 40.

43. A recombinant cell expressing the antibody or antigen-binding fragment thereof of claim 29, or carrying the nucleic acid molecule encoding the antibody or antigen-binding fragment.

44. A pharmaceutical composition comprising the antibody or antigen-binding fragment thereof of claim 29, or the nucleic acid molecule encoding the antibody or antigen-binding fragment, or the expression vector carrying the nucleic acid molecule, or the recombinant cell expressing the antibody or antigen-binding fragment, or the recombinant cell carrying the nucleic acid molecule.

45. A method of treating or preventing pulmonary fibrosis, non-alcoholic steatohepatitis, chronic heart failure or diseases caused by the transformation of fibroblasts into fibrosis in a subject comprising administering to the subject a therapeutically effective amount of claim 29, or the nucleic acid molecule encoding the antibody, or the expression vector carrying the nucleic acid molecule, or the recombinant cell expressing the antibody, or the recombinant cell carrying the nucleic acid molecule.

46. A method of treating or preventing pulmonary fibrosis, non-alcoholic steatohepatitis, chronic heart failure or diseases caused by the transformation of fibroblasts into fibrosis in a subject comprising administering to the subject a therapeutically effective amount of the pharmaceutical composition of claim 44.

47. A kit for detecting IL-11 comprising the antibody of claim 29.

48. A method of detecting IL-11 or diagnosing IL-11-related diseases in a subject using a kit comprising the antibody of claim 29, or the nucleic acid molecule encoding the antibody, or the expression vector carrying the nucleic acid molecule, or the recombinant cell expressing the antibody, or the recombinant cell carrying the nucleic acid molecule.

Description

DESCRIPTION OF THE DRAWINGS

[0118] The above and/or additional aspects and advantages of the present invention will become apparent and readily understood from the following description of embodiments taken in conjunction with the accompanying drawings, wherein:

[0119] FIG. 1 is the result of competitive blocking the binding of IL-11 and IL-11R by a preferred antibody according to the embodiments of the present invention;

[0120] FIG. 2 is the test result of competitive blocking activity of the preferred antibody according to the embodiments of the present invention;

[0121] FIG. 3 and FIG. 4 are the western test results of the preferred antibodies inhibiting the transformation of lung fibroblast HFL-1 to fibrosis according to the embodiments of the present invention;

[0122] FIG. 5 is the statistical analysis result of the preferred antibodies inhibiting the transformation of lung fibroblasts HFL-1 to fibrosis according to the embodiments of the present invention;

[0123] FIG. 6 and FIG. 7 are results of inhibition of pulmonary fibrosis in C57BL/6 mice by the preferred antibody according to the embodiments of the present invention;

[0124] FIGS. 8, 9, 10 and 11 are results of inhibition of pulmonary fibrosis in Sprague Dawley rats by the preferred antibody according to the embodiments of the present invention; and

[0125] FIG. 12 is the competitive blocking activity of the humanized antibody according to the embodiments of the present invention.

EXAMPLES

[0126] The embodiments of the present invention are described in detail below, examples of the embodiments are illustrated in the accompanying drawings. The embodiments described below with reference to the accompanying drawings are exemplary, and are intended to explain the present invention and should not be construed as limiting the present invention.

[0127] In addition, the terms “first” and “second” are only used for descriptive purposes, and should not be construed as indicating or implying relative importance or implying the number of indicated technical features. Thus, a feature delimited with “first”, “second” may expressly or implicitly include at least one of that feature. In the description of the present invention, “plurality” means at least two, such as two, three, etc., unless otherwise expressly and specifically defined.

[0128] Antibody

[0129] As used herein, the term “antibody” is an immunoglobulin molecule capable of binding to a specific antigen. It consists of two light chains with lighter molecular weight and two heavy chains with heavier molecular weight. The heavy chain (H chain) and the light chain (L chain) are connected by a disulfide bond to form a tetrapeptide chain molecule. Among them, the amino acid sequence of the amino-terminal (N-terminus) of the peptide chain varies greatly, which is called variable region (V region), and the carboxyl-terminal (C-terminus) is relatively stable and varies little, which is called constant region (C region). The V regions of the L chain and H chain are called VL and VH, respectively.

[0130] The amino acid composition and arrangement sequence of certain regions in the variable region have a higher degree of variation, which is called hypervariable region (HVR). The hypervariable region is where the antigen and antibody bind, so it is also called complementarity-determining region (CDR). There are three CDR regions on both the heavy chain variable region and the light chain variable region. The amino acid composition and arrangement sequence outside the hypervariable region of the antibody variable region vary relatively little, which is called framework region (FR). There are four framework regions in VH and VL respectively, which are represented by FR1, FR2, FR3 and FR4, respectively.

[0131] The present invention uses an IL-11 antigen to obtain a highly specific and high-affinity anti-IL-11 Fab (antigen-binding fragment) antibody fragment through immunization. The antibody fragment can specifically bind to the IL-11 antigen, so that diseases such as pulmonary fibrosis can be targeted for treatment.

[0132] It should be noted that “immunogenicity” refers to the property that can cause an immune response, that is, an antigen can stimulate specific immune cells, to make the immune cells activate, proliferate, and differentiate, and finally produce the characteristics of immune effector antibodies and sensitized lymphocytes. The inventors of the present application further carried out humanization transformation (humanization modification) on the screened new neutralizing antibody sequences of murine origin to obtain a humanized antibody, which can not only retain the affinity and specificity of the parental mouse monoclonal antibody, but also greatly reduce its immunogenicity and improve its safety.

[0133] In some embodiments, the present invention provides an antibody or antigen-binding fragment that can specifically recognize IL-11, the antibody comprises CDRs selected from at least one of the following or an amino acid sequence having at least 95% identity thereto: a heavy chain variable region comprising CDRs having the amino acid sequence of SEQ ID NO: 1-33, a light chain variable region comprising CDRs having the amino acid sequence of SEQ ID NO: 34-66. In other embodiments, the antibody or antigen-binding fragment provided by the present invention has conservative amino acid substitution compared to the above heavy chain and light chain. An “antigen-binding fragment” refers to an antibody fragment that retains the ability to specifically bind an antigen. “Conservative amino acid substitution” refers to the replacement of an amino acid by another amino acid with a residue that is biologically, chemically, or structurally similar. Biologically similar means that the substitution does not destroy the biological activity of the IL-11 antibody or binding to the IL-11 antigen. Structurally similar means that amino acids have side chains of similar length, such as alanine, glycine, or serine, or have side chains of similar size. Chemically similar means that amino acids have the same charge or are both hydrophilic or hydrophobic. For example, the hydrophobic residues isoleucine, valine, leucine or methionine are substituted for each other. Alternatively, polar amino acids can be substituted for each other, e.g., arginine substituted for lysine, glutamate substituted for aspartic acid, glutamine substituted for asparagine, serine substituted for threonine, and the like.

[0134] In some embodiments, the present invention provides an antibody or antigen-binding fragment, the heavy chain variable region has the amino acid sequence shown in any one of SEQ ID NO: 67-77 and the light chain variable region has the amino acid sequence shown in any one of SEQ ID NO: 78-88. The inventors can obtain the CDR regions of the above-mentioned heavy chain variable region (as shown in SEQ ID NO: 1-33) and the CDR regions of the light chain variable region (as shown in SEQ ID NO: 34-66) through the antibody sequence alignment database (NCBI, IMGT). In other embodiments, the heavy chain variable region of the antibody or antigen-binding fragment have conservative amino acid substitution compared to the amino acid sequence shown in SEQ ID NO: 67-77. In other embodiments, the light chain variable region of the antibody or antigen-binding fragment have conservative amino acid substitution compared to the amino acid sequence shown in any one of SEQ ID NO: 78-88. Of course, these conservative amino acid substitutions do not alter the biological function of the antibody or antigen-binding fragment. In some embodiments, these conservative amino acid substitutions can occur at the amino acids in heavy and light chain variable regions other than the CDR regions.

[0135] In some preferred embodiments, the present invention provides an anti-IL-11 antibody, the heavy chain has the amino acid sequence shown in any one of SEQ ID NO: 91-101 and the light chain has the amino acid sequence shown in any one of SEQ ID NO: 102-112.

[0136] In some preferred embodiments, the present invention provides an anti-IL-11 single chain antibody.

[0137] Nucleic Acid Molecule, Expression Vector, Recombinant Cell

[0138] In the process of preparing or obtaining these antibodies, the nucleic acid molecules expressing these antibodies can be used to connect with different vectors, and then express in different cells to obtain corresponding antibodies.

[0139] To this end, the present invention also provides an isolated nucleic acid molecule, which encodes the antibody or antigen-binding fragment described above.

[0140] In some embodiments, the isolated nucleic acid molecule has the nucleotide sequence shown in any one of SEQ ID NO: 113-123 or has the nucleotide sequence shown in any one of SEQ ID NO: 124-134.

[0141] In some embodiments, the isolated nucleic acid molecule has at least more than 90% homology with the nucleotide sequences shown in SEQ ID NO: 113-123 above, preferably, more than 95% homology, more preferably, more than 98% or 99% homology. In at least some embodiments, the isolated polynucleotide has at least more than 90% homology with the nucleotide sequences shown in SEQ ID NO: 124-134, preferably, more than 95% homology, more preferably, more than 98% or 99% homology. These sequences have homology to the nucleotide sequences shown in SEQ ID NO: 113-123 or SEQ ID NO: 124-134, and can express amino acids similar to SEQ ID NO: 91-101 and SEQ ID NO: 102-112, thereby can specifically bind to the IL-11 antigen to achieve the targeting function of the antibody.

[0142] In some preferred embodiments, the isolated nucleic acid molecule has a heavy chain nucleotide sequence shown in SEQ ID NO: 113-123 and a light chain nucleotide sequence shown in SEQ ID NO: 124-134. These nucleotide sequences are species optimized for easier expression in mammalian cells.

[0143] The present invention also provides an expression vector, which comprises the above-described isolated nucleic acid molecule. When the above-described isolated polynucleotide is ligated to a vector, the polynucleotide can be directly or indirectly connected to control elements on the vector, as long as these control elements can control the translation and expression and the like of the polynucleotide. Of course, these control elements can come directly from the vector itself, or can be exogenous, that is, not from the vector itself. Of course, it is sufficient that the polynucleotide is operably linked to the control elements. Herein, “operably linked” refers to linking an exogenous gene to a vector, so that the control elements in the vector, such as transcriptional control sequences and translational control sequences, etc., can perform the intended functions of regulating the transcription and translation of the exogenous gene. Of course, the polynucleotides used to encode the heavy chain and the light chain of the antibody can be independently inserted into different vectors, and usually inserted into the same vector. Commonly used vectors can be, for example, plasmid, phage, and the like. For example, Plasmid-X plasmid.

[0144] The present invention also provides a recombinant cell, which comprises the expression vector. The expression vector can be introduced into mammalian cells to construct and obtain recombinant cells, and then these recombinant cells can be used to express the antibody or antigen-binding fragment provided by the present invention. By culturing the recombinant cells, corresponding antibodies can be obtained. These usable mammalian cells can be, for example, CHO cells and the like.

[0145] Pharmaceutical Composition, Kit and Pharmaceutical Use and Use in the Preparation of Kit.

[0146] The present invention also provides a pharmaceutical composition, which comprises the above-mentioned antibody or antigen-binding fragment and a pharmaceutically acceptable carrier.

[0147] The anti-IL-11 antibody provided herein can be incorporated into pharmaceutical compositions suitable for administration to a subject. Typically, these pharmaceutical compositions include an anti-IL-11 antibody provided herein and a pharmaceutically acceptable carrier. “Pharmaceutically acceptable carrier” can include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Specific examples may be one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, etc., and combinations thereof. In many cases, isotonic agents such as sugars, polyols (e.g., mannitol, sorbitol) or sodium chloride, etc. are included in the pharmaceutical compositions. Of course, the pharmaceutically acceptable carrier may also include minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives or buffering agents, to prolong the shelf life or potency of the antibody.

[0148] For example, the antibody of the invention can be incorporated into pharmaceutical compositions suitable for parenteral administration (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular). These pharmaceutical compositions can be prepared in various forms. For example, liquid, semisolid, and solid dosage form, and the like, include, but are not limited to, liquid solution (e.g., injection solution and infusion solution), dispersion or suspension, tablet, pill, powder, liposome and suppository. Typical pharmaceutical compositions are in the form of injection solution or infusion solution. The antibody can be administered by intravenous infusion or injection or intramuscular or subcutaneous injection.

[0149] Of course, the anti-IL-11 antibody herein can also be made into a kit or part of other diagnostic reagents as needed. According to the embodiments of the present invention, the present invention also provides a kit, which comprises the above-mentioned IL-11 antibody. The application of the kit provided by the present invention, for example, the kit can be used for immunoblotting, immunoprecipitation, etc., involving the use of the specific binding properties of IL-11 antigen and antibody for detection, and the like. These kits may contain any one or more of the following: antagonist, anti-IL-11 antibody, or drug reference material; protein purification column; immunoglobulin affinity purification buffer; assay diluent for cells; instruction or literature, etc. Anti-IL-11 antibody can be used in different types of diagnostic tests, such as in vitro or in vivo detection of various diseases or the presence of drugs, toxins, or other proteins. For example, it can be used to test for related diseases by testing the serum or blood of the subject. Such related diseases may include IL-11 related diseases, such as pulmonary fibrosis and the like. Of course, the antibody provided herein can also be used for radioimmunoassay and radioimmunotherapy of the above-mentioned diseases.

[0150] When using the anti-IL-11 antibody provided by the present invention to treat the above-mentioned diseases, the anti-IL-11 antibody provided by the present invention may be provided to the subject. To this end, the present invention provides a method for treating the above-mentioned diseases, comprising administering the antibody or antigen-binding fragment thereof provided by the present invention to a subject in need.

[0151] The scheme of the present invention will be explained below in conjunction with the embodiments. Those skilled in the art will understand that the following examples are only used to illustrate the present invention, and should not be construed as limiting the scope of the present invention. If no specific technique or condition is indicated in the examples, the technique or condition described in the literature in the field or the product instruction is used. The reagents or instruments used without the manufacturer's indication are conventional products that can be obtained from the market.

Example 1 Production of Recombinant Human Protein Antigen Hu-IL-11-His Tag

[0152] Construction of vector: The amino acid sequence of human IL-11 was obtained from the global public database UniProt (P20809: 124294). An expression vector containing human IL-11 gene sequence was constructed using the method of molecular cloning. The vector encoding human IL-11 was transfected into mammalian cells CHO through electrotransfection for expression for 14 days. After fermentation, the cell supernatant was harvested, and Ni column (GE healthcare, Cat: 17524801) was used for preliminary purification, then Superdex75 (GE healthcare, Cat: 29148721) was used for refine purification, finally the recombinant protein antigen hu-IL-11-His tag that can be used to immunize animals was obtained.

Example 2 Animal Immunization

[0153] In order to obtain the mice that can secret antibody against hu-IL-11, we immunized female Balb/c mice. The female Balb/c mice were purchased from Hunan SJA Laboratory Animal Co., Ltd. The recombinant protein antigen hu-IL-11-His tag and immune adjuvant were fully emulsified before animal immunization. The immunization process is shown in Table 1.

TABLE-US-00013 TABLE 1 Schedule of Animal immunization Immunization time point (Day) Immunogen dose Immune mode 0 50 ug hu-IL-11-His tag and Intraperitoneal multipoint CFA mixed in equal volume injection 14 50 ug hu-IL-11-His tag and Intraperitoneal multipoint IFA mixed in equal volume injection 28 50 ug hu-IL-11-His tag and Intraperitoneal multipoint IFA mixed in equal volume injection 35 None Orbital blood collection 38 50 ug hu-IL-11-His tag Tail vein injection 41 None The mice were sacrificed and the spleens were removed

[0154] On the 35th day, a small amount of mice orbital blood was harvested, and the antibody titer was detected by the conventional Elisa method.

Example 3 Fusion and Screening of Antibody-Secreting Cells

[0155] Isolated mouse spleen cells were fused with immortalized mouse myeloma cells SP2/0, then stood and cultured in RPMI-1640 complete medium containing 10.sup.−4 M Hypoxanthine, 4×10.sup.−7 M Aminopterin, 1.6×10.sup.−5 M Thymidine for about 14 days, the antibody affinity detection and screening were carried out after the fusion cells grew clone group. The positive clones that bound to IL-11 were selected, and the supernatants were taken, then flow cytometry was performed to determine the competitive binding of antigen and antibody. Cell lines with high secretion of specific antibody were selected for expanded culture and cryopreservation. The results are shown in Table 2. The specific method was to obtain an antibody strain with high affinity (OD450 nm was the measured affinity value) for IL-11 through Elisa screening firstly, wherein P.C. was the binding affinity between the purchased IL-11 antibody (Abcam, ab130083) and IL-11 protein as a positive control. Secondly, by constructing a cell line stably expressing IL-11R, an appropriate amount of IL-11 protein was mixed with the positive hybridoma supernatant, then co-incubated with a cell line stably expressing IL-11R, the blocking effect (mean value of FITC-A) of hybridoma supernatant on IL-11/IL-11R was finally detected by flow cytometry, wherein N.C. was the value detected without hybridoma supernatant, which could be regarded as the value without blocking at all (Negative control). The underline in Table 2 indicates the selected clones. After multiple rounds of subcloning, a monoclonal antibody derived from a single antibody-secreting cell was finally obtained. The binding affinity (OD450 nm) and the competitive blocking results of the monoclonal antibodies are shown in Table 3.

TABLE-US-00014 TABLE 2 Test results of Elisa affinity test and flow cytometry competition test OD(450 nm) FITC-A Clone(No.) value mean 3-1A2 2.243 12538 3-2A12 1.781 13334 3-2B2 1.084 13285 3-2B5 3.432 13837 3-3B9 1.777 13049 3-3G9 3.078 11577 3-3G11 2.943 13959 3-4G12 2.991 14418 3-4H1 2.876 12658 3-4H4 2.736 14459 3-4H12 3.33 13876 3-5B2 3.264 11001 3-5D11 1.068 13000 3-5G12 1.907 14267 3-6A4 2.656 750 3-7C1 2.661 13349 3-7C6 2.589 11605 3-7C9 2.722 11406 3-7G12 2.959 12412 3-7H5 1.995 13161 3-8H12 2.926 13360 3-9C12 1.915 14499 3-9D12 2.732 13833 3-9E1 2.894 13822 3-12F10 0.628 17067 3-13F11 1.915 15967 3-13G12 2.732 15312 3-13H1 1.41 13551 3-13H8 2.066 14323 3-15A11 1.214 16661 3-15C4 1.318 15017 3-15D5 2.894 11919 3-15D10 2.402 15064 3-17D12 2.48 15572 3-17E7 2.372 13301 3-18C11 2.566 14884 3-18C12 3.504 16114 3-19E8 3.412 15279 3-20F12 3.496 14504 5-1A2 2.765 6217 5-1B12 2.865 4613 5-1E9 2.531 4638 5-2E11 2.921 5218 5-2F11 2.275 5625 5-2G11 2.948 5045 5-3E8 2.775 4897 5-3G12 2.77 8573 5-4C9 2.034 5933 5-5F5 2.768 4564 5-5F8 2.532 9436 5-5F11 2.627 12273 5-6F1 2.677 11496 5-6G5 2.679 10201 5-7B4 2.751 6587 5-9E12 2.049 10707 5-9D7 2.129 10127 5-9G8 3.591 6747 5-8G1 3.714 10460 5-10D3 3.201 10041 5-10F6 2.311 10472 5-12B1 2.351 9782 5-14B10 2.54 11385 5-14C3 3.654 7672 5-17C11 3.462 11718 5-20E11 3.649 4330 5-21G2 3.545 4946 5-21H7 3.25 11385 5-22C4 3.561 6019 5-24F6 3.571 9954 5-25D3 1.87 3713 P.C. (Elisa) 3.62 N/A N.C. (Flow) N/A 24596 Note: N/A in Table 2 means: no data

TABLE-US-00015 TABLE 3 Test results of Elisa affinity test and flow cytometry competition test Sample FITC Sample FITC number OD450 Mean number OD450 Mean 3-6A4 1.584 3036 3-5B2-2G4 1.65 19751 5-20E11-5F2 1.596 3109 5-21G12-1D3 1.528 3362 5-20E11-1A2 1.634 3635 3-5B2-7A4 1.636 20958 3-15D5-3A6 1.688 10944 3-9E1-3A2 1.544 9067 3-7C9-1A6 1.601 3148 3-15D5-6A1 1.511 13639 3-2B5-3D2 1.614 15289 N.C.(flow) N/A 18433 Note: N/A in Table 3 means: no data; because the sequence of 3-6A4 cells after subcloning was consistent with the sequence before subcloning, its number is the same as that in Table 2.

Example 4 Sequence Determination of Monoclonal Antibodies

[0156] 1*10{circumflex over ( )}6˜5*10{circumflex over ( )}6 hybridoma cells were taken, the total RNA was extracted with Takara MiniBEST Universal RNA Extraction Kit, and cDNA was reverse transcribed with PrimeScript RT Reagent Kit (Takara Corporation). The above steps were carried out according to the instructions provided by the manufacturer. The design of gene amplification primers for antibody heavy chain variable region (VH) and light chain variable region (VL) mainly refers to the primer pairs in Ig-Primer Sets (Novagen Corporation, Cat. No. 69831-3), synthesized by BGI Genomics. The genes of heavy chain variable region and light chain variable region were amplified from the first strand of the cDNA, then cloned into the pMD18-T vector and transformed into E. coli DH5a, the clones were picked and sequenced by BGI Genomics to obtain the gene sequences of the heavy chain variable region (VH) and light chain variable region (VL). The primer sequences used and the sequenced antibody sequences are also found in the documentation.

Example 5 Identification of Antibody Isotypes

[0157] The monoclonal hybridoma cell lines corresponding to the preferred antibody strains were injected into Balb/C mice by conventional method to produce and purify ascites antibodies. The purified antibody was used for antibody isotype analysis, and the antibody isotype detection method was detected by a mature kit (Proteintech, KMIM-2). The results are shown in Table 4 below.

TABLE-US-00016 TABLE 4 Antibody isotype identification results of candidate antibody strains Clones OD 3-5B2- 3-5B2- 3-2B5- 3-7C9-1 3-9E1-3 3-15D 3-15D 5-20E1 5-21G 5-20E1 Isotype 2G4 7A4 3D2 3-6A4 A6 A2 5-3A6 5-6A1 1-1A2 2-1D3 1-5F2 IgG1 0.307 1.207 0.113 3.098 0.475 0.501 0.241 0.402 1.853 1.231 2.457 IgG2a 0.055 0.071 0.063 0.095 0.081 0.072 0.096 0.074 0.265 0.075 0.293 IgG2b 0.051 0.307 0.823 0.071 0.086 0.075 0.474 0.075 0.088 0.053 0.285 IgG3 0.091 0.091 0.057 0.057 0.106 0.074 0.097 0.065 0.177 0.055 0.155

Example 6 Expression and Purification of Preferred Monoclonal Antibodies

[0158] The sequences of preferred monoclonal antibodies 3-6A4 and 5-20E11-5F2 were constructed into conventional expression vectors by genetic engineering method, and then transfected into CHO cells. After fermentation, the collected cell culture supernatants were purified by a Protein G column (EzFast Protein G 4FF, Borgron), the balance buffer was 20 mM PBS, 0.15M NaCl, pH 7.4, and 0.1M glycine, pH 3 0.0±0.2 was used as the elution buffer. The protein eluate under the target absorption peak was collected, and after ultrafiltration with PBS buffer, part of the samples were taken for SDS-PAGE electrophoresis detection, and the aggregation content was determined by SEC-HPLC method. The aggregation contents of the antibodies were all within 3%.

Example 7 Preferred Antibodies Competitively Block the Binding of IL-11 to IL-11R

[0159] In order to detect the competitive binding ability of the preferred antibodies 3-6A4 and 5-20E11-5F2, the Elisa plates were coated with an appropriate amount of IL-11R-His protein and incubated overnight. Then, an appropriate amount of IL-11-Fc protein was added, and co-incubated with different concentration gradients of antibodies. Finally, HRP-conjugated Goat anti IgG-Fc secondary antibody (ThermoFisher, 31413) and TMB substrate were used for detection. We detected that both the preferred antibodies and 6D9A1 (Abcam, ab130083) could inhibit the binding of IL-11 to IL-11R to varying degrees. The results are shown in FIG. 1.

Example 8 Cross-Reactivity of Preferred Antibodies

[0160] IL-6 cytokine family members include IL-6, IL-11, CNTF, CLC, LIF, CT-1, OSM, IL-27, IL-31. IL-11 is a member of the IL-6 cytokine family. We used conventional Elisa method to coat recombinant IL-6 (Sinobiological-10395-HNAE), IL-27 (R&D systems, 2526-IL-010), LIF (Peprotech, 300-05), CLC (R&D systems, 962-CL-050), IL-11 (LSBio, LS-G132887-10), OSM (Genscript-z03132), IL-31 (Peprotech, 200-31), CNTF (R&D systems, 257-NT-010), CT-1 (R&D systems, 612-CD-010) protein, and the binding affinity of preferred antibodies 3-6A4 and 5-20E11-5F2 to members of the IL-6 cytokine family was detected. The results show that the preferred antibodies do not cross-react with other members of the IL-6 cytokine family except for binding to the IL-11 cytokine. The Elisa results (OD450 nm) are shown in Table 5 below.

TABLE-US-00017 TABLE 5 Binding affinity detection of preferred antibodies 3-6A4 and 5-20E11-5F2 to different members of the IL-6 cytokine family IL-6 IL-27 OSM CLC LIF IL-31 CNTF CT-1 IL-11 3-6A4 0.039 0.035 0.102 0.042 0.084 0.088 0.064 0.041 1.884 5-20E11-5F2 0.049 0.048 0.045 0.033 0.037 0.036 0.036 0.034 1.926

Example 9 Binding Affinity Determination of Preferred IL-11 Monoclonal Antibodies to Antigen

[0161] Bio-Layer Interferometry (BLI) was used for binding affinity determination. Ni-NTA sensor was used to capture antigen IL-11 (His tag), the preferred antibodies 3-6A4 and 5-20E11-5F2 were used as analytes. The analytes were diluted in 7 concentration gradients, the binding time was 60 s and the dissociation time was 1000 s. The buffer was 20 mM PBS, 0.15M NaCl, 0.1% BSA, 0.05% Tween 20, pH 7. BLI kinetics/affinity software was used to analysis and obtain the dissociation constant (kdis) and affinity constant (KD) of the preferred antibodies and the corresponding hu-IL-11 ligand. The specific results are shown in Table 6 below.

TABLE-US-00018 TABLE 6 Conc. Sample ID (nM) Response KD (M) kon (1/Ms) kon Error kdis (1/s) kdis Error Full X{circumflex over ( )}2 Full R{circumflex over ( )}2 3-6A4  41.7 1.0442 3.93E−11 1.06E+06 2.08E+04 4.16E−05 2.39E−06 0.017992 0.999488 5-20E11-5F2 166.7 1.2727 6.90E−11 1.75E+05 3.19E+03 1.21E−05 2.94E−06 0.051363 0.999171

Example 10 Competitive Blocking Activity Detection of Preferred Antibodies

[0162] In order to evaluate the binding of the preferred Anti-huIL-11 antibodies 3-6A4 and 5-20E11-5F2 to IL-11 and whether the binding between the ligand and the receptor can be blocked, we constructed a cell line (membrane-IL-11R CHO) that stably expressing IL-11R. The blocking activities of candidate antibodies and commercial antibody 6D9A1 (Abcam, ab130083) against IL-11 and IL-11R were detected by flow cytometry. Firstly, an appropriate amount of IL-11 recombinant protein with Fc tag was co-incubated with different gradients of antibodies for 15 mins, and then incubated with 1 E+05 membrane-IL-11R CHO cells. The secondary antibody used in the detection was a secondary antibody conjugated with a FITC fluorophore (Goat-anti-Fc-FITC) (Abcam, ab98529). The competitive binding results show that the neutralizing activity IC50 of the 3-6A4 antibody is about 7 μg/ml; the neutralizing activity IC50 of the 5-20E11-5F2 antibody is about 21 μg/ml, and the blocking activity of the candidate antibodies is significantly better than that of the 6D9A1 clone antibody, the results are shown in FIG. 2.

Example 11 Preferred Antibodies Inhibit the Transformation of Lung Fibroblasts HFL-1 into Fibrosis

[0163] As lung fibroblasts, HFL-1 cells were induced by pro-fibrotic factors such as TGF-beta1 and expressed a large amount of IL-11 cytokines, and finally transformed into fibrosis. When HFL-1 cells were transformed into fibrosis, the marker ACTA2 protein was accumulated continuously. In this example, when TGF-beta1 cytokine was used to induce HFL-1 cells to transform into fibrosis, the preferred antibodies 3-6-A4, 5-20E11-1A2 and 5-20E11-5F2 were added at the same time. After culturing for 48 h, the cells were harvested for western blot detection analysis. It can be seen that different concentrations of antibodies can inhibit the transformation of HFL-1 cells to fibrosis (the expression of ACTA2 protein was reduced), as shown in FIG. 3, FIG. 4 and the corresponding statistical analysis FIG. 5.

Example 12 Preferred Antibodies Inhibit Pulmonary Fibrosis in C57BL/6 Mice

[0164] In an animal model of pulmonary fibrosis in C57BL/6 mice induced by bleomycin, specifically, 10-week-old C57BL/6 was subjected to general anesthesia with pentobarbital anesthetic and the main trachea of the mouse lung was surgically exposed. Then an appropriate amount of bleomycin was injected into the trachea by instillation or nebulization. After seven days of bleomycin induction in mice, pulmonary fibrosis was basically appeared. On the eighth day, the preferred antibody 5-20E11-5F2 or the isotype control antibody IgG was injected every other day. After 14 days of continuous injection, the mice were sacrificed and the lungs were removed, and the inflammatory damage and fibrosis scores of the lungs were detected. Under this pharmacodynamic model, it can be seen that the candidate antibodies can slow down pulmonary fibrosis in mice, and the results are shown in FIGS. 6 and 7.

Example 13 Preferred Antibodies Inhibit Pulmonary Fibrosis in Sprague Dawley Rats

[0165] Intratracheal instillation of bleomycin in rats was a widely used pharmacodynamic model to study pulmonary fibrosis, the ability of the preferred antibodies to reduce bleomycin-induced unilateral pulmonary fibrosis in rats in vivo was tested in this experiment.

[0166] The male animals were divided into nine groups. The depth of anesthesia was maintained by 25 mg/kg pentobarbital sodium combined with 1-2.5% isoflurane respiratory anesthesia. The fibrosis groups were induced by tracheal injection of bleomycin, and in sham-operated group, the bleomycin was replaced by an equal volume of saline. On the eighth day of model establishment, different groups were treated with different doses of the preferred antibody for 14 days every other day, wherein pirfenidone (Esbriet) or nintedanib (Ofev) were used as the treatment reference (Esbriet and Ofev were both used 100 mg/kg/day). After the treatment, lungs were taken for immunohistochemical H&E staining and Masson's tri-staining. The histological examination of the rat lungs showed that the control group was normal. In the bleomycin-treated lungs, the inflammatory damage was significantly aggravated, and the preferred antibody could significantly alleviate the infiltration of inflammatory cells in the lungs, as shown in FIG. 8 (FIG. 8, H&E staining of lung tissue, A is the control group; B is the bleomycin-induced group; C is the 3-6A4 mAb-20 mg/kg group; D is the 5-20E11-5F2 mAb-20 mg/kg group). In addition, the preferred antibodies could also greatly alleviate the process of pulmonary fibrosis, as shown in FIG. 9 (FIG. 9, Masson's tri-staining of lung tissue, A is the control group; B is the bleomycin-induced group; C is the 3-6A4 mAb-20 mg/kg group; D is 5-20E11-5F2 mAb-20 mg/kg). The statistical analysis results show that the preferred antibodies can alleviate the inflammatory damage and fibrosis process of rat lung caused by bleomycin at different doses, as shown in FIG. 10 (FIG. 10, ###P<0.001 vs. BLM Model; aaP<0.01 vs. Ofev; bP<0.05 vs. Esbriet, bbbP<0.001 vs. Esbriet; cccP<0.001 vs. 3-6A4 mAb 30 mg/kg), FIG. 11 (***P<0.001 vs. Sham; ##P<0.01 vs. BLM Model, ###P<0.001 vs. BLM Model.).

Example 14 Humanization of IL-11 Antibody

[0167] The humanization of the IL-11 antibody in the above examples was carried out by complementarity determining region grafting (CDR grafting). Firstly, the human germline antibody sequence with the highest homology to the light and heavy chain variable regions of murine antibody was found. The germline selected for humanization of the heavy chain variable region of the antibody was IGHV1-46*01, IGKV3-11*01 was selected for humanization of the light chain variable region. The CDR region of the murine antibody was retained, and the framework sequence of the murine antibody was replaced with the framework sequence of the human germline antibody. Secondly, the structure model of the murine antibody Fv fragment was established, and BLAST was performed in the PDB antibody database, and the structure INQB was selected as the template for homology modeling. Each different amino acid position in the structural model of human antibody and the corresponding murine antibody was compared one by one, the amino acid that did not meet the FR structural specification, the amino acid located in the FR core, and the amino acid located at the VH-VL interface were selected and backmutated to murine sequences.

[0168] The sequences of the obtained heavy chain variable region and the light chain variable region of the IL-11 humanized antibody are shown in SEQ ID NO: 143-146 and SEQ ID NO: 147-150.

TABLE-US-00019 Sequence of IL-11 humanized antibody heavy chain  variable region (VH1): (SEQ ID NO: 143) QVQLVQSGAEVKKPGASVKVSCKASDYTFTNYWLGWVRQAPGQGLEWMGH IYPGGGYTNYNEKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARVR SGNDALDFWGQGTLVTVSS. Sequence of IL-11 humanized antibody heavy chain variable region (VH2): (SEQ ID NO: 144) QVQLVQSGAEVKKPGASVKVSCKASDYTFTNYWLGWVRQAPGQGLEWIGH IYPGGGYTNYNEKFKGRVTMTADTSTSTVYMELSSLRSEDTAVYFCARVR SGNDALDFWGQGTLVTVSS. Sequence of IL-11 humanized antibody heavy chain  variable region (VH3): (SEQ ID NO: 145) QVQLVQSGAEVKKPGASVKVSCKASDYTFTNYWLGWVRQAPGQGLEWIGH IYPGGGYTNYNEKFKGRATLTADTSTSTVYMELSSLRSEDTAVYFCARVR SGNDALDFWGQGTLVTVSS. Sequence of IL-11 humanized antibody heavy chain variable region (VH4): (SEQ ID NO: 146) QVQLVQSGAEVKKPGASVKVSCKASDYTFTNYWLGWVRQAPGHGLEWIGH IYPGGGYTNYNEKFKGRATLTADTSTSTVYMELSSLRSEDTAVYFCARVR SGNDALDFWGQGTLVTVSS. Sequence of IL-11 humanized antibody light chain variable region (VL1): (SEQ ID NO: 147) EIVLTQSPATLSLSPGERATLSCRASESVDEYGISFMNWYQQKPGQAPRL LIYSASNQGSGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSKEVPW TFGGGTKLEIK. Sequence of IL-11 humanized antibody light chain  variable region (VL2): (SEQ ID NO: 48) EIVLTQSPATLSLSPGERATLSCRASESVDEYGISFMNWYQQKPGQAPRL LIYSASNQGSGIPARFSGSGSGTDFTLTISSLEPEDFAVYFCQQSKEVPW TFGGGTKLEIK. Sequence of IL-11 humanized antibody light chain  variable region (VL3): (SEQ ID NO: 149) EIVLTQSPATLSLSPGERATLSCRASESVDEYGISFMNWFQQKPGQAPRL LIYSASNQGSGIPARFSGSGSGTDFTLTISSLEPEDFAVYFCQQSKEVPW TFGGGTKLEIK. Sequence of IL-11 humanized antibody light chain  variable region (VL4): (SEQ ID NO: 150) EIVLTQSPATLSLSPGERATLSCRASESVDEYGISFMNWFQQKPGQAPRL LIYSASNQGSGIPARFSGSGSGTDFTLTISSLEPEDFAMYFCQQSKEVPW TFGGGTKLEIK.

[0169] The nucleic acid sequences encoding the light chain and heavy chain of the IL-11 humanized antibody were synthesized and inserted into the eukaryotic expression vector pcDNA3.4. 4 heavy chain sequence vectors were paired respectively with 4 light chain sequence vectors and co-transfected into mammalian cells CHO for expression to obtain a single-chain antibody in the form of scFv. One week later, the supernatant containing the scFv antibodies were collected for affinity detection.

Example 15 Affinity Ranking of IL-11 Humanized Antibody

[0170] Biacore was used to measure the binding affinity of each humanized antibody supernatant scFv to IL-11, and sorted according to the dissociation constant kd (1/s), and three humanized antibodies with the smallest dissociation constant kd (1/s) were selected. The measure method included the steps of capturing the humanized antibody at a flow rate of 10 ul/min. The flow rate was switched to 30 ul/min, 400 nM of IL-11 antigen was flowed through the sample channel, the binding time was 180 s, and the dissociation time was 600 s. Finally the chip was regenerated with 10 mM glycine buffer. The results are shown in Table 7. The humanized antibodies VH1+VL2, VH1+VL3, VH1+VL4 dissociated from IL-11 at a slower rate than other humanized antibodies.

TABLE-US-00020 TABLE 7 Affinity of IL-11 Humanized Antibodies to IL-11 Antigen Rmax Ligand Analyte ka (1/Ms) kd (1/s) KD (M) (RU) Chi.sup.2 (RU.sup.2) BLANK(PBS) IL-11 NA NA NA NA NA 5-20E11-5F2 IL-11 5.84E+04 1.22E−04 2.09E−09 213.2 1.14E−01 NC(culture IL-11 NA NA NA NA NA medium) VH1 + VL1-scFv IL-11 3.51E+04 7.58E−04 2.16E−08 257.1 8.24E−01 VH1 + VL2-scFv IL-11 4.13E+04 4.61E−04 1.12E−08 247.2 5.66E−01 VH1 + VL3-scFv IL-11 3.55E+04 4.36E−04 1.23E−08 239.7 4.35E−01 VH1 + VL4-scFv IL-11 3.31E+04 3.87E−04 1.17E−08 268.7 3.92E−01 VH2 + VL1-scFv IL-11 5.34E+04 8.90E−04 1.67E−08 142.3 7.35E−01 VH2 + VL2-scFv IL-11 4.57E+04 8.12E−04 1.78E−08 208.9 7.67E−01 VH2 + VL3-scFv IL-11 4.56E+04 5.41E−04 1.19E−08 185.7 4.06E−01 VH2 + VL4-scFv IL-11 4.88E+04 5.28E−04 1.08E−08 174.5 4.64E−01 VH3 + VL1-scFv IL-11 4.45E+04 1.00E−03 2.25E−08 184.8 8.66E−01 VH3 + VL2-scFv IL-11 4.65E+04 6.80E−04 1.46E−08 184.4 4.71E−01 VH3 + VL3-scFv IL-11 4.76E+04 4.64E−04 9.76E−09 181.4 4.14E−01 VH3 + VL4-scFv IL-11 4.18E+04 5.56E−04 1.33E−08 219.5 5.76E−01 VH4 + VL1-scFv IL-11 4.89E+04 8.40E−04 1.72E−08 128.4 4.84E−01 VH4 + VL2-scFv IL-11 5.52E+04 6.14E−04 1.11E−08 135.9 4.22E−01 VH4 + VL3-scFv IL-11 4.61E+04 5.16E−04 1.12E−08 181.7 3.90E−01 VH4 + VL4-scFv IL-11 4.79E+04 4.81E−04 1.00E−08 147.6 2.54E−01

Example 16 Expression and Purification of Preferred IL-11 Humanized Antibodies

[0171] The preferred IL-11 humanized antibodies VH1+VL2, VH1+VL3, VH1+VL4 were respectively constructed with full-length sequences (including Fc part), and transfected into mammalian cells CHO for expression. After fermentation, the collected cell culture supernatants were purified by Protein A column, the balance buffer was 20 mM PBS, pH 7.4, and the eluent was 0.1M glycine pH 3.0±0.2, and the protein eluent under the target absorption peak was collected. After ultrafiltration with PBS buffer, part of the samples were taken to measure the concentration by HPLC and purity by SDS-PAGE electrophoresis detection.

Example 17 Affinity Detection of Preferred IL-11 Humanized Antibodies

[0172] The binding affinity of each preferred humanized full-length (IgG format) antibody sample to IL-11 was determined by Biacore. The measure method included the steps of capturing the humanized antibody at a flow rate of 10 ul/min. The flow rate was switched to 30 ul/min, and different concentrations of IL-11 antigen (400 nM, 200 nM, 100 nM, 50 nM, 25 nM, 12.5 nM, 6.25 nM) were flowed through the sample channel and reference channel, the binding time was 180 s, and the dissociation time was 600 s. Finally the chip was regenerated with 10 mM glycine buffer. As shown in Table 8, the affinity of the humanized antibody VH1+VL3 was better than that of the other two humanized antibodies, and slightly lower than that of the 5-20E11-5F2 antibody.

TABLE-US-00021 TABLE 8 Affinity of preferred humanized antibodies to IL-11 antigen Rmax Ligand Analyte ka (1/Ms) kd (1/s) KD (M) (RU) Chi.sup.2 (RU.sup.2) VH1 + VL2 IL-11 4.98E+04 5.97E−04 1.20E−08 114.1 4.03E−01 VH1 + VL3 IL-11 5.26E+04 4.74E−04 9.03E−09 105.6 3.71E−01 VH1 + VL4 IL-11 5.43E+04 5.45E−04 1.00E−08 63.26 1.25E−01 5-20E11-5F2 IL-11 6.76E+04 4.33E−04 6.41E−09 72.58 6.99E−02

Example 18 Competitively Blocking the Binding of IL-11 to IL-11R with Preferred Humanized Antibodies

[0173] To assess whether the preferred humanized antibodies could block the binding of IL-11 to IL-11R, a cell line (membrane-IL-11R CHO) that stably expressing IL-11R was constructed. The measure method included the following steps: IL-11-Fc protein with a concentration of 100 μg/ml was taken and added to a 96-well U-shaped plate with 10 ul/well, and incubated with 90 ul of serial dilutions of preferred humanized antibodies (100 ug/ml, 10 ug/ml, 1 ug/ml, 0.1 ug/ml, 0.01 ug/ml, 0.001 ug/ml) at room temperature for 1 h. Then the plate was incubated with 1.5*10{circumflex over ( )}5 membrane-IL-11R CHO cells (100 ul/well) for 1 h at room temperature. After incubation, the plate was centrifuged at 1500 rpm for 5 min, washed three times with PBS, and 1:400 diluted flow secondary antibody Goat-anti-Fc-FITC (Abcam, ab98529) was added with 200 ul/well. Then, the plate was incubated at 4° C. for 1 h, centrifuged at 1500 rpm for 5 min, washed three times with PBS, resuspended cells in 180 ul PBS, and detected by flow cytometry. The results are plotted as an S-curve as shown in FIG. 12. The results show that the blocking activity of the humanized antibody was basically the same as that of the 5-20E11-5F2 antibody.

TABLE-US-00022 TABLE 9 EC50 of humanized antibody competitively blocking the binding of IL-11 to IL-11R Antibody number 5-20E11-5F2 VH1 + VL2 VH1 + VL3 VH1 + VL4 EC50 (ug/ml) 7.537 11.57 10.46 12.48

Example 19 Preferred Humanized Antibodies Inhibit the Transformation of Hepatic Fibroblasts LX-2 to Fibrosis

[0174] LX-2 cells are human hepatic stellate cells, which can express a large amount of IL-11 cytokines when induced by pro-fibrotic factors such as TGF-beta1, and finally transform into fibrosis. When LX-2 cells transform into fibrosis, the marker ACTA2 protein will continue to accumulate. In this example, LX-2 cells were plated in a 6-well plate at a density of 3*10{circumflex over ( )}5 cells/well and cultured for 10 h until the cells adhered. After starvation in serum-free DMEM medium for 12 h, 5 ng/ml of TGF-beta1 cytokine was added for stimulation, and serial dilutions of preferred humanized antibodies (50 ug/ml, 25 ug/ml, 5 ug/ml) were added at the same time. After culturing for 24 h, the medium was taken, 200 ul of RIPA lysis solution (Biyuntian, P0013B) was added to each well for western blot analysis. The results show that different concentrations of humanized antibodies can inhibit the transformation of LX-2 cells into fibrosis (the expression of ACTA2 protein was decreased).

[0175] In the description of this specification, description with reference to the term “an embodiment,” “some embodiments,” “example,” “specific example,” or “some examples”, etc., means that a particular feature, structure, material, or characteristic described in connection with the embodiment or example is included in at least one embodiment or example of the present invention. In this specification, schematic representations of the above terms are not necessarily referring to the same embodiment or example of the present disclosure. Furthermore, the particular features, structures, materials, or characteristics may be combined in any suitable manner in one or more embodiments or examples. In addition, those skilled in the art can integrate and combine different embodiments, examples or the features of them as long as they are not contradictory to one another.

[0176] Although the embodiments of the present invention have been shown and described above, it would be appreciated that the above-mentioned embodiments are exemplary and should not be construed to limit the present disclosure, changes, alternatives, and modifications to the above-described embodiments may be made by those of ordinary skill in the art within the scope of the present invention.