Wound Healing Composition and Uses Thereof
20230257435 · 2023-08-17
Inventors
Cpc classification
A61L2300/412
HUMAN NECESSITIES
A61L15/60
HUMAN NECESSITIES
A61K9/06
HUMAN NECESSITIES
A61L15/42
HUMAN NECESSITIES
A61P17/02
HUMAN NECESSITIES
A61K9/0014
HUMAN NECESSITIES
A61L2300/252
HUMAN NECESSITIES
A61L27/54
HUMAN NECESSITIES
International classification
Abstract
The present disclosure provides a pharmaceutical composition comprising an Agrin fragment or derivative thereof, and uses of the pharmaceutical composition. The present disclosure also provides method of producing the pharmaceutical composition.
Claims
1. A pharmaceutical composition comprising an Agrin fragment or derivative thereof, wherein the Agrin fragment or derivative thereof comprises the LG3 domain of Agrin and an eight-amino-acid insert ELANEIPV (SEQ ID NO: 1) at the z-site of the LG3 domain.
2. The pharmaceutical composition of claim 1, wherein the LG3 domain of Agrin without any insert at the z-site comprises the sequence TABLE-US-00008 (SEQ ID NO: 5) EYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIV DGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAP VTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVV GRHPLHLLEDAVTKPELRPC.
3. The pharmaceutical composition of claim 1, wherein the Agrin fragment or derivative thereof comprises the sequence TABLE-US-00009 (SEQ ID NO: 7) DTLAFDGRTFVEYLNAVTESELANEIPVEKALQSNHFELSLRTEATQGL VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLR VVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGP ALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP.
4. The pharmaceutical composition of claim 1, wherein the Agrin fragment or derivative further comprises the LG2 domain of Agrin.
5. The pharmaceutical composition of claim 4, wherein the LG2 domain of Agrin without any insert at the y-site comprises the sequence TABLE-US-00010 (SEQ ID NO: 2) PFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQK TDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERN GRKGALRVGDGPRVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVS SGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPC.
6. The pharmaceutical composition of claim 4, wherein the Agrin fragment or derivative thereof comprises the sequence TABLE-US-00011 (SEQ ID NO: 8) LGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALE VVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIR SREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPVPHTVLNLKEPL YVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTS FAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSA GDVDTLAFDGRTFVEYLNAVTESELANEIPVEKALQSNHFELSLRTEAT QGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNR WLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELP VGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP.
7. The pharmaceutical composition of claim 1, wherein the Agrin fragment or derivative thereof is soluble.
8. A vector comprising the nucleic acid molecule encoding for an Agrin fragment or derivative thereof, wherein the Agrin fragment or derivative thereof comprises the LG3 domain of Agrin and an eight-amino-acid insert ELANEIPV (SEQ ID NO: 1) at the z-site of the LG3 domain.
9. A host cell comprising the vector of claim 8.
10. A hydrogel or scaffold comprising the pharmaceutical composition of claim 1.
11. The hydrogel of claim 10, wherein the hydrogel is an inert hydrogel or a thermoresponsive hydrogel.
12. (canceled)
13. A method of treating a wound, the method comprising administering a pharmaceutically effective amount of the pharmaceutical composition of claim 1 to a subject in need thereof.
14. (canceled)
15. The method of claim 13, wherein the wound is a slow healing wound or a non-healing wound.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] The invention will be better understood with reference to the detailed description when considered in conjunction with the non-limiting examples and the accompanying drawings, in which:
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION OF THE PRESENT INVENTION
[0036] The stages of wound healing proceed in an organized way and follow four processes: hemostasis, inflammation, proliferation and maturation. Hemostasis is the process of the wound being closed by clotting. Inflammation is the second stage of wound healing and it controls bleeding and prevents infection. Proliferation is when the wound is rebuilt with new tissue made up of collagen and extracellular matrix (ECM). The maturation phase is when collagen is remodeled from type III to type I and the wound fully closes. The proliferative phase comprises angiogenesis, fibroplasia and granulation tissue formation, collagen deposition, re-epithelialization, and contraction, and is the key phase of wound healing. Re-epithelialization is the key step in the proliferative phase. Keratinocytes are the main cells responsible for re-epithelialization. Activated keratinocytes at the wound edge migrate across the wound bed until the epithelial tongues meet at the wound center. From here, keratinocytes differentiate to form a new skin barrier. On epidermal wounding, keratinocytes at the wound edge undergo a transition from a non-motile epithelial state to a mesenchymal-like state, where they lose cell-cell contacts and become motile. Migrating cells reorganize their actin cytoskeleton and secrete proteases to remodel the ECM and enable migration across the wound. Directly behind the migrating cells, keratinocytes rapidly proliferate to provide enough cells to cover the wound. Non-healing wounds are characterized by defective keratinocyte migration, where, as a result, re-epithelialization fails to occur.
[0037] It has been shown in the present disclosure that Agrin expression is significantly triggered within the epidermal and dermal layers of skin upon mechanical injury, and that supplementing sAgrin (the C-terminus recombinant protein fragment of Agrin harboring the binding sites to its receptors Lipoprotein related receptor-4 (LRP4) and integrins) significantly rescued the wound healing and the migration of keratinocytes. Thus, in a first aspect, the present invention refers to a pharmaceutical composition comprising an Agrin fragment or derivative thereof, wherein the Agrin fragment or derivative thereof comprises the LG3 domain of Agrin and an eight-amino-acid insert ELANEIPV (SEQ ID NO: 1) at the z-site of the LG3 domain. The Agrin fragment or derivative thereof as defined above contains the binding site to Lipoprotein related receptor-4 (LRP4) and integrins.
[0038] In some examples, the Agrin fragment or derivative thereof further comprises the LG2 domain of Agrin.
[0039] Agrin is a large heparan proteoglycan with a molecular weight of 400-600 kDa. The protein core of Agrin consists of about 2000 amino acids with a mass of about 225 kDa. Agrin is a multidomain protein composed of 9 K (kunitz-type) domains, 2 LE (laminin-EGF-like) domains, one SEA (sperm protein, enterokinase and agrin) domain, 4 EG (epidermal growth factor-like) domains and 3 LG (laminin globular) domains. Agrin exists in several splice variants and can be expressed as a secreted protein, containing the N-terminal NtA (N-terminal Agrin) domain, which is the most abundant form of Agrin. The C-terminal, 75 kDa moiety of Agrin starts with the first EG domain. Several binding sites for interaction partners of Agrin, including α-dystroglycan, heparin, some integrins and LRP4 are mapped to the C-terminal region. In the C-terminal part of human Agrin, there are two alternative splice sites y and z. The y-site is located within the LG2 domain, and the z-site is located within the LG3 domain. At the y-site, there may be inserts of 0, 4, 17 or 21 (4+17) amino acids; and at the z-site, there may be inserts of 0, 8, 11 or 19 (8+11) amino acids.
[0040] Lipoprotein receptor-related protein 4 (LRP-4), also known as low-density lipoprotein receptor-related protein 4, is a protein that in humans is encoded by the LRP4 gene. LRP-4 is a member of the Lipoprotein receptor-related protein family and may be a regulator of Wnt signaling.
[0041] Integrins are transmembrane receptors that facilitate cell-cell and cell-ECM adhesion. Upon ligand binding, integrins activate signal transduction pathways that mediate cellular signals such as regulation of the cell cycle, organization of the intracellular cytoskeleton, and movement of new receptors to the cell membrane. The presence of integrins allows rapid and flexible responses to events at the cell surface.
[0042] The terms “LG2” and “LG3” as used herein refers to the second and third laminin globular domains of Agrin. LG2 and LG3 shall encompass all possible different splice variations of these domains. In one example, the LG2 domain of Agrin without any insert at the y-site has the sequence PFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDF VSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRV LGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEH VLRQVDVTSFAGHPC (SEQ ID NO: 2). In one example, the LG2 domain of Agrin having an insert of 4 amino-acids at the y-site has the sequence of PFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDF VSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRV LGESPVPKSRKHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLL TPEHVLRQVDVTSFAGHPC (SEQ ID NO: 3), with the sequence of the insert being KSRK (SEQ ID NO: 4). In the above mentioned LG2 domain, the y-site starts at P (proline) 119. In one example, the Agrin fragment or derivative as described herein comprises the LG2 domain of Agrin without any insert at the y-site. In one example, the LG3 domain of Agrin without any insert at the z-site has the sequence EYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQLS YNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDT DGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPC (SEQ ID NO: 5). In another example, the LG3 domain of Agrin having an insert of 8 amino-acids at the z-site has the sequence of EYLNAVTESELANEIPVEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIV DGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPL GATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVT KPELRPC (SEQ ID NO: 6), with the sequence of the insert being ELANEIPV (SEQ ID NO: 1). In the above mentioned LG3 domain, the z-site is between S (serine) 9 and E (glutamic acid) 10. In some examples, the Agrin fragment or derivative thereof comprising the LG3 domain of Agrin and an eight-amino-acid insert at the z-site of the LG3 domain has the following sequence:
TABLE-US-00001 (SEQ ID NO: 7) DTLAFDGRTFVEYLNAVTESELANEIPVEKALQSNHFELSLRTEATQGL VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLR VVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELPVGP ALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP.
[0043] In some examples, the Agrin fragment or derivative thereof comprising the LG2 and LG3 domains of Agrin and an eight-amino-acid insert at the z-site of the LG3 domain has the following sequence:
TABLE-US-00002 (SEQ ID NO: 8) LGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALE VVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIR SREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPVPHTVLNLKEPL YVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTS FAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEKGLVEKSA GDVDTLAFDGRTFVEYLNAVTESELANEIPVEKALQSNHFELSLRTEAT QGLVLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNR WLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLPELP VGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDAVTKPELRPCPTP.
[0044] As additional variations of sequence which do not affect the biological activity are possible, the invention shall not be limited to the indicated sequences of the different splice variants of the domains LG2 and LG3. In some examples, the Agrin fragment or derivative thereof comprises sequences which have at least about 60%, or at least about 65%, or at least about 70%, or at least about 75%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity as the exemplary LG2 and/or LG3 domain sequences as provided herein.
[0045] The term “derivative” as used herein refers to a polypeptide that has been derived from the basic sequence by modification, including amino acid deletions or additions to polypeptides or variants and modification to side chains, where the derivative retains the activity of the basic protein. The resulting derivative will retain at least about at least about 60%, or at least about 65%, or at least about 70%, or at least about 75%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% homology with the basic sequence of the original polypeptide. The derivative will also exhibit a qualitatively similar effect to the unmodified polypeptide.
[0046] In some examples, the Agrin fragment or derivative thereof additionally includes at least one further domain naturally occurring in Agrin, including but not limited to, the LG1 and EGF-like domains EG1-4. Exemplary sequences of LG1 and EG1-4 domains are as follows:
TABLE-US-00003 LG1 domain: (SEQ ID NO: 9) APVPAFEGRSFLAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDF LALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLS VDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRG CIRLLDVNNQRLELGIGPGAATRGSGVGEC. EG1 domain: (SEQ ID NO: 10) PPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCE. EG2 domain: (SEQ ID NO: 11) GDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCA. EG3 domain: (SEQ ID NO: 12) EKSPCQPNPCHGAAPCRVLPEGGAQCECPLGREGTFCQ. EG4 domain: (SEQ ID NO: 13) AGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCE.
[0047] Agrin fragments or derivatives thereof can be obtained by usual recombinant engineering which is well known in the art and exemplified in the working examples of the present disclosure. In summary, nucleic acid molecules encoding for the Agrin fragment or derivative thereof is expressed in suitable expression systems and the resulting protein is subsequently purified. Thus, in some examples, there are provided a nucleic acid molecule encoding for the Agrin fragment or derivative thereof as disclosed herein. In one example, the nucleic acid molecule encoding for the Agrin fragment or derivative thereof comprising the LG3 domain and the 8 amino acid insert at the z-site has the following sequence: CATATGGACACCCTGGCGTTCGATGGTCGTACCTTTGTTGAGTACCTGAACGCGG TGACCGAGAGCGAACTGGCGAACGAGATCCCGGTTGAAAAGGCGCTGCAGAGC AACCACTTCGAGCTGAGCCTGCGTACCGAAGCGACCCAAGGTCTGGTGCTGTGG AGCGGCAAAGCGACCGAACGTGCGGACTACGTTGCGCTGGCGATTGTGGATGGT CACCTGCAGCTGAGCTATAACCTGGGCAGCCAACCGGTGGTTCTGCGTAGCACC GTTCCGGTGAACACCAACCGTTGGCTGCGTGTGGTTGCGCACCGTGAGCAGCGTG AAGGTAGCCTGCAAGTTGGCAACGAAGCGCCGGTGACCGGTAGCAGCCCGCTGG GTGCGACCCAGCTGGACACCGATGGTGCGCTGTGGCTGGGTGGCCTGCCGGAAC TGCCGGTTGGTCCGGCGCTGCCGAAGGCGTATGGTACCGGCTTTGTGGGTTGCCT GCGTGACGTGGTTGTTGGTCGTCACCCGCTGCACCTGCTGGAGGATGCGGTTACC AAACCGGAACTGCGTCCGTGCCCGACCCCGTAAGGATCC (SEQ ID NO: 14). In one example, the nucleic acid molecule encoding for the Agrin fragment or derivative thereof comprising the LG2 domain, the LG3 domain and the 8 amino acid insert at the z-site has the following sequence:
TABLE-US-00004 (SEQ ID NO: 15) CATATGCTGGGTCGTGAGGGCACCTTCTGCCAAACCGCGAGCGGTCAAG ATGGTAGCGGTCCGTTTCTGGCGGATTTCAACGGTTTTAGCCACCTGGA ACTGCGTGGCCTGCACACCTTCGCGCGTGACCTGGGCGAGAAGATGGCG CTGGAAGTGGTTTTTCTGGCGCGTGGTCCGAGCGGTCTGCTGCTGTACA ACGGCCAGAAGACCGACGGTAAAGGCGATTTCGTTAGCCTGGCGCTGCG TGACCGTCGTCTGGAGTTTCGTTATGATCTGGGTAAAGGTGCTGCGGTT ATTCGTAGCCGTGAGCCGGTGACCCTGGGTGCGTGGACCCGTGTGAGCC TGGAACGTAACGGTCGTAAGGGTGCGCTGCGTGTTGGTGATGGTCCGCG TGTGCTGGGCGAGAGCCCGGTTCCGCACACCGTGCTGAACCTGAAGGAA CCGCTGTACGTTGGTGGCGCGCCGGACTTCAGCAAGCTGGCGCGTGCGG CGGCGGTTAGCAGCGGTTTTGATGGCGCGATTCAGCTGGTTAGCCTGGG TGGCCGTCAACTGCTGACCCCGGAGCACGTGCTGCGTCAAGTTGACGTT ACCAGCTTTGCGGGTCACCCGTGCACCCGTGCGAGCGGTCATCCGTGCC TGAACGGTGCGAGCTGCGTTCCGCGTGAAGCGGCGTACGTGTGCCTGTG CCCGGGTGGCTTTAGCGGTCCGCACTGCGAGAAGGGTCTGGTGGAGAAG AGCGCGGGTGACGTGGATACCCTGGCGTTCGATGGCCGTACCTTTGTTG AGTATCTGAACGCGGTGACCGAGAGCGAACTGGCGAACGAGATCCCGGT TGAAAAGGCGCTGCAGAGCAACCACTTCGAGCTGAGCCTGCGTACCGAA GCGACCCAAGGTCTGGTGCTGTGGAGCGGCAAAGCGACCGAACGTGCGG ACTACGTTGCGCTGGCGATTGTGGATGGTCACCTGCAGCTGAGCTATAA CCTGGGCAGCCAACCGGTGGTTCTGCGTAGCACCGTTCCGGTGAACACC AACCGTTGGCTGCGTGTGGTTGCGCACCGTGAGCAGCGTGAAGGTAGCC TGCAAGTTGGCAACGAAGCGCCGGTGACCGGTAGCAGCCCGCTGGGTGC GACCCAGCTGGACACCGATGGTGCGCTGTGGCTGGGTGGCCTGCCGGAA CTGCCGGTTGGTCCGGCGCTGCCGAAGGCGTATGGTACCGGCTTTGTGG GTTGCCTGCGTGACGTGGTTGTTGGTCGTCACCCGCTGCACCTGCTGGA GGATGCGGTTACCAAACCGGAACTGCGTCCGTGCCCGACCCCGTAAGGA TCC.
[0048] In some examples, there are provided a vector comprising the nucleic acid molecule encoding for the Agrin fragment or derivative thereof as disclosed herein. The term “vector” as used herein includes vectors which can be used to express DNA sequences contained therein, where such DNA sequences are operably linked to other sequences capable of effecting their expression (e.g., promotor/operator sequences). In general, expression vectors of utility in recombinant DNA techniques are often in the form of “plasmids” which refer to circular double stranded DNA loops which in their vector form, are not bound to the chromosome. Various expression vectors known in the art can be used to obtain a vector comprising the nucleic acid molecule encoding for the Agrin fragment or derivative thereof as disclosed herein, including but are not limited to, bacterial expression vectors such as pET28, pUC19, pBR327, pBR322, pET3a, pEXP4-DEST, pSP72, pET SUMO, pBAD TOPO, pGEX-4T2, pQE-30 and pACYC177 vectors, and mammalian expression vectors such as pACT, pBIND, pG5luc, pTNT, pTarget, pReg neo, pCat3-Basic, pSI, pcDBA and pCMV vectors. In one example, the expression vector is a pET28 vector. In one specific example, the expression vector is a pET28 vector containing His-tag.
[0049] The present disclosure also provides host cells comprising the vector comprising the nucleic acid molecule encoding for the Agrin fragment or derivative thereof as disclosed herein. Several prokaryotic and eukaryotic expression systems are suitable for the production of the Agrin fragment or derivative thereof as disclosed herein. Prokaryotic expression systems include, but are not limited to, expression in Escherichia coli (E. coli). Eukaryotic expression systems include expression in mouse myeloma cells, baculovirus-mediated expression in insect cells, as well as expression in human embryonic kidney (HEK) cells, transient expression in Chinese hamster ovary (CHO) cells and stable expression in Pichia pastoris. These systems have the advantage that they can easily be adapted to serum-free conditions to reduce the amount of contaminating proteins in the supernatant and can be adapted for large scale production. In addition, a variety of cell lines may be used, including HEK293T and HEK293-cells, COS cells, CHO cells, HeLa cells, H9 cells, Jurkat cells, NIH3T3 cells, C127 cells, CV1 cells, CAP cells or SF cells. Thus, in one example, the present disclosure provides a host cell comprising the vector comprising the nucleic acid molecule encoding for the Agrin fragment or derivative thereof as disclosed herein. In one specific example, the host cell is an E. coli cell. The present disclosure also provides a method of producing the Agrin fragment or derivative thereof as disclosed herein, the method comprising culturing the host cells as disclosed herein to express the Agrin fragment or derivative thereof, and harvesting the Agrin fragment or derivative thereof produced. In some examples, the method further comprises purification of the Agrin fragment or derivative thereof obtained.
[0050] For the purification of the Agrin fragment or derivative thereof obtained, standard protein purification technologies can be applied. His-tagged protein can be purified using IMAC, and ion exchange chromatography or affinity purification using a heparin column can be used as well. Purification via an antibody raised against the C-terminal part of Agrin can also be used. The eluted protein can then further be purified using, for example, a hydroxyapatite column or by gel filtration.
[0051] Agrin fragment or derivative thereof as disclosed in the present application can be in either the secreted or transmembraneous form. In some examples, Agrin fragment or derivative thereof is in the secreted form. In some examples, the Agrin fragment or derivative thereof is soluble.
[0052] The Agrin fragment or derivative thereof as disclosed in the present application can be of any origin. In some examples, the Agrin fragment or derivative thereof is derived from human, non-human primates, mouse, rat, hamster, rabbit, goat or other mammalian species. In some specific examples, the Agrin fragment or derivative thereof is derived from human or mouse.
[0053] In some examples, the pharmaceutical compositions disclosed herein comprise about 0.01% to about 25%, or about 0.01% to about 10%, or about 0.03% to about 1%, or about 0.03% to about 5%, or about 1% to about 10% w/v, or about 6%, 8%, 10%, 15% or 20% w/v of Agrin fragment or derivative thereof.
[0054] In some examples, the pharmaceutical compositions disclosed herein further comprise other active agents acting synergistically on the wound for the promotion of wound healing or wound closure or the treatment of non-healing wounds.
[0055] In some examples, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier and/or other pharmaceutically acceptable inert agents.
[0056] The term “pharmaceutically acceptable” as used herein refers to ingredients, agents, or compositions that are suitable for pharmaceutical administration without undue toxicity, incompatibility, instability, irritation, allergic response and the like.
[0057] The term “carrier” as used herein refers to diluents, adjuvants, excipients, vehicles, and other inert agents with which the Agrin fragment or derivative thereof is administered.
[0058] Examples of pharmaceutically acceptable carriers include but are not limited to sugars, starches, cellulose, excipients, oils, glycols, polyols, esters, agar, and buffering agents. The above are non-limiting examples of carriers. Pharmaceutically acceptable carriers may be easily formulated by those of ordinary skill in the art.
[0059] Examples of excipients include but are not limited to, solvents, emollients and/or emulsifiers, oil bases, preservatives, antioxidants, tonicity adjusters, penetration enhancers and solubilizers, chelating agents, buffering agents, surfactants, one or more polymers, and combinations thereof. Suitable solvents for an aqueous or hydrophilic topical formulation include water; ethyl alcohol; isopropyl alcohol; mixtures of water and ethyl and/or isopropyl alcohols; glycerin; ethylene, propylene or butylene glycols; DMSO; and mixtures thereof. Suitable solvents for a hydrophobic topical formulation include mineral oils, vegetable oils, and silicone oils. If desired, the pharmaceutical composition as described herein may be dissolved or dispersed in a hydrophobic oil phase, and the oil phase may then be emulsified in an aqueous phase comprising water, alone or in combination with lower alcohols, glycerin, and/or glycols. Suitable emollients include hydrocarbon oils and waxes such as mineral oil, petrolatum, paraffin, ceresin, ozokerite, microcrystalline wax, polyethylene, squalene, perhydrosqualene, silicone oils, triglyceride esters, acetoglyceride esters, such as acetylated monoglycerides; ethoxylated glycerides, such as ethoxylated glyceryl monostearate; alkyl esters of fatty acids or dicarboxylic acids. Suitable silicone oils for use as emollients include dimethyl polysiloxanes, methyl(phenyl) polysiloxanes, and water-soluble and alcohol-soluble silicone glycol copolymers. Suitable triglyceride esters for use as emollients include vegetable and animal fats and oils including castor oil, safflower oil, cotton seed oil, corn oil, olive oil, cod liver oil, almond oil, avocado oil, palm oil, sesame oil, and soybean oil. Suitable esters of carboxylic acids or diacids for use as emollients include methyl, isopropyl, and butyl esters of fatty acids. Specific examples of alkyl esters including hexyl laurate, isohexyl laurate, iso-hexyl palmitate, isopropyl palmitate, decyl oleate, isodecyl oleate, hexadecyl stearate, decyl stearate, isopropyl isostearate, dilauryl lactate, myristyl lactate, and cetyl lactate; and alkenyl esters of fatty acids such as oleyl 5 myristate, oleyl stearate, and oleyl oleate. Specific examples of alkyl esters of diacids include diisopropyl adipate, diisohexyl adipate, bis(hexyldecyl) adipate, and diisopropyl sebacate. Other suitable classes of emollients or emulsifiers which may be used in topical formulations include fatty acids, fatty alcohols, fatty alcohol ethers, ethoxylated fatty alcohols, fatty acid esters of ethoxylated fatty alcohols, and waxes. Specific examples of fatty acids for use as emollients include pelargonic, lauric, myristic, palmitic, stearic, isostearic, hydroxystearic, oleic, linoleic, ricinoleic, arachidic, behenic, and erucic acids. Specific examples of fatty alcohols for use as emollients include lauryl, myristyl, cetyl, hexadecyl, stearyl, isostearyl, hydroxystearyl, oleyl, ricinoleyl, behenyl, and erucyl alcohols, as well as 2-octyl dodecanol. Specific examples of waxes suitable for use as emollients include lanolin and derivatives thereof, including lanolin oil, lanolin wax, lanolin alcohols, lanolin fatty acids, isopropyl lanolate, ethoxylated lanolin, ethoxylated lanolin alcohols, ethoxolated cholesterol, propoxylated lanolin alcohols, acetylated lanolin, acetylated lanolin alcohols, lanolin alcohols linoleate, lanolin alcohols recinoleate, acetate of lanolin alcohols recinoleate, acetate of lanolin alcohols recinoleate, acetate of ethoxylated alcohols esters, hydrogenolysates of lanolin, hydrogenated lanolin, ethoxylated hydrogenated lanolin, ethoxylated sorbitol lanolin, and liquid and semisolid lanolin. Also usable as waxes include hydrocarbon waxes, ester waxes, and amide waxes. Useful waxes include wax esters such as beeswax, spermaceti, myristyl myristate and stearyl stearate; beeswax derivatives, e.g., polyoxyethylene sorbitol beeswax; and vegetable waxes including carnauba and candelilla waxes. Polyhydric alcohols and polyether derivatives may be used as solvents and/or surfactants in topical formulations. Suitable polyhydric alcohols and polyethers include propylene glycol, dipropylene glycol, polypropylene glycols 2000 and 4000, poly(oxyethylene co-oxypropylene) glycols, glycerol, sorbitol, ethoxylated sorbitol, hydroxypropylsorbitol, polyethylene glycols 200-6000, methoxy polyethylene glycols 350, 550, 750, 2000 and 5000, poly[ethylene oxide] homopolymers (100,000-5,000,000), polyalkylene glycols and derivatives, hexylene glycol, 2-methyl-2,4-pentanediol, 1,3-butylene glycol, 1,2,6-hexanetriol, 2-ethyl-1,3-15 hexanediol, vicinal glycols having 15 to 18 carbon atoms, and polyoxypropylene derivatives of trimethylolpropane. Polydydric alcohol esters may be used as emulsifiers or emollients. Suitable polydydric alcohol esters include ethylene glycol mono- and di-fatty acid esters, diethylene glycol mono- and di-fatty acid esters, polyethylene glycol (200-6000) mono- and di-fatty acid esters, propylene glycol mono- and di-fatty esters, polypropylene glycol 2000 monooleate, polypropylene glycol 2000 monostearate, ethoxylated propylene glycol monostearate, glyceryl mono- and di-fatty acid esters, polyglycerol poly-fatty acid esters, ethoxylated glyceryl monostearate, 1,3-butylene glycol monostearate, 1,3-butylene glycol distearate, polyoxyethylene polyol fatty acid ester, sorbitan fatty acid esters, and polyoxyethylene sorbitan fatty acid esters. Suitable emulsifiers for use in topical formulations include anionic, cationic, nonionic, and zwitterionic surfactants. Preferred ionic emulsifiers include phospholipids, such as lecithin and derivatives. Lecithin and other phospholipids may be used to prepare liposomes containing the composition as described herein. Formation of lipid vesicles occurs when phospholipids such as lecithin are placed in water and consequently form one bilayer or a series of bilayers, each separated by water molecules, once enough energy is supplied. Liposomes can be created by sonicating phospholipids in water. Low shear rates create multilamellar liposomes. Continued high-shear sonication tends to form smaller unilamellar liposomes. Hydrophobic chemicals can be dissolved into the phospholipid bilayer membrane. The lipid bilayers of the liposomes deliver the composition as described herein to keratinocytes by fusing with the cell membrane of the keratinocytes. Sterols including, for example, cholesterol and cholesterol fatty acid esters; amides such as fatty acid amides, ethoxylated fatty acid amides, and fatty acid alkanolamides may also be used as emollients and/or penetration enhancers. Suitable viscosity enhancers or thickeners which may be used to prepare a viscous gel or cream with an aqueous base include sodium polyacrylate, xanthan gum, polyvinyl pyrollidone, acrylic acid polymer, carrageenans, hydroxyethyl cellulose, hydroxypropyl cellulose, methyl cellulose, ethyl cellulose, propyl cellulose, hydroxypropyl methyl cellulose, polyethoxylated polyacrylamides, polyethoxylated acrylates, and polyethoxylated alkane thiols. Suitable preservatives and/or antioxidants for use in topical formulations include benzalkonium chloride, benzyl alcohol, phenol, urea, parabens, butylated hydroxytoluene (BHT), butylated hydroxyanisole 5 (BHA), Tocopherol, and mixtures thereof. Suitable chelating agents for use in topical formulations include ethylene diamine tetraacetic acid, alkali metal salts thereof, alkaline earth metal salts thereof, ammonium salts thereof, and tetraalkyl ammonium salts thereof. The carrier preferably has a pH of between about 4.0 and 10.0, more preferably between about 6.8 and about 7.8. The pH may be controlled using buffer solutions or other pH modifying agents. Suitable pH modifying agents include phosphoric acid and/or phosphate salts, citric acid and/or citrate salts, hydroxide salts (i.e., calcium hydroxide, sodium hydroxide, potassium hydroxide) and amines, such as triethanolamine. Suitable buffer solutions include a buffer comprising a solution of monopotassium phosphate and dipotassium phosphate, maintaining a pH of between 5.8 and 8; and a buffer comprising a solution of monosodium phosphate and disodium phosphate, maintaining a pH of between 6 and 7.5. Other buffers include citric acid/sodium citrate, and dibasic sodium phosphate/citric acid.
[0060] The pharmaceutical compositions disclosed herein may additionally comprise conventional adjuvants such as propionic acid, propylene glycol, conventional buffers, preservatives, hydrophilic emulsifiers, lipophilic emulsifiers, perfumes, emollients, deodorants, humectants and the like. Colorants may also optionally be added in the compositions disclosed herein. Adjuvants which would be harmful to a wound or surrounding skin should be avoided, as well as those adjuvants which may react with and/or adversely reduce the effectiveness of the pharmaceutical composition.
[0061] The pharmaceutical compositions disclosed herein may be formulated into a wide variety of articles to be topically applied that include but are not limited to lotions, creams, gels, sticks, sprays, ointments, emulsions, pastes, foams, powders and film-forming products. Such pharmaceutical compositions may be formulated for time-controlled release. If the pharmaceutical composition is formulated into an emulsion, the emulsion may have a continuous aqueous phase and a discontinuous non-aqueous or oil phase (oil-in-water emulsion), or a continuous non-aqueous or oil phase and a discontinuous aqueous phase (water-in-oil emulsion).
[0062] In some examples, the pharmaceutical composition as disclosed herein further comprises one or more preservatives. Examples of preservatives include, but are not limited to chelators such as EDTA, diethylene triamine pentaacetic acid (DTPA), and catechins; sodium benzoate; potassium sorbate; and sodium nitrate. The compositions may comprise about 0.01% to about 5%, or about 0.1% to about 3%, or about 0.015% to about 1%, or about 0.015% to about 0.5%, or about 0.01% to about 0.1%, or about 0.0225% to about 0.1% w/v or about 0.015%, 0.225%, or 0.1% w/v of preservatives.
[0063] The compositions provided herein may further comprise one or more antimicrobial agents. The antimicrobial agents can act to counter any bacterial protease activity that may hamper the healing environment, which allows a wound to progress towards an optimal healing state. Examples of antimicrobial agents include, but are not limited to, components of aloe vera, ashitaba, bacteriophage, beta-defensin, quaternary ammonium compound, chlorhexidine, copper, dispersin B, essential oil, gentamicin, lactoferrin, lysostaphin, N-halamines, nitric oxide, oleic acid, PLUNC, polyhexanide biguanide (PHMB), bacteriocin, selenium, silver compound, triclosan, zinc, and combinations thereof. Aloe vera contains numerous photochemical compounds including but not limited to tannin, saponin, flavonoids, and fumaric acid. As used herein, the term “PLUNC” refers to the gene or clone encoding the palate, lung, nasal epithelium carcinoma associated protein and to the protein itself. Examples of quaternary ammonium compound include benzethonium chloride and benzalkonium chloride. An example of a beta-defensin is cathelicidin (LL-37). Examples of a silver compound may include colloidal silver, ionic silver, nonionic silver, silver chloride, silver nanoparticles, and silver sulfadiazine. Examples of essential oil include but are not limited to cinnamon oil, clove oil, eucalyptus oil, and tea tree oil. An example of chlorhexidine is chlorhexidine gluconate. The compositions may comprise about 0.01% to about 1%, or about 0.05% to about 1%, or about 0.05% to about 0.5% w/v of antimicrobial agents.
[0064] The pharmaceutical compositions disclosed herein may further comprise other agents such as growth factors, cytokines, and proteinase inhibitors. Examples of growth factors include but are not limited to, epidermal growth factor (EGF), transforming growth factor-α (TGF-α), platelet derived growth factor (PDGF), fibroblast growth factors (FGFs) including acidic fibroblast growth factor (α-FGF) and basic fibroblast growth factor (β-FGF), transforming growth factor-β (TGF-β) and insulin like growth factors (IGF-1 and IGF-2), and combination thereof.
[0065] In some examples, the pharmaceutical composition as disclosed herein may be infused within, injected into, absorbed by, layered on, encapsulated within, or coated on, a carrier material, such as a bandage, gauze, wound dressing, adhesive bandage, scaffold, or hydrogel. The carrier material may be either bioresorbable, for instance comprising polyglycolic acid, polylactic acid, polydioxanone, polyhydroxybutyrate, polyhydrozyvalerate, polyaminoacids polyorthoesters, polyvinly alcohol, collagen, gelatin, chitosan, oxidized regenerated cellulose, hyaluronic acid, alginate or derivatives thereof, or may be non-bioresorbable, comprising for instance, polyurethane, polyvinyl alcohol, or gauze. Carrier materials are distinct from the carriers and pharmaceutically acceptable carriers used in the pharmaceutical compositions.
[0066] Examples of suitable carrier materials include, but are not limited to: bandages, gauze, wound dressings, adhesive bandages, scaffold, hydrogels, in particular hydrogels containing cellulose derivatives, including hydroxyethyl cellulose, hydroxymethyl cellulose, carboxymethyl cellulose, hydroxypropylmethyl cellulose and mixtures thereof; and hydrogels containing polyacrylic acid as well as gelatin. The above carrier materials may include alginate (as a thickener or stimulant), buffers to control pH such as disodium hydrogen phosphate/sodium dihydrogen phosphate, agents to adjust osmolarity such as sodium chloride, and stabilizers such as EDTA.
[0067] In some specific examples, the carrier material is a hydrogel or a scaffold.
[0068] The term “hydrogel” as used herein refers to a three-dimensional (3D) network of hydrophilic polymers. Hydrogels can generally absorb a large amount of fluid and while maintaining the structure due to chemical or physical cross-linking of individual polymer chains. In equilibrium, hydrogels are typically 60-90% fluid and only 10-30% polymer. In some examples, the water content of a hydrogel is approximately 70-80%. Hydrogels are particularly useful because of the inherent biocompatibility of the crosslinked polymer network. Hydrogels can be prepared by crosslinking hydrophilic biopolymers or synthetic polymers. Examples of hydrogels formed by physical or chemical crosslinking of hydrophilic biopolymers include, but are not limited to, hyaluronans, chitosans, alginates, collagen, dextran, pectin, carrageenan, polylysine, gelatin, or agarose. These materials consist of high molecular weight framework chains made with linear or branched polysaccharides or polypeptides.
[0069] Hydrogels closely resemble the natural living extracellular matrix. Hydrogels can also be made to be degradable in vivo by incorporating PLA, PLGA, or PGA polymers. Furthermore, hydrogels can be modified with fibronectin, laminin, vitronectin, or, for example, with RGD for surface modification, which can promote cell adhesion and proliferation. Furthermore, alteration of molecular weights, block structures, degradable linkages, and crosslinking modes can influence the strength, elasticity, and degradation properties of hydrogels.
[0070] Hydrogels can also be modified with functional groups for the covalent attachment of a variety of proteins (eg, collagen) or compounds such as therapeutic agents. Therapeutic agents that can bind to the matrix include, but are not limited to, analgesics, anesthetics, antifungals, antibiotics, anti-inflammatories, anthelmintics, antidotes, antiemetics, antihistamines, antihypertensives, antimalarials, antimicrobials, antipsychotics, antipyretics, antiseptics, anti-arrhythmic, antituberculous, antitussive, antiviral, cardioactive, cathartic, chemotherapeutic agents, a colored or fluorescent imaging agent, corticosteroids (such as steroids), antidepressants, depressants, diagnostic aids, diuretics, enzymes, expectorants, hormones, hypnotics, minerals, nutritional supplements, parasympathomimetics, potassium supplements, radiation sensitizers, a radioisotope, sedatives, sulfonamides, stimulants, sympathomimetics, tranquilizers, urinary antiinfectives, vasoconstrictors, vasodilators, vitamins, xanthine derivatives, and the like. The therapeutic agent may also be other small organic molecules, naturally isolated entities or their analogues, organometallic agents, chelated metals, or metal salts, peptide-based drugs, or binding or targeting agents to a peptide or non-peptide receptor. Molecules that can be incorporated into the hydrogel matrix include, but are not limited to, vitamins and other nutritional supplements; glycoproteins (eg, collagen); fibronectin; peptides and proteins, carbohydrates (both simple and complex); proteoglycans; antigens; oligonucleotides (sense and antisense DNA and/or RNA); antibodies (for example, against infectious agents, tumors, drugs, or hormones); and gene therapy reagents.
[0071] A number of classifications of hydrogels have been reported. For example, hydrogels can be divided into those formed from natural polymers and those formed from synthetic polymers. Depending on the ionic charges on the bound groups, hydrogels may be cationic, anionic, or neutral. Hydrogels can also be classified as inert, physical, chemical, or biochemical hydrogels. Inert hydrogels are inactive to normal chemical or biological processes, and they are resistant to degradation, and not absorbed by the body. Physical hydrogels can undergo a transition from liquid to a gel in response to a change in environmental conditions such as temperature, ionic concentration, pH, or other conditions such as mixing of two components. Chemical hydrogels use covalent bonding that introduces mechanical integrity and degradation resistance compared to other weak materials. In biochemical hydrogels, biological agents like enzymes or amino acids participate in the gelation process. It is also possible to divide hydrogels into groups based on their structure: amorphous, semicrystalline, crystalline, and hydrocolloid aggregates.
[0072] In some examples, the hydrogel is an inert hydrogel. In some other examples, the hydrogel is physical hydrogel, in particular a thermoresponsive hydrogel. Thermoresponsive hydrogels use temperature as external stimulus to show solution-gel transition and most of the thermoresponsive polymers can form hydrogels around body temperature. Various inert and thermoresponsive hydrogels are commercially available. For example, Vaseline is an inert hydrogel, and Pluronic F-127 is a thermoresponsive hydrogel.
[0073] A scaffold may be infused with, coated with, or comprised of cells, growth factors, extracellular matrix components, nutrients, integrins, or other substances to promote cell growth. The scaffold may also serve as a carrier material for the pharmaceutical composition disclosed herein. Scaffolds may be formed from biologic or synthetic scaffold materials, and are used in the field of tissue engineering to support protein adhesion and cellular ingrowth for tissue repair and regeneration. The current state of the art in scaffold technology relies upon the inherent characteristics of the surrounding tissue space for the adsorption of proteins and migration of cells. Nonlimiting examples of suitable scaffold materials include extracellular matrix proteins such as fibrin, collagen or fibronectin, and synthetic or naturally occurring polymers, including bioabsorbable or non-absorbable polymers, such as polylactic acid (PLA), polyglycolic acid (PGA), polylactide-co-glycolide (PLGA), polyvinylpyrrolidone, polycaprolactone, polycarbonates, polyfumarates, caprolactones, polyamides, polysaccharides (including alginates (e.g., calcium alginate) and chitosan), hyaluronic acid, polyhydroxybutyrate, polyhydroxyvalerate, polydioxanone, polyorthoesthers, polyethylene glycols, poloxamers, polyphosphazenes, polyanhydrides, polyamino acids, polyacetals, polycyanoacrylates, polyurethanes (e.g., GranuFoam®), polyacrylates, ethylene-vinyl acetate polymers and other acyl substituted cellulose acetates and derivatives thereof, polystyrenes, polyvinyl chloride, polyvinyl fluoride, poly(vinylimidazole), chlorosulphonated polyolefins, polyethylene oxide, polyvinyl alcohol, Teflon®, and nylon. The scaffold can also comprise ceramics such as hydroxyapatite, coralline apatite, calcium phosphate, calcium sulfate, calcium carbonate or other carbonates, bioglass, allografts, autografts, xenografts, decellularized tissues, or composites of any of the above. In some examples, the scaffold may comprise collagen (e.g., Biostep® or Promogran® scaffolds), polylactic acid (PLA), polyglycolic acid (PGA), polylactide-co-glycolide (PLGA), a polyurethane, a polysaccharide, an hydroxyapatite, or a polytherylene glycol. Additionally, the scaffold can comprise combinations of any two, three or more materials, either in separate or multiple areas of the scaffold, combined noncovalently or covalently (e.g., copolymers such as a polyethylene oxide-polypropylene glycol block copolymers, or terpolymers), or combinations thereof.
[0074] In another aspect, there is provided the pharmaceutical composition as disclosed herein for use in therapy.
[0075] In one aspect, there is provided method of treating a wound, the method comprises administering a pharmaceutically effective amount of the pharmaceutical composition as disclosed herein to a subject in need thereof.
[0076] The present disclosure also provides a method for promoting regeneration of epithelial tissue in a subject. In some examples, the regeneration of epithelial tissue is promoted at the site of a wound in the subject, and, thus, contributes to the promotion of wound healing in the subject.
[0077] The present disclosure also provides the pharmaceutical composition as disclosed herein for use in treating a wound in a subject. The present disclosure also provides the pharmaceutical composition as disclosed herein for promoting regeneration of epithelial tissue in a subject. Also provided are use of the pharmaceutical composition as disclosed herein in the manufacture of a medicament for treating a wound in a subject. Also provided are use of the pharmaceutical composition as disclosed herein in the manufacture of a medicament for promoting regeneration of epithelial tissue in a subject.
[0078] As used herein, the term “treating” includes reducing or alleviating at least one adverse effect or symptom of a disease or disorder. As used herein, “pharmaceutically effective amount” refers to an amount of the pharmaceutical composition that is sufficient to bring about a beneficial or desired clinical effect. Said amount could be administered in one or more administrations. However, the precise determination of what would be considered an effective amount may be based on factors individual to each patient, including, but not limited to, the patient's age, the size of wound, the type of wound, the severity of the wound, route of administration of the pharmaceutical composition, etc. This amount may be readily determined by the skilled person, based upon known procedures, including clinical trials, and methods disclosed herein.
[0079] As used herein, the term “subject” includes warm-blooded animals, preferably mammals, including humans. In some specific examples, the subject is a primate. In one specific example, the subject is a human.
[0080] In some examples, the subject is a subject suffering from, or thought to suffer from, an underlying condition or disease. In some other examples, the subject is suffering from or thought to suffer from cancer. In some further examples, the subject is suffering from, or thought to suffer from, diabetes. In yet some other examples, the subject is undergoing further treatment or has undergone further treatment, whereby the treatment is, but is not limited to, chemotherapy, chemoprevention, radiation therapy, immune suppressive therapy, steroid treatment, and the like.
[0081] As used herein, the term “wound” refers to an injury to a body that typically involves laceration or breaking of a membrane, for example, such as the skin. Wounding may also include damage to underlying tissues, and is, in most cases, usually a result of an external, physical force on the body.
[0082] In some examples, the wound is characterized as being slow healing, or nonhealing.
[0083] A nonhealing wound, for example, is a wound that does not heal according to an orderly set of stages and in a predictable amount of time the way most wounds do; wounds that do not heal within three months are often considered to be non-healing. Wounds can display a spectrum of healing rates, whereby acute and non-healing wounds lie at opposite ends of the spectrum.
[0084] A possible reason for the occurrence of a nonhealing or slow healing wound can be, for example, due to preexisting and/or underlying conditions or diseases, or because a subject is undergoing further treatment, whereby the further treatment results in impaired wound healing. These conditions or diseases may be pathological or non-pathological and can aggravate or exacerbate wound healing by being present in the subject. Examples of such conditions and/or diseases are, but are not limited to, cancer, diabetes (type I and type II), skin disorders, autoimmune disorders, inflammatory disorders (both internal and external) of the epithelial lining, the dermis and/or the sub-dermis, eczema, and the like.
[0085] Examples of wound include but are not limited to, chronic wounds, acute wounds, traumatic wounds, sub-acute wounds, and dehisced wounds, wounds caused by burns, partial-thickness burns, ulcers (such as diabetic, pressure, or venous insufficiency ulcers), flaps, and grafts. In one example the wound is caused by burns or a chronic wound.
[0086] The pharmaceutical composition as disclosed herein may be applied to a wound through direct topical application. Alternatively, the pharmaceutical composition may be applied to a carrier material, which is then applied to the wound. Such methods may include application of the pharmaceutical composition to a bandage, gauze, or dressing to be applied to the wound. The pharmaceutical composition provided herein may also be added to other known compositions for treating wounds.
[0087] The term “topical” application refers to application to skin, dermis or tissue site, and application to such tissue sites may include application adjacent to or within the tissue site.
[0088] The term “tissue site” as used herein broadly refers to a wound or defect located on or within tissue, including but not limited to, bone tissue, adipose tissue, muscle tissue, neural tissue, dermal tissue, vascular tissue, connective tissue, cartilage, tendons, or ligaments.
[0089] Other than topical application, the pharmaceutical composition as disclosed herein can also be administered to a subject in need thereof via other routes. Examples of modes of administration include but are not limited to, intravenous, intravascular, intramuscular, subcutaneous, intracerebral, intraperitoneal, soft tissue injection, surgical site, arthroscopic site, and percutaneous insertion, eg, by direct injection, cannulation, or catheterization. Any administration can be a single application of the pharmaceutical composition or multiple applications. Administrations can be at a single site or at more than one site in the subject to be treated. Multiple administrations can occur at essentially the same time or separate over time.
[0090] It is also shown in the present disclosure that the Agrin fragment or derivative of as described herein promotes collective keratinocyte migration. It is also shown that the Agrin promoted collective keratinocyte migration is achieved by engaging MMP12 as a downstream effector. Since wound re-epithelialization begins after keratinocytes at the wound margins becomes activated for migration, the present disclosure also provides a method for promoting wound re-epithelialization, the method comprises administering an Agrin fragment or derivative thereof as disclosed herein.
[0091] As used herein, the term “re-epithelialization” refers to the process of creating a new barrier between wound and environment through epithelial cell migration. The cellular and molecular processes involved in the initiation, maintenance, and completion of re-epithelialization are essential for successful wound closure.
[0092] The invention illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms “comprising”, “including”, “containing”, etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the inventions embodied therein herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention.
[0093] It will be understood by those skilled in the art that a wide variety of methods and techniques known in the art may be used in carrying out certain embodiments of the present invention.
[0094] Throughout this disclosure, certain embodiments may be disclosed in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the disclosed ranges. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0095] The invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the invention. This includes the generic description of the invention with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
[0096] Other embodiments are within the following claims and non-limiting examples. In addition, where features or aspects of the invention are described in terms of Markush groups, those skilled in the art will recognize that the invention is also thereby described in terms of any individual member or subgroup of members of the Markush group.
Experimental Section
[0097] Materials and Methods
[0098] Antibodies, siRNAs, and Reagents
[0099] The following antibodies were used in the study: Mouse monoclonal anti-Agrin (D-2), Santa Cruz Biotechnology, Cat #sc-374117; RRID: AB_10947251; Human Agrin clone PIF12 (in house generated); Rabbit polyclonal Agrin antibody, Novus Biologicals, Cat #NBP1-90209, Mouse monoclonal anti-Integrin β1, Abcam, Cat #ab24693; RRID: AB_448230; Anti-Integrin Beta1, activated, Clone HUTS-4, Cat #MAB2079Z, RRID:AB_2233964; Mouse monoclonal anti-β Actin (C4), Santa Cruz Biotechnology, Cat #sc-47778; RRID: AB_2714189; Rabbit polyclonal anti-GAPDH (FL-335), Santa Cruz Biotechnology, Cat #sc-25778; RRID: AB_10167668; Phospho-Myosin Light Chain 2 (Ser19) Antibody #3671, RRID:AB_330248, Anti-Myosin light chain (phospho-S20) antibody (ab2480), RRID:AB_303094; Myosin Light Chain 2 Antibody #3672, RRID: AB_330278; MMP-12 Antibody clone G-2, Cat #sc-390863; Anti-MMP12 antibody, Abcam, Cat #ab137444; MMP12 Polyclonal Antibody, Thermo Fisher Scientific, Cat #PA5-27254, RRID: AB_2544730; Rabbit polyclonal anti-CD31, Abcam, Cat #ab28364; RRID: AB_726362; Goat anti-rabbit IgG-HRP, Santa Cruz Biotechnology, Cat #sc-2030; RRID: AB_631747; Goat anti-mouse IgG-HRP, Santa Cruz Biotechnology, Cat #sc-2005; RRID: AB_631736; Goat anti-mouse IgM-HRP, Santa Cruz Biotechnology, Cat #sc-2973; RRID: AB_650513; Goat anti-Rabbit IgG (H+L) Alexa Flour 488 Invitrogen, Cat #A11034; Goat anti-mouse IgM Alexa Flour 594, Invitrogen, Cat #A21044. The following siRNAs were used in this study: human Agrin Stealth siRNAs (Set of 3) HSS139721, HSS180123, HSS180124; mouse Agrin Stealth siRNAs (Set of 3) MSS201833, MSS201834, MSS201835 (Thermo Fisher Scientific), human Agrin smartpool (Cat #L-031716-00-0050), human MMP12 (Cat #L-005954-00-0050) from Dharmacon. The specific siRNA sequences are listed in Table 3. Lipofectamine RNAimax (Invitrogen) was used for siRNA transfections following the manufacturer's recommended guidelines. Fibronectin was obtained from Gibco, and Advanced Biomatrix. Rat tail collagen type 1 was from Corning. Alexa-488 conjugated F-actin phalloidin was from Thermo Fisher Scientific. Blebbistatin and Pluronic F127 was obtained from Sigma and MMP408 from Merck Millipore, respectively. Aquaphore was obtained from Beirsdorf AG while Vaseline was from Unilever. Dimethylsulfoxide was from Kanto Chemical, co., Inc., Cat #10378-00. CellTiter 96® AQueous One Solution Cell Proliferation Assay (MTS), Promega Cat #G3580, was used for proliferation assays. 5-bromo-2′-deoxyuridine-BrdU (#Cat ab142567) and Anti-BrdU antibody (Cat #ab6326) were purchased from Abcam.
[0100] Mice
[0101] Six to eight to week old female experimental ICR (nomenclature: IcrTac:ICR) mice purchased from InVivos were used for punch-biopsy wound healing in vivo assays. In the ex-vivo mouse skin explant assay, random ratios of male and female new born ICR mouse pups were used. Wherever possible, the experiments were performed taking into consideration an ethical and reductionist approach of animal usage. Animal studies were not performed in a blinded fashion. The animals were randomly assigned to different experimental groups. The number of animals used for each experiment is indicated in the legend as n=x mice per group. All animal experiments performed were done in accordance with experimental protocols reviewed by the Biological Resource Center (BRC), Agency for Science Technology and Research (A*STAR) under strict compliance to the Institutional Animal Care and Use Committee (IACUC) guidelines for ethical use of animal models in biological research.
[0102] Cell Lines and Human Skin Explants
[0103] Human epidermal keratinocyte cell line HaCaT was maintained in Dulbecco's modified Eagle's Medium (DMEM) (Gibco) containing 10% fetal bovine serum (FBS) with Penicillin and Streptomycin (Gibco Cat #15140148) antibiotics. The human foreskin normal fibroblasts (BJ) obtained from ATCC (ATCC® CRL-2522™) were passaged in DMEM (Gibco) with antibiotics. Normal primary adult epidermal keratinocytes (HEK) purchased from CELL Applications, Inc., (Cat #C-12003) were maintained in manufacturer provided keratinocyte growth medium as recommended. Primary keratinocytes from C57BL mouse strain were purchased from CellBiologics (Cat #C57-6066K) and maintained as per manufacturer recommended Epithelial cell growth medium (Cat #M6621, CellBiologics). The mouse primary dermal fibroblasts were isolated from C57BL mouse strain (Cat #m-GFP-6067), and cultured in complete fibroblast medium (CellBiologics, Cat #M2267). Epiderm full-thickness (EPIDERM-FT™) human skin explants on a basement membrane bearing 3 mm punch wounds were purchased from MatTek Lifesciences and maintained using the company supplied medium. All cells were propagated at standard culture conditions of 37° C. and 5% CO.sub.2.
[0104] RNA Interference and Knockdown In Vitro and In Vivo
[0105] The desired siRNAs were dissolved as per the manufacturer's recommended buffers. For in vitro studies, 50 nM of control or targeted siRNA was mixed with 5 μl of Lipofectamine RNAimax (Thermo Fisher Scientific), and incubated for 30 min at room temperature. The siRNA: lipofectamine mixture was added to 250 μl of reduced growth factor medium. The knockdown was verified by RT-PCR or Western blot after 72 h. For in vivo and ex vivo RNAi, 75 nM of stealth siRNAs were mixed with 8 μl of Lipofectamine RNAiMAX (Thermo Fisher Scientific) for 30 min at room temperature. Subsequently, the siRNA mix was slowly incorporated into a 1:1 mixture of Aquaphore gel in Phosphate buffered saline (PBS) for topical delivery. For treatment with skin explants, the siRNA lipofectamine mix was added to Aquaphore as 1:1 mixture at day 0 post-wounding and incubated for the indicated number of days. For efficient knockdown, the topical siRNA ointment was re-applied on day 4 post-wounding. For the explants that were rescued with sAgrin, an Aquaphore mix containing 20 μg protein was added on days 2, 4 and 6 post-wounding.
[0106] Recombinant Agrin Expression and Purification
[0107] The C-terminus fragment containing 8 amino acid ‘Z8’ insert and LG3 domain (AgrinZ8LG3, having the sequence of DTLAFDGRTFVEYLNAVTESELANEIPVEKALQSNHFELSLRTEATQGLVLWSGKA TERADYVALAIVDGHLQLSYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQ VGNEAPVTGSSPLGATQLDTDGDCALWLGGLPELPVGPALPKAYGTGFVGCLRDVVV GRHPLHLLEDAVTKPELRPCPTP (SEQ ID NO: 7)) was cloned into a pET28 vector containing His-ta and expressed in Escherichia coli (strain BL21-DE3). The bacteria were transformed with the plasmid. A single colony was inoculated in TB medium containing antibiotics and induced with IPTG for 16 h at 15° C. The cells were harvested by centrifugation and cell pellets were lysed in lysis buffer followed by sonication. The resultant supernatant containing Agrin protein fragment was purified using gel filtration chromatography via Superdex75 columns in imidazole buffer, and sterilized by passing through a 22 μm low-protein binding filter and was dissolved in PBS solution.
[0108] Punch-Biopsy Wound Healing Models
[0109] The mice were housed under standard conditions of 21° C. and a 12 h light-dark cycle with free access to food. Subsequently, the mice were intraperitoneally (i.p.) anesthezised using Ketamine 100 mg/kg and Xylazin 10 mg/kg diluted in 100 ml of saline solution. The fur was shaved from the base of the neck towards the back on the entire shoulder region. The skin was wiped with an alcohol swab and 10% povidone-iodine (Betadine) antiseptic solution. Circular symmetrical 4 mm wounds were inflicted on either side of the midline in the shoulder region using a sterile 4 mm punch biopsy needle (Integra Miltex, Integra York, P.A., Inc.). The wound skin was carefully removed using a scalpel and a pair of scissors to generate a full-thickness wound that were left open for topical administrations during the analysed time periods. For splinted wound healing models, a 10 mm transparent donut shaped nylon sheet (Grace Bio-Laboratories, Bend, Oreg.) was placed around the 4 mm wound. The splint was placed with the wound at the center, glued to the skin by adhesive (Krazy Glue®; Elmer's Inc.), and covered by Tegaderm dressing. The wounds were treated with different formulations based on either petroleum jelly (Vaseline), a thermoresponsive hydrogel (Pluronic F127-Sigma) or a commercially available skin ointment (Aquaphore-Beiersdorf, Inc.). For Vaseline based ointment cream preparation, 10 mg per cm.sup.2 vaseline ointment was mixed with filtered PBS solutions containing the indicated amounts of Agrin (100 μg, 200 μg or 500 μg) and 100 μg BSA (w/w) were used and applied topically every two days. For siRNA mediated knockdown experiments, 75 nM of indicated siRNAs were incubated with lipofectamine in PBS. Subsequently, a 1:1 mixture of PBS (containing the siRNAs): Aquaphore was applied topically on the wound region every two days. A topical formulation comprising of 20% (w/w) Pluronic F127 (Sigma) was used to dissolve in sterile and 0.22μ filtered solution containing a final concentration of 200 μg/ml sAgrin or BSA. This mixture was dissolved overnight at 4° C. to ensure that liquid phase is achieved. The mixture forms a homogenous gel at temperatures above ˜20° C. and was dispersed topically to cover the wound. Wound closure was assessed using a Vernier caliper every alternate day. For both models, the animals were caged individually throughout the observed time-points of healing at the institutional animal facility. All wound healing animal experiments performed were done in accordance with experimental protocols reviewed by the Biological Resource Center (BRC), Agency for Science Technology and Research (A*STAR) under strict compliance to the Institutional Animal Care and Use Committee (IACUC) guidelines for ethical use of animal models in biological research.
[0110] Mouse Skin Explant Assay
[0111] Three days old ICR strain mouse pups were sacrificed and the hind skin on either side of the midline in the shoulder region was washed in 70% ethanol and excised using scalpel. The excised skin was washed in 70% ethanol and placed (dermis side down) on the pre-made gel substrates of defined stiffness, either in the absence or presence of 20 μg/ml sAgrin. The explants were allowed to adhere for 2 h before adding the keratinocyte culture medium (DMEM) containing 300 μM Ca.sup.2+ as described previously.sup.31. The keratinocyte outgrowth and the skin tissues regularly imaged under an Axiovert-200 inverted microscope and were subsequently fixed in 4% paraformaldehyde and immunostained for Keratin 17 antibody.
[0112] Substrate Stiffness Manipulations and Micropatterning
[0113] Tissue culture plates were coated with Col-T-gel (Fischer Scientific) of stiffness ranging from 0.8 KPa (soft) to 30 KPa (stiff) as per manufacturer recommendations and allowed to solidify for 40 min at 37° C. inside tissue culture incubators. Some experiments were performed with cells seeded on the poly-hydrogel plates of defined stiffness: 0.2 kPa and 16 kPa soft and hard polyhydrogels, respectively (CytoSoft, Advanced Biomatrix, Inc.,). The determination of stiffness of silicone substrates were done by the manufacturer as per previously published protocols. For certain experiments, indicated amounts of sAgrin was incorporated into the 0.8 KPa collagen gels before gelation process. Upon gelation, trypsinized cells or excised mouse skin explants were plated onto the gels of different stiffness either alone or containing sAgrin. The cells/tissues were incubated under standard culture condition with 500 μl recommended culture medium for the indicated days. The crossbow shaped micropatterns with fibronectin coated islands were generated by microlithography on a 19.5×19.5 mm coverslide from Cytoo, Inc., France. The micropatterns had surface areas of 800μ.sup.2 or 1600μ.sup.2, respectively. Fifty thousand cells after initial siRNA treatment was placed on the micropatterns for 4-6 h before processing them for immunofluorescence. For some experiments, 10 μg/ml sAgrin was added on the slides 18 h prior to the addition of cells.
[0114] 3D-Stiffness Dependent Keratinocyte Fibroblast Co-Culture Migration Assay
[0115] A 3D in-vitro wound healing model was created using collagen constructs of defined stiffness modifying a previously published protocol. Collagen constructs were made with Col-T-gel (0.8 KPa-soft) or (30 KPa-stiff) as per manufacturer's recommended protocol containing 300,000 primary mouse dermal fibroblasts (DFs). For some experiments, siControl and siAgrin treated DFs were incorporated within soft or stiff collagen constructs. The constructs bearing fibroblasts were allowed to solidify for 45 min inside incubator. A second layer of collagen matching the stiffness of the underneath layer was added containing 350,000 of primary mouse keratinocytes (KRTs) and the construct was allowed to solidify for 3-4 h. After removing excess media, the constructs were washed gently with 1×PBS twice. An upside down 2μ pipette tip was inserted and gently rotated at the center of the constructs to create a circular wound. The collagen and cells was quickly removed from the wound area and replaced with 40 μl of soft or stiff Col-T-gel matching the consistency and set-up of the constructs. The resultant wounded constructs were placed inside the incubator and imaged after 30 min for day 0 time-points. The migratory keratinocytes were imaged till day 5 post-wounding.
[0116] Western Blot Analysis
[0117] Indicated cells post-manipulation were washed twice with cold Phosphate buffered saline (PBS) and lysed with cold 1% NP-40 lysis buffer supplemented with 1× protease inhibitor cocktail (Roche Applied Biosciences) for 15 mins at 4° C. The cell lysate was centrifuged at 13,000 rpm for 15 min. This was followed by protein estimation using Bradford reagent. Subsequently, 40-50 μl of total protein was mixed with an equal volume of 2× Laemmli sample buffer and heated at 95° C. for 5 mins. This was followed by resolution with SDS-PAGE gel. The resolved proteins were transferred onto nitrocellulose membrane and blocked in 5% skimmed milk reconstituted in 1×PBS containing 0.1% Tween-20, and probed overnight with the respective primary antibody. The membrane was then washed with 1×PBS supplemented with 0.1% Tween-20: three times at 15 min intervals. This was followed by 1 h incubation in conjugated horseradish peroxidase HRP secondary antibody (Santa Cruz Biotechnology). Post-incubation, the blot was again washed three times as above and then overlaid with enhanced chemiluminescence (ECL) substrate (Pierce/Bio-Rad) and visualized on X-ray film by image processor or digitally by Chemidoc analyzer (Bio-Rad). The density of the various bands was quantified using the Image-J software.
[0118] Immunofluorescence and Confocal Microscopy
[0119] Cells were cultured on eight-well chamber slides or coverslips over-night. Cells were then washed twice with PBS and fixed for 15 min with 4% paraformaldehyde. Subsequently, the cells were permeabilized for 15 min with 0.1% Triton X in Phosphate buffered saline containing 1 mM Ca.sup.+2 and 1 mM Mg.sup.+2 (PBSCM) at room temperature. The permeabilized cells were incubated with indicated antibodies in fluorescent dilution buffer (FDB) for 1-2 h at RT or overnight at 4° C., followed by 5 washes with PBSCM and incubation with secondary antibody; Alexa Fluor (Thermo Fisher Scientific) for 1 h at RT. Slides were again washed five times with PBSCM and mounted with Vectashield medium containing DAPI. The stained cells were then imaged by a Zeiss confocal microscope. The images were processed and analyzed by Zen blue software. Intensity measurements were acquired using tool selection parameter in image analysis within the Zen blue software.
[0120] Histology and Immunofluorescence-Histology
[0121] Human skin equivalents and mice skin tissues were harvested, embedded, and subjected to routine histology using Hematoxylin and Eosin. For immunostaining, the tissues were fixed for 24 h in 10% neutral buffered formalin solution. Subsequently, the tissues were sectioned using a microtome and subjected to antigen-retrieval at pH 9 or pH 6 (for the indicated antibodies). Primary antibodies were used at a concentration of 1:50 dilution, while the respective Alexa-488 and Alexa-594 secondary antibodies (Thermo Fisher Scientific) were used at a concentration of 1:100 and 1:500, respectively in fluorescent dilution buffer. The slides were mounted in a VECTASHIELD Hardset™ antifade mounting medium containing DAP. Quantification of collagen as a marker for ECM deposition was done by picrosirius red staining of paraffin embedded mouse skin tissues, as per previously published protocol.
[0122] In Vitro Wound-Healing Assay
[0123] A confluent monolayer of control and Agrin depleted cells in a 6-well plate was subjected to a unidirectional scratch using a 20 μl pipette tip. This was followed by washing with 1×PBS at room temperature and incubation in complete culture media at 37° C. and 5% CO.sub.2 with or without sAgrin used as indicated. Phase contrast images of the wound area were taken periodically at the indicated time-points. For some wound-healing migration assays, keratinocytes were cultured on either soft or stiff substrates within a stencil barrier (Nalge Nunc., Inc) for 18 h. Upon removal of the barrier, the cells were allowed to migrate and imaged using an Axiovert 200 inverted microscope at indicated time-points.
[0124] Traction Force Microscopy
[0125] Substrate preparation—Two-part silicone elastomer, DOWSIL CY52-276 (Dow Inc.), is first mixed thoroughly in a 1:1 weight ratio. The mixture is then poured into a 35 mm glass-bottom culture dish (iwaki 3930-035, Asahi Techno Glass Corporation, Japan) placed on a level surface, to a thickness of ˜500 μm. After pre-curing overnight, the silicone coated culture dish is further baked for 2 hours at 80° C. to fully cure. To maximize subsequent microsphere attachment, the silicone film is pre-treated with (3-aminopropyl) triethoxysilane (A3648, Sigma-Aldrich). To silanize, a 1 ml solution containing 96% v/v, 2% v/v APTES and 1% v/v acetic acid (A6283, Sigma Aldrich) is added to the glass-bottom culture dish, covering the whole silicone film, and left for 10 minutes to react. The silicone film is then twice rinsed with 96% v/v ethanol and followed by a quick dip in Milli-Q water to remove all the solution: removing solution from the film this way is preferred over blow-drying with nitrogen gas because the latter may introduce dust to the surface which subsequently affects the uniformity of attached microsphere distribution. Following this, the culture-dish is baked at 80° C. for another 2 hours to promote siloxane bond formation. For the physisorption of fluorescent latex microspheres on to the silicone film, 6 μl of 100 nm orange fluorescent (540/560) carboxylate-modified microspheres (F8800, ThermoFisher Scientific) is first diluted in 10 ml of Milli-Q water and sonicated for 10 minutes. The diluted microspheres are then passed through a 0.22 μm filter directly into a 15 ml falcon tube containing 500 μl of 500 mM MES buffer, pH 6.0 (M3671, Sigma Aldrich). The microspheres are then sonicated again for 10 minutes before being added to cover the APTES silanized silicone film within the culture dish previously prepared. The solution was left for 5 minutes to allow the microspheres to attach. Then, to remove the solution, the culture dish is carefully and quickly tipped so that all the solution is removed in a single action, as the solution's surface tension would decouple microspheres if allowed to flow back. The microsphere coupled culture dishes are then baked at 80° C. for 2 hours and typically used within a week. To facilitate the attachment of adherent cells, the microsphere coupled silicone films are coated with human blood plasma fibronectin (10838039001, from Sigma Aldrich) with a concentration of 50 μg/ml to a surface density of 5 μg/cm.sup.2. The stiffness of silicone substrates used for TFM were determined by atomic force microscopy as per previously established protocols as described in the section below.
[0126] Traction force imaging—A Nikon Biostation IMQ is used to live-cell image the HACAT cell-sheet migration and microsphere displacement over 24 hours with 10-minute intervals, at 37° C. and 5% CO.sub.2. Both phase contrast and epifluorescence images were acquired using the internal 20× objective (0.5 NA) and 1.3-megapixel monochrome camera. The light source for the epifluorescence is the Intensilight Hg Pre-Centred Fibre Illuminator and orange microspheres are imaged using a Texas Red filter set. To account for z-drift, 2-3 planes 1 μm apart either side of the focal plane is typically taken in a z-stack. Three independent samples are imaged for each condition, and for each independent sample 3-4 locations are randomly selected and tracked.
[0127] Cell Stiffness by Atomic Force Microscopy (AFM)
[0128] The stiffness of the mouse keratinocyte cells was measured using a Nanowizard IV BioAFM system (JPK Instruments, Germany). Confluent mouse kerantinocyte monolayers were cultured on a petri dish in PBS media. The monolayers were scratched across the center of the petri dish using a 100 μl pipette tip and characterised after 4 hrs. Indentations were performed on randomly selected cells at the wound edge with a polystyrene bead of diameter (˜4.5 μm) attached to the end of a cantilever (k=0.03 N/m, Novascan Technologies, Inc., Ames, Iowa) using a force of 3 nN at 1 Hz. More than 60 cells from triplicate experiments were characterized and averaged to evaluate the Young's modulus for each condition. Young's modulus values were calculated using JPK Data Processing Software (JPK Instruments, Germany), which employs Hertz's contact model for spherical indenters (diameter 4.5 μm; Poisson's ratio 0.5) fitted to the extend curves.
[0129] Fabrication of Polyacrylamide Block for Collective Traction Force Measurements in a Wound Healing Assay Model
[0130] A polyacrylamide precursor mixture is first prepared as follows. To prepare 1 ml of such precursor mixture, 200 μl of 40% w/v aqueous AC (1610140, Bio-Rad), 200 μl of 2% w/v aqueous BIS (1610142, Bio-Rad), 1.5 μl of TEMED (1610800, Bio-Rad), and 583 μl of Milli-Q water are thoroughly mixed together. 500 μl of this mixture is then combined with 8 μl of 10% ammonium persulfate (1610700, Bio-Rad) and quickly pipetted into to a 3D printed mould with a cavity size of 1.2×1.2×0.5 cm. A slightly larger square piece of 3-(trimethoxysilyl) propyl methacrylate (440159, Sigma-Aldrich) silanized glass is then placed over the top. The glass will covalently bind to the polyacrylamide once reaction completes, and acts as a solid support for the block; it will also facilitate adding weights to the block. The silanization procedure for this glass support is similar to that performed for the silicone film in the main text, except TMSPMA is used instead of APTES. The solid hydrogel is removed from the mould after 30 minutes and immersed in Milli-Q water overnight to wash out remaining toxic components. The mould and the finished block are shown in
[0131] Wound Assay Using Microfabricated Device for Collective Traction Force Microscopy
[0132] Prior to seeding the HaCaT cells, the 35 mm culture dish containing the ECM coated silicone film is setup with a block of polyacrylamide hydrogel (1.2×1.2×0.5 cm, see also
[0133] Force Transmission Via Ligand Conjugated Magnetic Beads
[0134] The ligands were conjugated to 4.5 μm epoxide paramagnetic beads (Dynabeads M-450 Epoxy, Thermo Fisher Scientific) according to the manufacturer's manual. Briefly, the beads were washed twice in 0.1 M sodium phosphate buffer, pH 7.4. Subsequently. 8×10.sup.7 beads were conjugated to 20 μg sAgrin, BSA and FN per in 0.1 M sodium phosphate buffer at pH 7.4 for 16-18 h at 4° C. with gentle rotation throughout. The degree of protein conjugation to the beads was verified by a reducing SDS-PAGE gel analysis using a subset of ligand conjugated beads. The remaining beads were washed and subsequently stored in 0.1% BSA-phosphate buffered saline (PBS) pH 7.4 at 4° C. They were subsequently suspended in medium and added on the cells for 30 min at 37° C. After a brief wash with PBS to remove excess non-adherent beads, the cells were placed under a permanent neodymium magnet (J Magnetics, USA) at a distance of 6 mm apart for another 30 min that allowed a vertical tensile force in the magnitudes of ˜200 pN on the beads. The cells were then fixed in 4% paraformaldehyde, permeabilized and processed for immunofluorescence.
[0135] Mathematical Computation of Traction Forces
[0136] The displacement fields associated with the fluorescent bead images were computed using PIVLab, an open-source Particle Image Velocimetry MATLAB package, which is based on cross-correlation. Images of the substrate in a stress-free state (i.e. sufficiently long after the addition of 1% v/v sodium dodecyl sulfate (L4509, Sigma Aldrich) to the culture to kill the cells) were used as the reference images to compute these deformations. During cross-correlation, four window passes were used, each of (square) window sizes of 64, 32, 16, and 16 pixels respectively, with 50% window overlap between strides. These computed displacement fields were then used to perform Fourier Transform Traction Cytometry (FTTC) to infer traction forces, using the MATLAB code. The Young's modulus and Poisson's ratio were assumed to be 10 kPa and 0.5 for all of the FTTC calculations, respectively. The L-Curve criterion was used to select the optimal L2 regularisation parameter. More specifically, an L-curve was constructed for the 1.sup.st, 10.sup.th, 20.sup.th, 30.sup.th, 40.sup.th, 50.sup.th, and 60.sup.th frame of each sample movie, and then the optimal regularization parameter corresponding to each L-curve was selected using the l-corner function for MATLAB. The median of all the optimal regularization (i.e. the parameters calculated for each frame of every sample) was taken to be the optimal regularisation parameter (found to be 1.26×10.sup.−9), which was then fixed for all samples. Noting that a larger regularization parameter will reduce the magnitude of our computed force fields, this was done to avoid creating artificial differences in the magnitude of the computed traction fields by systematically selecting smaller or larger regularisation parameters for different sample conditions.
[0137] Image Stitching
[0138] An in-house script based on image cross-correlation was used to stitch neighbouring image fields together to generate a larger traction force field.
[0139] Dermal Endothelial Cell Fibroblast 3D-Angiogenesis Assay
[0140] One hundred thousand Human Dermal Microvascular endothelial cells (HDMEC) cells were pre-labeled overnight with Cell Tracker Blue CMAC (7-amino-4-chloromethyl coumarin-invitrogen) and mixed with equal amounts of GFP expressing BJ cells. Both the cells were treated with the concerned siRNA and allowed to form co-culture spheroids as per previously established protocols. Images of sprouting ECs was captured 24 h post-embedding and quantified using Sprout morphology plugin from Fiji (Image J) as described previously.
[0141] MMP12 Activity Assay
[0142] MMP12 activity were monitored via Gelatin and Casein zymography as per previously published protocols. Briefly, control or Agrin depleted HaCaT cells were grown till 80-90% confluency in media without FBS. Supernatants collected from each culture dish were spun down at 10,000 rpm for 5 min and concentrated using Amicon ultra columns. Twenty microliter of medium was mixed with 2×SDS loading buffer and loaded on 10% gelatin or casein gel. The gels were washed with incubation buffer and subsequently stained with Coomassie Brilliant Blue for 1 h. The gels were de-stained for 30 min before imaging using a Chemidoc imager.
[0143] Quantitative Reverse Transcription PCR (RT-PCR) and RNA Sequencing
[0144] Total RNA was extracted from indicated cells using Qiagen RNeasy mini kit as per the manufacturer's recommended protocol. The total RNA was then reverse transcribed using High-Capacity cDNA reverse transcription kit (Applied Biosystems). The generated cDNA (200 ng) was used as a template for the RT-PCR using the SYBR™Green or Tagman® (Thermo Fisher Scientific) based master mix and probes. The data was normalized to GAPDH as endogenous controls. The RT-PCR primers used in the study for the respective target genes are provided in the Table 1. For RNA-sequencing, the RNA quality was analyzed on a Bioanalyzer instrument (Agilent) using the Agilent RNA 6000 Pico Kit. A total of 4 μg RNA was used for RNA-Sequencing library preparation with the TruSeq Stranded mRNA Library Prep kit (Illumina) based on the manufacturer's instructions. Amplification of libraries was limited to 7 PCR cycles. Purified libraries were quantified by qPCR (KAPA Library Quantification Kit for Illumina, Roche). The Agilent High Sensitivity DNA Kit was used to assess the fragment lengths of a subset of libraries, before combining the rest of the libraries into one pool and further subjecting to a sequencing run on a NextSeq500 (Illumina). The condition of sequencing was represented by a single read high output run at 75 bp read length. Raw reads from fastq files were aligned to the hg38 genome using STAR 2.6.1d. Bam files were sorted and indexed with samtools. The relative number of reads mapping to each gene was quantified with htseqcount on features from the gtf file gencode.v29.annotation.gtf. The raw counts of reads were then imported into EdgeR in R to perform the differential expression analyses using the Gene-ontology, GSEA or other analysis, respectively. Gene set enrichment analysis (GSEA) was performed running the GSEA Pre-ranked tool of the GSEA Software 3.0, using the gene sets from the Molecular Signatures Database (MSigDB) v6.2. Enriched Gene Ontology terms and KEGG pathways were identified using Metascape (https://metascape.org/). Only genes with a false discovery rate (FDR) below 1% and more than 2-fold change in expression between conditions were considered.
TABLE-US-00005 TABLE 1 List of RT-PCR primers used Forward/ Reverse SEQ Gene primer ID NO Sequence (5′ to 3′) MMP12 Forward 16 GATGCACGCACCTCGATGT Reverse 17 GGCCCCCCTGGCATT MMP10 Forward 18 GACCCCAGACAAATGTGATCCT Reverse 19 TTCAGGCTCGGGATTCCA MMP-1 Forward 20 CCTAGTCTATTCATAGCTAATCAAGA Reverse 21 AGTGGAGGAAAGCTGTGCATAC GSDMB Forward 22 AAAGCGACCGGCAATATAAA Reverse 23 ATAGCTCAGGACCCGATTTG Duox2 Forward 24 ACGCAGCTCTGTGTCAAAGGT Reverse 25 TGATGAACGAGACTCGACAGC Dkk3 Forward 26 GCGGGAGCGAGCAGATCCAG Reverse 27 GGAAGCTGGCAAACTGGCAG SERPINE2 Forward 28 TCTCATTGCAAGATCATCGCC Reverse 29 CCCCATGAATAACACAGCACC SQLE Forward 30 TTAGAGGAGAAATGCCAAGGAA Reverse 31 CACTGATGAAGGAGGAAGGAAG IFI27 Forward 32 TGGACTCTCCGGATTGACCAAGTT Reverse 33 ATTTGGGATAGTTGGCTCCTCGCT IFI6 Forward 34 CCCATCTATCAGCAGGCTCC Reverse 35 AAAGCGATACCGCCTTCTG ARHGAP26 Forward 36 TAAGAATGCTTCCAGGACCACTC Reverse 37 GCTGTAACATCTGCCGATTTTTC TPD52L1 Forward 38 CTCGGCATGAATCTGATGAATG Reverse 39 TGGCAGTTCCCACGTTATTG EPHB6 Forward 40 TGGACTATCAGCTCCGCTACTATG Reverse 41 GTGGCAGTGTTGGTCTCGC ACAN Forward 42 CTACACGCTACACCCTCGAC Reverse 43 ACGTCCTCACACCAGGAAAC CXCL1 Forward 44 GCGCCCAAACCGAAGTCATA Reverse 45 ATGGGGGATGCAGGATTGAG PDK4 Forward 46 CCGTATTTCTACTCGGATGCTG Reverse 47 TGGCTTGGGTTTCCTGTC AJAP1 Forward 48 GGACTCAGCTCCATGTCTATCC Reverse 49 ACTGAGGTCTCCCCTAAGATCC NPTX4 Forward 50 GAGAAAGTGGTTGAGAGG Reverse 51 GTAATCAACGACGGCAAG ACTB Forward 52 TGACAGGATGCAGAAGGAGATTA Reverse 53 AGCCACCGATCCACACAGA GAPDH Forward 54 CTATAAATTGAGCCCGCAGC Reverse 55 GACCAAATCCGTTGACTCCG AGRN Forward 56 ACACCGTCCTCAACCTGAAG Reverse 57 CCAGGTTGTAGCTCAGTTGC GPC1 Forward 58 CGGCCCCGCCATGGAGCTCC Reverse 59 GGCAGTTACCGCCACCGGGG HSPG2 Forward 60 AGCATGGACGTGGCTGTGCC Reverse 61 GGCGTGCGTGTGTAGCCTGT AGRN Forward 62 AATGGCACGGACTAATTTGC (mouse) Reverse 63 TATGAGGGTTTGTGGGGTGT MMP12 Forward 64 AATGCTGCAGCCCCAAGGAAT (mouse) Reverse 65 CTGGGCAACTGGACAACTCAACTC GAPDH Forward 66 CATCACTGCCACCCAGAAGACTG (mouse) Reverse 67 ATGCCAGTGAGCTTCCCGTTCAG
[0145] Statistical Analysis
[0146] The number of biological and technical repeats for each experiment is indicated in the figure legends. For most in-vitro experiments, three biological repeats are performed unless stated differently in the legend. For in vivo experiments, no animals were excluded from analysis and the sample size was not pre-determined using power analysis. The age and sex of animals are mentioned in the methods section. Randomization is not applied for experiments using cell lines. Data are presented as mean+/−s.d. Students ‘t’ test was employed to detect paired comparisons and ANOVA or Multiple t tests were used to compare multiple groups using GraphPad Prism software. The data was considered statistically significant when *p<0.05, **p<0.005, ***p<0.0005, respectively. Data considered insignificant was designated as ‘ns’. No prior statistical tests or assumptions were used to determine the sample size of in vitro, ex vivo and in vivo experiments. Three biological replicates were chosen for in-vitro experiments as it adheres to the commonly held practice in biomedical research.
[0147] Results
[0148] Skin Wounding Actuates an Agrin-Enriched Microenvironment
[0149] Epithelial wound healing is dramatically influenced by the re-establishment of lost ECM components to generate a new stroma that supports re-epithelialization of keratinocytes facilitating wound closure. Focusing on the early phase of the wound healing where re-epithelization is marked by Keratin 17 (KRT17) expressing keratinocytes, we identified a wound signature of ECM proteins including Agrin (AGRN), Perlecan (HSPG2), Glypican 1-3 (GPC1-3), that were enhanced within days 1-10 post punch wound biopsies in mouse skin (
[0150] Depletion of Agrin Impairs Skin Wound Healing
[0151] To test the functional relevance of an Agrin-enriched microenvironment in promoting wound healing in vivo, the inventors utilized three independent stealth siRNAs to knockdown Agrin in the mouse skin to see the impact on healing rates following punch-biopsy wounds under ‘non-splinted’ and ‘splinted’ conditions, respectively (
[0152] Furthermore, the 4 mm punch-wounds were surrounded by a 10 mm splint tightly adhered to the skin, thereby representing a ‘closed’ splinted condition for wound healing. The ointments containing the respective siRNAs were applied and the wound region were subsequently covered by Tegaderm (
[0153] Moreover, siRNAs against human Agrin were used to inhibit its expression in keratinocyte and in a human skin explant model (
[0154] As keratinocyte re-epithelialization is tightly coordinated with their proliferative states, it was next documented whether Agrin supported keratinocytes' proliferation during their migratory phase post-wound injury. During early in vitro migration within 4 h post-wound injury, Agrin depletion did not affect the proliferative rates of the leader cells as measured by 5-bromo-2′-deoxyuridine (BrdU) incorporation assays (
[0155] Agrin Sensitizes Keratinocytes Towards ECM Rigidity and Fluidic Collective Migration
[0156] Having demonstrated a role in wound healing response, the inventors explored whether Agrin generates a mechanically competent environment favoring collective keratinocyte migration and wound closure. Since bulk stiffness from the ECM stimulates the migration in a variety of cell types, the inventors rationalized that Agrin may integrate ECM stiffness signals and collective keratinocyte migration within the wounded skin environment. Collective migration of HaCaT cells cultured on stiff (30 kPa) substrates was significantly higher than in compliant ones (0.8 kPa) (
[0157] Complementing the 2D scratch-wound assays, the inventors next devised an in vitro 3D-substrate stiffness dependent migration assay to recapitulate the role of Agrin in mediating keratinocytes' migration under the simultaneous influence of underlying dermal cultures and bulk substrate rigidity as experienced by native skin tissues. In this strategy, primary mouse dermal fibroblasts (DFs) were first embedded within a compliant collagen matrix (0.8 KPa) which were subsequently overlaid with mouse keratinocytes (KRTs) (
[0158] In the next paradigm, the ability of sAgrin to sensitize collective ex vivo keratinocyte outgrowth from mouse skin explants experiencing varied substrate rigidity was tested. Accordingly, collective keratinocyte outgrowth was monitored when full-thickness hind skin from 2-day old mouse pup was placed on either collagen matrix corresponding to soft or stiff substrates in the presence or absence of sAgrin, respectively (
[0159] Cells respond to bulk ECM stiffness by introducing subtle changes to their intrinsic material properties by enhancing their cytoskeletal tension that favor greater motility. To examine the mechanoperception of keratinocytes bestowed by an Agrin-enriched environment, the stiffness of migrating keratinocytes post-injury was first measured by Atomic Force Microscopy (AFM) as a marker for cell-intrinsic material property. The stiffness of migrating mouse keratinocytes recorded as ˜2.1 KPa at 4 h post-wound scratch was significantly decreased to ˜0.9 KPa upon Agrin knockdown (
[0160] Agrin Mechanotransduction Tunes Cell Mechanics Post-Injury
[0161] Central to the outcome of enhanced keratinocytes' fluidic motility, it was asked whether Agrin tunes cellular mechanics during wound injury via coordinating cytoskeletal architecture. An organized cytoskeletal architecture determining the integrity of collective migration in keratinocytes is showcased by the formation of actomyosin cables at the leading front in embryonic and adult wound healing. First, the inventors examined whether Agrin orchestrated actomyosin dynamics at the leading edge during wound stress. Wounding generated robust actomyosin cables within 4 h in control keratinocytes (
[0162] To gain deeper insights on how cellular mechanoperception is calibrated through actomyosin engagement by an Agrin-induced force recognition mechanism, the inventors used a permanent magnet to apply mechanical force on wounded keratinocytes via ligand coated magnetic beads that simulated the effects of abnormal mechanical force experienced by the wound microenvironment. In this setup, magnetic beads were conjugated with control proteins (Bovine Serum Albumin-BSA or Fibronectin-FN) and sAgrin, respectively, and were subsequently allowed to bind to the cell surface. A permanent magnet placed 6 mm above the cells in culture plate ensured a sustained force of 200 pN was applied for 30 min post-wound scratch through the ligand coated beads (
[0163] In addition to the loss of ECM components, keratinocytes often navigate through wounded areas adapting to large-scale changes to their morphology and cytoskeleton under different geometrical tensions. To simulate whether Agrin influences keratinocytes' ability to shift their cytoskeletal tension upwards upon exposure to geometrical constraints, normal HEK cells were cultured in crossbow shaped FN patterns of different surface areas. The FN coated crossbow micropatterns force the cells to assume a polarized orientation with F-actin stress fibers originating from the dorsal arc and extensive actomyosin stress fiber bundling at the transverse arc towards the base. Smaller (800μ.sup.2) fibronectin patterns compressed cells even further leading into severe loss of F-actin stress fibers (
[0164] MMP12 as a Mediator of Agrin-Mechanotransduction Following Wound Injury
[0165] To identify the downstream effectors of Agrin mediating mechanotension in keratinocytes upon wound injury, the inventors performed transcriptome-wide comparison via RNAseq analysis in control versus Agrin depleted cells cultured in plastics that mimic a highly stiff ECM (
TABLE-US-00006 TABLE 2 Pro-inflammatory cytokines and chemokines primers used in the study Target Gene Forward/ SEQ (Mouse) Reverse ID NO Sequence (5′ to 3′) IL-18 Forward 68 GCCTCAAACCTTCCAAATCA Reverse 69 TGGATCCATTTCCTCAAAGG TGF-BETA 1 Forward 70 CCTGTCCAAACTAAGGC Reverse 71 GGTTTTCTCATAGATGGCG VEGF Forward 72 GTACCTCCACCATGCCAAGT Reverse 73 TCACATCTGCAAGTACGTTCG IL1beta Forward 74 CCTTCCAGGATGAGGACATGA Reverse 75 TGAGTCACAGAGGATGGGCTC TLR3 Forward 76 CCTCCAACTGTCTACCAGTTCC Reverse 77 GCCTGGCTAAGTTATTGTGC MIP-1α Forward 78 TGAATGCCTGAGAGTCTTGG Reverse 79 TTGGCAGCAAACAGCTTATC MIP-1β Forward 80 TGCTCGTGGCTGCCTTCT Reverse 81 CAGGAAGTGGGAGGGTCAGA MIP-2 Forward 82 CGCCCAGACAGAAGTCATAG Reverse 83 TCCTCCTTTCCAGGTCAGTTA KC Forward 84 TGCACCCAAACCGAAGTCAT Reverse 85 TTGTCAGAAGCCAGCGTTCAC TARC Forward 86 CAAGCTCATCTGTGCAGACC Reverse 87 CGCCTGTAGTGCATAAGAGTCC RANTES Forward 88 CACCACTCCCTGCTGCTT Reverse 89 ACACTTGGCGGTTCCTTC MCP-1 Forward 90 TAGGCTGGAGATCTACAAGAGG Reverse 91 AGTGCTTGAGGTGGTTGTGG MIP-3ß Forward 92 AGCCTTCCGCTACCTTCTTA Reverse 93 GCTGTTGCCTTTGTTCTTGG I-309 Forward 94 CGTGTGGATACAGGATGTTGACAG Reverse 95 AGGAGGAGCCCATCTTTCTGTAAC TRIF Forward 96 GGTTCACGATCCTGCTCCTGAC Reverse 97 GCTGGGCCTGAGAACACTCAAG GAPDH Forward 98 TGAGCAAGAGAGGCCCTATC Reverse 99 AGGCCCCTCCTGTTATTATG TNF-α Forward 100 GCCTCTTCTCATTCCTGCTTG Reverse 101 CTGATGAGAGGGAGGCCATT IL-6 Forward 102 ACGGCCTTCCCTACTTCACA Reverse 103 CATTTCCACGATTTCCCAGA ß-actin Forward 104 CGTGCGTGACATCAAAGAGAA Reverse 105 TGGATGCCACAGGATTCCAT
TABLE-US-00007 TABLE 3 Small interfering RNA (siRNA) sequences Name Company Primer Name SEQ ID NO Sequence (5′ to 3′) Human Invitrogen AGRNHSS139721 106 CCUUUGUCGAGUACCUCAACGCUGU AGRN (Stealth) 107 ACAGCGUUGAGGUACUCGACAAAGG AGRNHSS180123 108 CAUACGGCAACGAGUGUCAGCUGAA 109 UUCAGCUGACACUCGUUGCCGUAUG AGRNHSS180124 110 GCGAUUUAUGGACUUUGACUGGUUU 111 AAACCAGUCAAAGUCCAUAAAUCGC Mouse Invitrogen AgrnMSS201833 112 GGAGACCUGCCAGUUUAACUCUGUA AGRN (Stealth) 113 UACAGAGUUAAACUGGCAGGUCUCC AgrnMSS201834 114 AGGUUCCCUUCAGGUGGGCAAUGAA 115 UUCAUUGCCCACCUGAAGGGAACCU AgrnMSS201835 116 CCAAAGUCCUGUGAUUCCCAGCCUU 117 AAGGCUGGGAAUCACAGGACUUUGG Mouse Invitrogen MMP12MSS206678 118 GGAGCUCACGGAGACUUCAACUAUU MMP12 (Stealth) 119 AAUAGUUGAAGUCUCCGUGAGCUCC
[0166] The next set of experiments focused on identifying the key MMPs that mediate Agrin's mechanical functions in the wound environment. First, it was evaluated whether MMP 1, 10 and 12 independently affected keratinocyte migration following wound-scratch. Accordingly, knocking down MMP 1 and 10 reduced keratinocytes' migration that was not restored by sAgrin treatment (
[0167] MMP12 emerged as the most significant potential candidate for mediating Agrin's mechanotension in wound repair. Similar to its mRNA levels, MMP12 protein levels were significantly reduced upon Agrin depletion in a panel of immortalized and primary keratinocytes and dermal fibroblasts cultures (
[0168] It was next determined whether the activation of MMP12 is a consequence of Agrin's sensitization towards ECM rigidity in a wound injury associated Agrin-rich environment. First, HaCaT cells were cultured in soft substrates (0.8 kPa) alone or those with increasing concentration of supplemented sAgrin. Importantly, soft substrates incorporated with sAgrin strongly stabilized MMP12 protein levels in a dose-dependent fashion (
[0169] Several snippets of observations further imply that MMP12 mediated the Agrin induced collective migration post-wounding. Firstly, sAgrin failed to stimulate migration in MMP12 depleted human and mouse keratinocytes (
[0170] In reminiscence to the fact that MMP12 regulates Agrin-driven migration, it was rationalized MMP12 as a mediator of Agrin's mechanotension sensing in wound stressed keratinocytes. Accordingly, the next set of experiments was focused on determining the role of MMP12 in overhauling cytoskeletal tension in response to an Agrin-rich environment, as poised during early wound healing stages. The robust actomyosin cables generated in Agrin complacent keratinocytes post-wounding were severed by the depletion of MMP12 that accompanied with pronounced inhibition of pMLC at the wound edges (
[0171] Due to impaired collective migration upon MMP12 inhibition, it was examined whether reduced cytoskeletal tension is a consequence of progressive weakening in the mechanotransducing abilities of Agrin arising from MMP12 inhibition. To this end, the inventors first mapped the cell stiffness of MMP12 suppressed mouse keratinocytes during at 4 h post-injury. Strikingly, MMP12 knockdown significantly reduced the stiffness of migrating keratinocytes which were not restored by sAgrin treatment (
[0172] Agrin Fails to Heal Wounds in MMP12 Deficient Mouse Skin
[0173] To test whether sAgrin bestows a mechanically competent wound healing environment by engaging MMP12 in vivo, MMP12 was depleted by stealth siRNAs that efficiently suppressed cutaneous MMP12 levels at days 0 and 10 post-wounding (
[0174] Agrin as Bio-Additive in Hydrogel Material Accelerates Wound Healing
[0175] An Agrin-primed environment in wound closure prompted the inventors to test whether sAgrin, per se, accelerated in vitro and in vivo wound healing which may have clinical relevance as a wound healing biomaterial. The inventors generated sAgrin recombinant protein containing ‘z’ insert by gel-filtration that resulted in a purified protein corresponding to a size of 23 kDa (
[0176] Finally, using two independent full-thickness mouse punch-biopsy non-splinted and splinted wound healing models, the wound healing attributes of sAgrin versus control proteins when supplied as bio-additive were assessed in two different hydrogels for topical application. In the first paradigm, sAgrin or a control protein (BSA) was incorporated in Vaseline, as inert hydrogel material for topical delivery to the wounded skin following a non-splinted healing model. The healing efficacy promoted by different concentrations of sAgrin incorporated in Vaseline was determined. As shown, sAgrin significantly accelerated the healing rates of mice punch wounds in a dose-dependent fashion in a non-splinted wound healing model (
[0177] In addition, the efficacy of sAgrin in comparison to rat-tail collagen-I and BSA as bio-additives was tested using splinted wound healing mouse models. The incorporation of 200 ug sAgrin within Pluronic F127 significantly accelerated wound healing when compared to similar concentrations of collagen or BSA within the observed 12 days post-injury (
[0178] Prompt expression of inflammatory cytokines early during wound healing process is known to initiate an efficient skin healing program. Hence, it was next explored whether sAgrin selectively activated key cytokines and chemokines to modulate inflammatory responses associated with wound healing. The inventors profiled the mRNA expression of several cytokines and chemokines known to be induced within 48 hours after injury to the mouse skin. Among them, TGF-β1, VEGF-A, MCP-1, MIP-1β and MIP-2 were significantly induced in the mouse skin wounds within 48 h post-injury that received sAgrin treatment in comparison to BSA or Collagen treated groups (
[0179] To establish whether improved healing rates attributed by sAgrin occurs via sustaining angiogenesis in the wound beds would be of potential significance to the field of regenerative medicine. Consequently, on day 6 in non-splinted models, a steady enhancement in angiogenesis with an increased number of blood vessels and their respective diameters was observed in the Agrin treated mouse skin wound beds (
DISCUSSION
[0180] Wound healing represents a complicated yet highly orchestrated biological program restoring normalcy to damaged tissue architecture. Cutaneous wound healing is sequentially characterized by a homeostasis phase where damage signals trigger clot formation to restrict blood flow, followed by an inflammatory phase that debrides wounded cells. Next, a proliferative phase governs proliferation, survival and migration of keratinocytes over the wounded area in a process termed as re-epithelialization. Timely execution of all the above culminates towards wound closure and renovation of tissue integrity. As such, a prime criterion for effective keratinocytes migration following an injury is dependent on the rate of deposition of new extracellular matrix (ECM) and its components that subsequently trigger angiogenesis that favors the healing process.
[0181] In addition to the scaffolding functions, the ECM acts as a ‘dynamic communicative layer’ to its surrounding tissue often shielding from mechanical stress and/or instructing the tissues to equate the adverse extrinsic stress, thereby sustaining tissue integrity. Besides, the skin serves as an excellent mechanoreceptor organ to analyze how mechanical forces integrate within a structured tissue architecture to sustain key biological functions. Underscoring this dynamic mechano-feedback between the skin cells and its surrounding ECM, a plethora of soluble and matrix-bound proteins are spatiotemporally regulated by the ECM. During injury, a major chunk of ECM is lost rendering the underlying tissues incapable of responding to bulk extrinsic mechanical stress, a phenomenon called mechanoperception. The lack of mechanoperceiving ability upon inflicting an injury largely accounts for large-scale deficits in actomyosin tension affecting cell survival and migration. As an appealing hypothesis favoring early phases of wound healing, the de novo expression of key ECM proteins within a wound-healing niche may recondition the underlying skin tissues by improving mechanoperception and potentially reinstating the mechanoreciprocity between the ECM and skin tissues. On this premise, an overarching interest is to identify key ECM components that integrate mechanical stimuli and establish mechanoperception within wounded cells, thereby adapting them to a wound-stressed environment.
[0182] In this study, the inventors investigated whether Agrin tunes a mechanically competent wound microenvironment enforcing skin tissue repair by improving keratinocyte mechanoperception.
[0183] Upon tissue injury, composite changes to the disorganized ECM and its surrounding tissues that integrate a collage of mechanical forces, tissue compression, bulk stress from the ECM, and collective migration of cells are required to initiate the healing program. Notably, concerted efforts to replenish the wounded ECM that sensitize the wound environment towards adverse physical stresses leading into a productive healing response and limits hypertrophic scarring are of utmost importance in regenerative medicine. Comprehensive lines of evidence presented here uncovers several important findings that advance our understanding of mechanobiology in wound healing and offer immense significance to tissue repair strategies. Firstly, Agrin represents a vital ECM proteoglycan whose expression is triggered in the wounded skin tissue and this Agrin-enriched microenvironment tunes the mechanical landscape for productive wound healing (
[0184] Epithelial cells experience a wide array of physical stresses that include ECM rigidity, topographic changes in cell shape and geometry, lack of adhesion, and application of mechanical forces. Each of these parameters dictates cell behavior in a wound environment, however, the nature of ECM proteins that enable wounded cells to respond to such physical parameters are less known. Driving this conviction, Agrin, in part, sensitized keratinocytes to enforce collective migration in response to several physical parameters including bulk ECM rigidity, shift cytoskeletal tension upwards in geometrically constrained architectures, and act as localized mechanotransducer when extrinsic forces are applied to wounded cells (
[0185] The dynamic ECM reorganization of an Agrin-enriched environment-induced shortly after wounding remains yet to be fully established. The transcriptomic data in this study reveals an overall loss of collagens and ECM structural components in Agrin depleted keratinocytes. Given that Agrin depletion delays wound healing, it is evident that Agrin confers comprehensive ECM reorganization signals via MMP12 to sustain wound healing.