Chimeric antigen receptors comprising a human transferrin epitope sequence

11725053 · 2023-08-15

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention is directed to a chimeric antigen receptor fusion protein comprising: (i) a single-chain variable fragment (scFv) comprising V.sub.H and V.sub.L, wherein scFv has an activity against a tumor antigen, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain; wherein the CAR further comprises a human transferrin fragment, which is an epitope for an antibody against human transferrin, at N-terminus or C-terminus to scFv, or between V.sub.H and V.sub.L. Preferred tumor antigens are CD19, CD22 and BCMA. The CD19-TF-CAR-T cells, CD22-TF-CAR-T cells, and BAMA-TF CAR-T cells secrete less cytokines, but they have the same efficacy against cancer target cells when comparing with same CAR without TF.

Claims

1. A chimeric antigen receptor (CAR) comprising from N-terminal to C-terminal: an extracellular domain comprising a single-chain variable fragment (scFv) comprising VH and VL, wherein scFv binds to a tumor antigen, a human transferrin fragment having the amino acid sequence of KNPDPWAKNLNEKDY (SEQ ID NO: 1, TF), 2-5 TFs, or 1/2 TF having the amino sequence of KNLNEKDY (SEQ ID NO: 2), wherein the transferrin fragment is C-terminus to the scFv; a transmembrane domain; and an intracellular domain comprising: at least one co-stimulatory domains, and an activating domain.

2. The CAR according to claim 1, wherein the tumor antigen is selected from the group consisting of: CD19, CD22, BCMA, VEGFR-2, CD20, CD30, CD25, CD28, CD30, CD33, CD47, CD52, CD56, CD80, CD81, CD86, CD123, CD171, CD276, B7H4, CD133, EGFR, GPC3; PMSA, CD3, CEACAM6, c-Met, EGFRvIII, ErbB2/HER-2, ErbB3/HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, FLT1, KDR, FLT4, CD44v6, CD151, CA125, CEA, CTLA-4, GITR, BTLA, TGFBR2, TGFBR1, IL6R, gp130, Lewis A, Lewis Y, TNFR1, TNFR2, PD1, PD-L1, PD-L2, HVEM, MAGE-A, mesothelin, NY-ESO-1, PSMA, RANK, ROR1, TNFRSF4, CD40, CD137, TWEAK-R, LTPR, LIFRP, LRP5, MUC1, TCRa, TCRp, TLR7, TLR9, PTCH1, WT-1, Robol, a, Frizzled, OX40, CD79b, and Notch-1-4.

3. The CAR according to claim 2, wherein the tumor antigen is CD19.

4. The CAR according to claim 3, wherein (a) the VH has the amino acid sequence of SEQ ID NO: 6 and VL has the amino acid sequence of SEQ ID NO: 4, or (b) the VH has the amino acid sequence of SEQ ID NO: 16 and the VL has the amino acid sequence of SEQ ID NO: 14.

5. The CAR according to claim 2, wherein the tumor antigen is CD22.

6. The CAR according to claim 5, wherein the VH has the amino acid sequence of SEQ ID NO: 17 and the VL has the amino acid sequence of SEQ ID NO: 18.

7. The CAR according to claim 2, wherein the tumor antigen is BCMA.

8. The CAR according to claim 7, wherein (a) the VH has the amino acid sequence of SEQ ID NO: 22 and the VL has the amino acid sequence of SEQ ID NO: 23, or (b) the VH has the amino acid sequence of SEQ ID NO: 26 and the VL has the amino acid sequence of SEQ ID NO: 27, or (c) the VH has the amino acid sequence of SEQ ID NO: 29 and the VL has the amino acid sequence of SEQ ID NO: 30, or (d) the VH has the amino acid sequence of SEQ ID NO: 31 and VL has the amino acid sequence of SEQ ID NO: 32.

9. The CAR according to claim 1, wherein the co-stimulatory domain is selected from the group consisting of CD28, 4-1BB, ICOS-1, CD27, OX-40, GITR and DAP10.

10. The CAR according to claim 1, wherein the co-stimulatory domain is CD28.

11. The CAR according to claim 1, wherein the human transferrin fragment has the amino acid sequence of SEQ ID NO: 1.

12. The CAR according to claim 11, which has the amino acid sequence of SEQ ID NO: 11 or at least 95% sequence identity thereof.

13. The CAR according to claim 1, wherein the human transferrin fragment has the amino acid sequence of 2 TF.

14. The CAR according to claim 13, which has the amino acid sequence of SEQ ID NO: 13 or at least 95% sequence identity thereof.

15. The CAR according to claim 1, wherein the human transferrin fragment has the amino acid sequence of SEQ ID NO: 2.

16. The CAR according to claim 15, which has the amino acid sequence of SEQ ID NO: 12 or at least 95% sequence identity thereof.

17. The CAR according to claim 1, wherein the scFv comprises from N-terminal to C-terminal the VL, a linker, and the VH, and the linker has the amino acid sequence of SEQ ID NO: 5.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1. The structures of first, second, and third generation of CAR. The left panel shows the structure of first generation (no co-stimulation domains), the middle panel shows the second generation (one co-stimulation domain CD28 or 4-BB), and the right panel show the third generation of CAR (two or several co-stimulation domains) [5].

(2) FIG. 2. Structures of CD19-TF-CAR, CD22-TF-CAR and BCMA-TF-CAR. CD19-CAR, CD22-CAR, and BCMA-CAR are shown as controls. GM-CSF is used as a leader sequence for CD19-CAR and CD22 CAR constructs. CD8 leader signaling sequence is used for BCMA-CAR. 1/2 TF; TF or 2xTF are shown at the end of CD19 scFv, CD22 scFv and BCMA scFv, each consisting of a variable fragment of heavy chain; a variable fragment of light chain; and a linker. TM is transmembrane domain; CD28 is CD28 co-activation domain. CD19 scFv has VL-linker-VH structure.

(3) FIG. 3. TF antibodies generated against 15 amino-acid TF epitope detect CD19-TF and CD22-TF-CAR. FACS analysis with TF-PE antibody (X-axis) and CD3-APC antibody as described in Example 5 (Y-axis) is shown. >20% of CD19 and CD22-TF-CAR-T cells are TF+ positive at 14 days of expansion.

(4) FIG. 4. Real-time cytotoxicity assay (RTCA) with CD19-positive Hela cervical cancer cells. RTCA plot. 10:1 ratio of Effector to Target cells was used. T cells, Mock-CAR-T cells were used as negative control cells against Hela-CD19-posirive cells. The CD19-TF and CD19-CAR-T cells effectively killed Hela-CD19-posirive cells.

(5) FIG. 5. Real-time cytotoxicity assay with CD19-positive and CD22-positive Raji lymphoma cells. The RTCA assay showed high cytotoxic activity of CD19-TF and CD22-TF-CAR-T cells against Raji cells.

(6) FIG. 6. Secretion of IFN-gamma by CD19-TF-CAR-T cells is significantly less than by CD19 CAR-T cells against Raji cells. E:T (effector cells: Target cells) ratio was 10:1. *p<0.01 CD19-TF versus CD19-CAR-T cells. The level of secretion of cytokines was normalized to the level of CAR-expression.

(7) FIG. 7. Secretion of IFN-gamma by C CD22-TF-CAR-T cells is significantly less than by CD22-CAR-T cells against Raji cells. *p<0.01, CD22-TF versus CD22-CAR-T cells. The level of secretion of cytokines was normalized to the level of CAR-expression.

(8) FIG. 8. Secretion of IL-2 by CD19-TF-CAR-T cells is less than by CD19 CAR-T cells against Raji cells. E:T ratio was 10:1. The level of secretion of cytokines was normalized to the level of CAR-expression.

(9) FIG. 9. Secretion of IL-6 by CD19-TF-CAR-T cells is significantly less than by CD19 CAR-T cells against Raji cells. E:T ratio was 10:1. The level of secretion of cytokines was normalized to the level of CAR-expression. *p<0.02, CD19-TF versus CD19-CAR-T cells. The level of secretion of cytokines was normalized to the level of CAR-expression

(10) FIG. 10. CD19-1/2TF and CD19-2TF-CAR have same cytotoxic activity as CD19-CAR against target Hela-CD19 cells. RTCA assay was used with target cells (E:T=10:1). N=3, average plus standard deviations are shown.

(11) FIG. 11. CD19-1/2TF-CAR and CD19 2TF-CAR have same cytotoxic activity as CD19-CAR against target Raji cells. RTCA assay was used with target cells (E:T=10:1).

(12) FIG. 12. Secretion of IL-2 is significantly less by BCMA-TF-CAR-T cells than by BCMA-CAR-T cells against multiple myeloma cells. BCMA-A-CAR-T cells had similar secretion of IL-2 as BCMA-B-CAR-T cells (now shown). p<0.05, BCMA (Clones A and B)-TF-CAR-T cells secreted significantly less IL-2 than BCMA-Clone B-CAR-T cells.

(13) FIGS. 13A-D. CD19-TF-CAR-Tcells significantly decrease Raji tumor growth in vivo and prolong mouse survival. A. IVIS imaging shows significantly decreased number of Raji-luciferase-positive cells in case of CAR-T-treated mice. B. Shows quantification of the BLI (bioluminescence) signal. C. Kaplan-Meier survival plot. P<0.05 CAR-T treated versus PB S-treated mice. D, Detection of CD19-CAR-T cells in mouse blood in Raji xenograft mouse model after treatment with CAR-T cells. FACS staining with either CD19scFv Ab (for CD19) and TF antibodies for CD19-TF-CAR-T cells) was performed. Y-axis shows increased number of CD19-CAR-T cells in mouse blood.

DETAILED DESCRIPTION OF THE INVENTION

Definitions

(14) As used herein, a “chimeric antigen receptor (CAR)” means a fused protein containing an extracellular domain capable of binding to an antigen, a transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain. The “chimeric antigen receptor (CAR)” is sometimes called a “chimeric receptor”, a “T-body”, or a “chimeric immune receptor (CIR).” The “extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen. The “intracellular domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.

(15) As used herein, a “domain” means one region in a polypeptide which is folded into a particular structure independently of other regions.

(16) As used herein, a transferrin epitope (TF), is a 15 amino acid polypeptide human transferrin motif (epitope for TF antibody binding): having a sequence of K N P D P W A K N L N E K D Y (SEQ ID NO: 1), it is an epitope for binding to transferrin antibody. TF is 564 to 578 amino-acids of human transferrin (protein sequence is available in Uniprot UP02787; uniprot.org/uniprot/P02787. It can be fused to the C-terminus or the N-terminus of a protein, or inserted within an extracellular domain of protein. 2TF, 3TF, 4TF, and 5TF each is a repeat of the 15 amino acid sequence of TF 2-5 times, respectively. 1/2TF is second half of TF, i.e. KNLNEKDY (SEQ ID NO: 2). “A TF sequence”, as used herein, includes TF, 1/2TF, and 2-5TF such as 2TF and 3TF.

(17) As used herein, a “single chain variable fragment (scFv)” means a single chain polypeptide derived from an antibody which retains the ability to bind to an antigen. An example of the scFv includes an antibody polypeptide which is formed by a recombinant DNA technique and in which Fv variable regions of immunoglobulin heavy chain (H chain) and light chain (L chain) fragments are linked via a spacer sequence. Various methods for preparing an scFv are known to a person skilled in the art.

(18) As used herein, a “tumor antigen” means a biological molecule having antigenicity, expression of which causes cancer.

(19) The inventors have discovered that adding a TF sequence to the N-terminal or C-terminal of ScFv, or in between V.sub.H and V.sub.L. in CAR provides advantages over conventional CAR. The addition of a TF sequence in CAR allows easy detection of CAR-positive cells by using an antibody against transferrin or TF. The addition of TF sequence in CAR also allows to track CAR-T cells in vivo, which can be used for imaging in clinics, and detecting the persistence and longevity of CAR-Tcells. The addition of a TF sequence to CD19-CAR, CD22-CAR and BCMA-CARs leads to safer CAR-T cells with less secretion of cytokines.

(20) The present invention is directed to a chimeric antigen receptor fusion protein comprising from the N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) comprising VH and V.sub.L, wherein scFv has an activity against a tumor antigen, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain; wherein the fusion protein further comprises a TF sequence (TF, 1/2 TF, or 2-5 TF) either at the N-terminus to ScFv, or between V.sub.H and V.sub.L, or at the C-terminus to ScFv, i.e., between V.sub.L or V.sub.H and the transmembrane domain.

(21) In one embodiment, the tumor antigen is selected from the group consisting of: CD19, CD22, BCMA (CD269, TNFRSF17), VEGFR-2, CD4, CD20, CD30, CD25, CD28, CD30, CD33, CD47, CD52, CD56, CD80, CD81, CD86, CD123, CD171, CD276, B7H4, CD133, EGFR, GPC3; PMSA, CD3, CEACAM6, c-Met, EGFRvIII, ErbB2/HER-2, ErbB3/HER3, ErbB4/HER-4, EphA2, IGF1R, GD2, O-acetyl GD2, O-acetyl GD3, GHRHR, GHR, FLT1, KDR, FLT4, CD44v6, CD151, CA125, CEA, CTLA-4, GITR, BTLA, TGFBR2, TGFBR1, IL6R, gp130, Lewis A, Lewis Y, TNFR1, TNFR2, PD1, PD-L1, PD-L2, HVEM, MAGE-A, mesothelin, NY-ESO-1, PSMA, RANK, ROR1, TNFRSF4, CD40, CD137, TWEAK-R, LTPR, LIFRP, LRP5, MUC1, TCRa, TCRp, TLR7, TLR9, PTCH1, WT-1, Robol, a, Frizzled, OX40, CD79b, and Notch-1-4. In a preferred embodiment, the tumor antigen is CD19, CD22, or BCMA.

(22) In one embodiment, the co-stimulatory domain is selected from the group consisting of CD28, 4-1BB, GITR, ICOS-1, CD27, OX-40 and DAP10. A preferred the co-stimulatory domain is CD28.

(23) A preferred activating domain is CD3 zeta (CD3 Z or CD3ζ)

(24) The transmembrane domain may be derived from a natural polypeptide, or may be artificially designed. The transmembrane domain derived from a natural polypeptide can be obtained from any membrane-binding or transmembrane protein. For example, a transmembrane domain of a T cell receptor α or β chain, a CD3 zeta chain, CD28, CD3ε, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, ICOS, CD154, or a GITR can be used. The artificially designed transmembrane domain is a polypeptide mainly comprising hydrophobic residues such as leucine and valine. It is preferable that a triplet of phenylalanine, tryptophan and valine is found at each end of the synthetic transmembrane domain. Optionally, a short oligopeptide linker or a polypeptide linker, for example, a linker having a length of 2 to 10 amino acids can be arranged between the transmembrane domain and the intracellular domain. In one embodiment, a linker sequence having a glycine-serine continuous sequence can be used.

(25) The insertion of a TF sequence increases functional activities of CAR-T cells to attack tumor cells more effectively and safely.

(26) CD19-TF-CAR, CD19-1/2TF-CAR, CD19-2TF-CAR, CD22-TF-CAR, and BCMA-TF-CAR of the present invention are illustrated in FIG. 2 (A-C). ScFv can be VH-linker-VL or VL-linker-VH. In FIG. 2, it is shown that a TF sequence (TF, or 1/2TF, or 2TF) is at the C-terminal end of scFv, however, the TF sequence can also be at the N-terminus of the scFv, or in between VH and VL. The TF epitope sequence should be in the extracellular domain, and not in the intracellular domain so as to be recognized by the anti-TF-antibody.

(27) CD19 and CD22 cell surface antigens are highly expressed in many types of hematologic cancers [2, 6-8]. BCMA is a B-cell maturation antigen (CD269, TNFSR17) that is overexpressed in multiple myeloma (MM) (6). The present invention provides several new constructs. The CD19-TF-CAR construct has similar activity as CD19-CAR. However, CD19-TF-CAR provides advantages over CD19-CAR in clinic, because the presence of TF in CD19-TF-CAR allows the selection of CD19+/−CAR cells during manufacturing with anti-TF antibody-conjugated beads; it also allows to image cells in vivo with a TF antibody. CD22-TF-CAR and BCMA-TF-CAR also have the same advantages for use in clinic as described above for CD19-TF-CAR. BCMA-TF-CAR is useful in treating multiple myeloma. All three constructs (CD19-TF-CAR, CD22-TF-CAR and BCMA-TF-CAR have demonstrated decreased secretion of cytokines, which suggests their increased safety in clinic.

(28) The present invention provides a nucleic acid encoding the TF-containing CARs. The nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by a conventional method. A base sequence encoding an amino acid sequence can be obtained from the aforementioned NCBI RefSeq IDs or accession numbers of GenBenk for an amino acid sequence of each domain, and the nucleic acid of the present invention can be prepared using a standard molecular biological and/or chemical procedure. For example, based on the base sequence, a nucleic acid can be synthesized, and the nucleic acid of the present invention can be prepared by combining DNA fragments which are obtained from a cDNA library using a polymerase chain reaction (PCR).

(29) A nucleic acid encoding the CAR of the present invention can be inserted into a vector, and the vector can be introduced into a cell. For example, a virus vector such as a retrovirus vector (including an oncoretrovirus vector, a lentivirus vector, and a pseudo type vector), an adenovirus vector, an adeno-associated virus (AAV) vector, a simian virus vector, a vaccinia virus vector or a sendai virus vector, an Epstein-Barr virus (EBV) vector, and a HSV vector can be used. A virus vector lacking the replicating ability so as not to self-replicate in an infected cell is preferably used.

(30) For example, when a retrovirus vector is used, a suitable packaging cell based on a LTR sequence and a packaging signal sequence possessed by the vector can be selected for preparing a retrovirus particle using the packaging cell. Examples of the packaging cell include PG13 (ATCC CRL-10686), PA317 (ATCC CRL-9078), GP+E-86 and GP+envAm-12, and Psi-Crip. A retrovirus particle can also be prepared using a 293 cell or a 293T cell having high transfection efficiency. Many kinds of retrovirus vectors produced based on retroviruses and packaging cells that can be used for packaging of the retrovirus vectors are widely commercially available from many companies.

(31) A CAR-T cell binds to a specific antigen via the CAR, thereby a signal is transmitted into the cell, and as a result, the cell is activated. The activation of the cell expressing the CAR is varied depending on the kind of a host cell and an intracellular domain of the CAR, and can be confirmed based on, for example, release of a cytokine, improvement of a cell proliferation rate, change in a cell surface molecule, or the like as an index. For example, release of a cytotoxic cytokine (a tumor necrosis factor, lymphotoxin, etc.) from the activated cell causes destruction of a target cell expressing an antigen. In addition, release of a cytokine or change in a cell surface molecule stimulates other immune cells, for example, a B cell, a dendritic cell, a NK cell, and a macrophage.

(32) The cell expressing the CAR can be used as a therapeutic agent for a disease. The therapeutic agent comprises the cell expressing the CAR as an active ingredient, and it may further comprise a suitable excipient.

(33) The inventors have generated CD19-TF-CAR-Tcells and CD22-TF-CAR-Tcells against hematologic malignancies (leukemia, lymphoma, and myeloma), which have high killing activity against cancer cells overexpressing CD19 or CD22. The inventors have provided data demonstrating efficient transduction efficiency of T cells transduced with CD19-TF lentiviral construct. The inventors have demonstrated high cytotoxic activity of CD19-TF-CAR-T cells against cancer cells by real-time cytotoxicity assay with cervical cancer cell line Hela stably overexpressing CD19 antigen. The inventors have also demonstrated CD19-TF-CAR-T cells significantly decrease Raji tumor growth in vivo and prolong mouse survival when compared with CD19-Car-T cells. Secretion of cytokines IL-2, and/or IL-6) is significantly less by CD19-TF-CAR-T, CD22-TF-CAR-T, and BCMA-TF-CAR-T cells than by CD19-CAR-T, CD22-CAR-T, and BCMA-CAR-T cells, respectively, against cancer cells.

(34) Inserting a TF sequence of the present invention in CARs does not generate an adverse immune response in humans because the TF sequence is derived from humans. CD19-TF-CAR-Tcells, CD22-TF-CAR-T cells and BCMA-TF-CAR-T cells can be sorted by flow cytometry or by anti-TF antibody-conjugated magnetic beads during manufacturing for enrichment of cytotoxic cells with higher activity. This enrichment approach can be used to generate other CARs for other tumor antigen targets.

(35) The same strategy can be applied to CAR construct using natural killer cells (NK-92 and primary human natural killer cells).

(36) The inventors also developed a new rabbit monoclonal TF-antibody. This antibody can be humanized for use in clinic.

(37) Combination therapy with (i) dual CD19-TF-CAR-T cells and CD22-TF-CAR-T cells, (ii) dual CD19-TF-CAR-T cells and BCMA-TF-CAR-T cells, or (iii) dual BCMA-TF-CAR-T plus other multiple myeloma marker (CS-1, CD138, CD38)-CAR-T, can be used to increase activity of single CAR-T cell-therapy, and can be used safely with less cytokines secretion. The dual CAR-TF-CAR-T cells can be generated with construct with two CARs, or by co-administration of two CARs, or by co-transduction of two CARs.

(38) Combination therapy with bi-specific CD19-CD22-TF-CAR-T, or bi-specific BCMA-plus another ScFv against any of multiple myeloma markers such as CD38, CD319, CD138, CD33-CAR-T cells, can used to increase activity of single CAR-T cell-therapy.

(39) Combination therapy with CD19-TF-CAR and chemotherapy or inhibitors of immune checkpoints (PD-1, CTLA-4 and other) can used to increase activity of single CAR.

(40) Dual or bi-specific CD19/CD22-TF-CAR-Tcells can kill Raji leukemia cell and secrete less cytokines.

(41) Dual or bi-specific-BCMA-TF and multiple myeloma antigen (CD138, CD38, CD319, CD138) CAR-T cells can kill multiple myeloma and secrete less cytokines.

(42) Co-transduction of (i) CD19-TF and CD22-TF lentiviral CAR, or (ii) BCMA and another multiple myeloma antigens, results in generation of CAR-T cells with same or less cytokine secretion against target cancer cells.

(43) The following examples further illustrate the present invention. These examples are intended merely to be illustrative of the present invention and are not to be construed as being limiting.

EXAMPLES

Example 1. CAR Constructs

(44) Mouse FMC63 anti-CD19 scFv (Kochenderfer et al (2009), I. Immunother, 32:689-702) was inserted into a second-generation CAR cassette containing a signaling peptide from GM-CSF, a hinge region, transmembrane domain and costimulatory domain from CD28, and the CD3 zeta activation domain; this CAR is herein called the CD19 CAR. The TF sequence (K N P D P W A K N L N E K D Y, SEQ ID NO: 1) was inserted into the CD19 CAR between the scFv and hinge region; this CAR is herein called the CD19-TF CAR.

(45) The VH and VL for CD22 scFv was taken from monoclonal 971 human CD22 Antibody (US Publication No. 20110020344).

(46) Each BCMA scFv was obtained from a BCMA antibody from Promab Technologies (Richmond, Calif.). A “mock” CAR was prepared with an scFv specific for an intracellular protein—and thus a “mock” CAR was not reactive with intact cells.

Example 2. Sequences of CD19-CAR Constructs

(47) Two anti-CD19 ScFv's were used to prepare two CD19-TF-CARs; one from mouse FMC63 anti-CD19 scFv, and another one from humanized clone 11. The sequence of each segment is shown below. Each segment can be replaced with an amino acid sequence having at least 95%, 98%, or 99% identity, wherein the amino acid variation in ScFv is in the framework outside of the CDR regions.

(48) The constructs of CD19-CAR, CD19-TF-CAR, CD19-1/2TF, and DC19-2TF are shown in FIG. 2.

(49) TABLE-US-00001 1. Mouse FMC 63 <Human GM-CSF Signal peptide> SEQ ID NO: 3 MLLLVTSLLLCELPHPAFLLIP FMC63 anti-CD19 scFv (VL-Linker-VH) <VL> SEQ ID NO: 4 D I Q M T Q T T S S L S A S L G D R V T I S C R A S Q D I S K Y L N W Y Q Q K P D G T V K L L I Y H T S R L H S G V P S R F S G S G S G T D Y S L T I S N L E Q E D I A T Y F C Q Q G N T L P Y T F G G G T K L E I T <linker> SEQ ID NO: 5 G S T S G S G K P G S G E G S T K G <VH> SEQ ID NO: 6 E V K L Q E S G P G L V A P S Q S L S V T C  T V S G V S L P D Y G V S W I R Q P P R K G L E W L G V I W G S E T T Y Y N S A L K S R  L T I I K D N S K S Q V F L K Met N S L Q T D D T A I Y Y C A K H Y Y Y G G S Y A M D Y  W G Q G T S V T V S S
In one embodiment as illustrated herein, 3 amino acids AAA are included after VH.

(50) TABLE-US-00002 <TF sequence> if present, after VH or VL (scFv), SEQ ID NO: 1 K N P D P W A K N L N E K D Y The TF sequence was inserted between the scFv and the CD28 hinge region of the CD19-specific CAR. <Human CD28 hinge> SEQ ID NO: 7 I E V M Y P P P Y L D N E K S N G T I I H V K G K H L C P S P L F P G P S K P <Transmembrane Domain TM28> SEQ ID NO: 8 F W V L V V V G G V L A C Y S L L V T V A F I I F W V <Co-stimulating domain human CD28> SEQ ID NO: 9 R S K R S R L L H S D Y M N M T P R R P G P T R K H Y Q P Y A P P R D F A A Y R S <Activation domain human CD3-zeta> SEQ ID NO: 10 R V K F S R S A D A P A Y Q Q G Q N Q L Y N E L N L G R R E E Y D V L D K R R G R D P E M G G K P R R K N P Q E G L Y N E L Q  K D K M A E A Y S E I G M K G E R R R G K
CD19-TF-CAR sequence with mouse FMC 63 scFv can be shown as SEQ ID NO: 11, TF is bold and underlined, CD19scFV is in Italic font:

(51) TABLE-US-00003 M L L L V T S L L L C E L P H P A F L L I P DIQ MTOTTSSLSASLGDRVTISCRASOD ISKYLNWYQQKPDGTVKLLIYHTSR LHSGVPSRFSGSGSGTDYSLTISNL EQEDIATYFCQOGNTLPYTFGGGTK LEITGSTSGSGKPGSGEGSTKGEVK LQESGPGLVAPSOSLSVTCTVSGVS LPDYGVSWIRQPPRKGLEWLGVIWG SETTYYNSALKSRLTIIKDNSKSQV FLKMNSLQTDDTAIYYCAKHYYYGG SYAMDYWGQGTSVTVSSAAAKNPDP WAKNLNEKDY I E V M Y P P P Y L D N E K S N G T I I H V K G K H L C P S P L F P G P S K P F W V L V V V G G V L A C Y S L L V T V A F I I F W V R S K R S R L L H S D Y M N M T P R R P G P T R K H Y Q P Y A P P R D F A A Y R S R V K F S R S A D A P A Y Q Q G Q N Q L Y N E L N L G R R E E Y D V L D K R R G R D P E M G G K P R R K N P Q E G L Y N E L Q K D K M A E A Y S E I G M K G E R R R G K G H D G L Y Q G L S T A T K D T Y D A L H M Q A L P P R
In one embodiment, 8 amino-acid of TF (1/2 TF) was used.

(52) TABLE-US-00004 <1/2 TF SEQUENCE> SEQ ID NO 2 KNLNEKDY, <CD 19-1/2TF-CAR>, 1/2TF sequence is shown in bold, underlined. SEQ ID NO:12 M L L L V T S L L L C E L P H P A F L L I P D I Q M T Q T T S S L S A S L G D R V T I S C R A S Q D I S K Y L N W Y Q Q K P D G T V K L L I Y H T S R L H S G V P S R F S G S G S G T D Y S L T I S N L E Q E D I A T Y F C Q Q G N T L P Y T F G G G T K L E I T G S T S G S G K P G S G E G S T K G E V K L Q E S G P G L V A P S Q S L S V T C T V S G V S L P D Y G V S W I R Q P P R K G L E W L G V I W G S E T T Y Y N S A L K S R L T I I K D N S K S Q V F L K M N S L Q T D D T A I Y Y C A K H Y Y Y G G S Y A M D Y W G Q G T S V T V S S A A A KNLNE KDY I E V M Y P P P Y L D N E K S N G T I I H V K G K H L C P S P L F P G P S K P F W V L V V V G G V L A C Y S L L V T V A F I I F W V R S K R S R L L H S D Y M N M T P R R P G P T R K H Y Q P Y A P P R D F A A Y R S R V K F S R S A D A P A Y Q Q  G Q N Q L Y N E L N L G R R E E Y D V L D K R R G  R D P E M G G K P R R K N P Q E G L Y N E L Q K D  K M A E A Y S E I G M K G E R R R G K G H D G L Y   Q G L S T A T K D T Y D A L H MQ A L P P R
In one embodiment, 2 TF was used,
CD19-2TF-CAR was generated with two TF sequences after CD19 ScFv; its sequence is shown below. Two TF sequences are marked bold and underlined.

(53) TABLE-US-00005 (SEQ ID NO: 13) M L L L V T S L L L C E L P H P A F L L I P D I Q M T Q T T S S L S A S L G D R V T I S C R A S Q D I S K Y L N W Y Q Q K P D G T V K L L I Y H T S R L H S G V P S R F S G S G S G T D Y S L T I S N L E Q E D I A T Y F C Q Q G N T L P Y T F G G G T K L E I T G S T S G S G K P G S G E G S T K G E V K L Q E S G P G L V A P S Q S L S V T C T V S G V S L P D Y G V S W I R Q P P R K G L E W L G V I W G S E T T Y Y N S A L K S R L T I I K D N S K S Q V F L K M N S L Q T D D T A I Y Y C A K H Y Y Y G G S Y A M D Y W G Q G T S V T V S S A A A KNPDP WAKNLNEKDYKNPDPWAKNLNEKDY I E V M Y P P P Y L D N E K S N G T I I H V K G K H L C P S P L F P G P S K P F W V L V V V G G V L A C Y S L L V T V A F I I F W V R S K R S R L L H S D Y M N M T P R R P G P T R K H Y Q P Y A P P R D F A A Y R S R V K F S R S A D A P A Y Q Q G Q N Q L Y N E L N L G R R E E Y D V L D K R R G R D P E M G G K P R R K N P Q E G L Y N E L Q K D K M A E A Y S E I G M K G E R R R G K G H D G L Y Q G L S T A T K D T Y D A L H M Q A L P P R
2. CD19 Humanized-Clone 11
Clone 11 ScFv (VL-linker-VH) was used to generated CD19-TF-CAR.
The VL, VH, and linker sequences are shown below. The CDR regions are bolded.

(54) TABLE-US-00006 <VL> SEQ ID NO: 14 DIQNITQSPSSLSASVGDRVTITCRASQDISKYLNWYQQKPGKAYK LLIYHTSRLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQG NTLPYTFGGGTKVEIK <VH> SEQ ID NO: 16 QVQLQESGPGLVKPSETLSLTCTVSGcustom character SLPDYGVSWIRQPPGKGL EWIGVIWGSETTYYNSALKSRVTISVDTSKNQFSLKLSSVTAADTA VYYCAKHYYYGGSYAMDYWGQGTLVTVSS
<Linker> SEQ ID NO: 15
CD19-TF-CAR containing humanized-clone 11, ScFv was prepared; the CAR sequence is similar to SEQ ID NO: 11 except VL and VH.

Example 3. Sequences of CD22-CAR Construct

(55) The CD22-TF-CAR is shown in FIG. 2. Human CD22 m971 scFV was used to generate CD22-TF CAR sequence. The sequence of each segment is shown below. Each segment can be replaced with an amino acid sequence having at least 95%, 98%, or 99% identity, wherein the amino acid variation in ScFv is in the framework outside of the CDR regions.

(56) Human GM-CSF Signal peptide (see Example 2) was used in the CAR construct.

(57) TABLE-US-00007 <CD22 VH> SEQ ID NO: 17 QVQLQQSGPGLVKPSQTLSLTCAI SGDSVSSNSAAWNWIRQSPSRGLE WLGRTYYRSKWYNDYAVSVKSRIT INPDTSKNQFSLQLNSVTPEDTAV YYCAREVTGDLEDAFDIWGQGTMV TVSS <CD22 VL> SEQ ID NO: 18 DIQMTQSPSSLSASVGDRVTITCR ASQTIWSYLNWYQQRPGKAPNLLI YAASSLQSGVPSRFSGRGSGTDFT LTISSLQAEDFATYYCQQSYSIPQ TFGQGTKLEIK
The sequence of CD22-TF-CAR is shown below. CD22 ScFv containing VH-linker-VL is shown by Italic font. Linker is GGGGSGGGGSGGGGS (SEQ ID NO:19)
TF is shown bold and underlined.

(58) TABLE-US-00008 (SEQ ID NO: 20) M L L L V T S L L L C E L P H P A F L L I P QV Q LQQSGPGLVKPSQTLSLTCAISG DSVSSNSAAWNWIRQSPSRGLEWL GRTYYRSKWYNDYAVSVKSRITIN PDTSKNQFSLQLNSVTPEDTAVYY CAREVTGDLEDAFDIWGQGTMVTV SS G G G G S G G G G S G G G G S DIQMTQS PSSLSASVGDRVTITCRASQTIWS YLNWYQQRPGKAPNLLIYAASSLQSGVPSRFSGRGSGTDFTLTISSLQ AEDFATYYCQQSYSIPQTFGQGTK LEIKKNPDPWAKNLNEKDY I E V M Y P P P Y L D N E K S N G T I I H V K G K H L C P S P L F P G P S K P F W V L V V V G G V L A C Y  S L L V T V A F I I F W V R S K R S R L L H S D  Y M N M T P R R P G P T R K H Y Q P Y A P P R D  F A A Y R S R V K F S R S A D A P A Y Q Q G Q N  Q L Y N E L N L G R R E E Y D V L D K R R G R D  P E M G G K P R R K N P Q E G L Y N E L Q K D K  M A E A Y S E I G M K G E R R R G K G H D G L Y Q G L S T A T K D T Y D A L H M Q A L P P R

Example 4. Sequences of BCMA-CAR Constructs

(59) The construct of BCMA-TF-CAR is shown in FIG. 2.

(60) Four ScFv's were used to prepare CAR; one from Clone A (mouse), one from Clone B (mouse), one from Clone 7 (humanized), and one from Clone 7B5B4 (humanized). The sequence of each segment is shown below. Each segment can be replaced with and amino acid sequence having at least 95%, 98%, or 99% identity, wherein the amino acid variation in ScFv is in the framework outside of the CDR regions.

(61) 1. BCMA-Clone A

(62) Human CD8 leader signaling sequence is used for BCMA-CAR.

(63) TABLE-US-00009 <CD8 leader signaling sequence>: SEQ ID NO: 21 M A L P V T A L L L P L A L L L H A A R P
In between the CD8 leader sequence and ScFv sequence, there are two amino acids AS connecting leader and ScFv, this is enzyme (Nhe I) site flanking scFv from 5′ end

(64) TABLE-US-00010 BCMA Clone A (Promab Biotechnologies) ScFv was used to generate BCMA-TF CAR. <BCMA VH, Clone A> SEQ ID NO: 22 QVQVVESGGGLVKPGGSLKLSCVVS GFAFSSYDMSWVRQTPEKRLEWVAY INSGGYITYYLDTVKGRFTISRDNA KNILYLQMNSLKSEDSALYYCVPGF AHWGQGTLVIVS <Linker> SEQ ID NO: 19 GGGGSGGGGSGGGGS <BCMA, Clone A VL> SEQ ID NO: 23 DIVMTQAAPSVPVTPGESVSISCR SNKSLLHSNGNTYLYWFLQRPGQS PQLLIYRMSNLASGVPDRFSGSGS GTAFTLRISRVEAEDVGVYYCMQH LEYPYTFGGGTKLEIK
In between the TF sequence and CD8 hinge sequence, there are two amino acids LE, this is enzyme (Xho I) site flanking scFv from 3′ end.

(65) TABLE-US-00011 <Human CD8 hinge> SEQ ID NO: 24 K P T T T P A P R P P T P A P T I A S Q P L S L R  P E A S R P A A G G A V H T R G L D F A S D K P
The sequence of BCMA-TF-CAR (Clone A) is shown below. TF is bold and underlined, BCMA ScFv containing VH-linker-VL is shown by Italic. The CAR contains CD8 leader sequence that is shown by Italic underlined and CD8 hinge sequence underlined.

(66) TABLE-US-00012 (SEQ ID NO: 25) MALPVTALLLPLALLLHAARPASQVQVVESGGGLVKPGGSLKLSCVVSGFAFSSYDMSWVRQTPEKRLEWVAYINSGGYITYYLDTVKGRFTISRDNAKNILYLQMNSLKSEDSALYYCVPGFAHWGQGTLVIVSGGGGSGGGGSGGGGSDIVMTQAAPSVPVTPGESVSISCRSNKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCMQHLEYPYTFGGGTKLEIKKN PDPWAKNLNEKDY L E K P T T T P A P R P P T P A P T I A S Q P L S L R P E A S R P A A G G A V H T R G L D F A S D K P F W  V L V V V G G V L A C Y S L L V T V A F I I  F W V R S K R S R L L H S D Y M N M T P R R  P G P T R K H Y Q P Y A P P R D F A A Y R S  R VKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 2. BCMA-Clone B BCMA clone B (Promab Biotechnologies) ScFv  was used to generate BCMA-TF CAR. <VH, Clone B>, SEQ ID NO: 26 QVQVVESGGGLMKPGGSLKLSCVVSGFAFSSYDMSWVRQTPEKRLEWVAYINSGGYITYYLDTVKGRFTISRDNAKKSLYLQMNSLKSEDSALYYCVPGFAHWGQGTLVIVS <VL, Clone B>, SEQ ID NO: 27 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNSYLHWYLQRPGQSPKLLIYKVSSRFSGVPDRFSGSGSGTDFTLKIRRVEAEDLGVYFCSQSTHFPYTFGGGTMLEIK
The sequence of BCMA-TF-CAR (Clone B) is shown below; the CAR sequence is similar to SEQ ID NO: 25 except VH and VL. TF is bold and underlined, BCMA ScFv containing VH-linker-VL is shown by Italic. The CAR contained CD8 leader sequence that is shown by italic underlined and CD8 hinge sequence underlined.

(67) TABLE-US-00013 (SEQ ID NO: 28) MALPVTALLLPLALLLHAARPASQVQVVESGGGLVKPGGSLKLSCVVSGFAFSSYDMSWVRQTPEKRLEWVAYINSGGYITYYLDTVKGRFTISRDNAKNILYLQMNSLKSEDSALYYCVPGFAHWGQGTLVIVSGGGGSGGGGSGGGGSDVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNSYLHWYL   QRPGQSPKLLIYKVSSRFSGVPDR FSGSGSGTDFTLKIRRVEAEDLGVYFCSQSTHFPYTFGGGTMLEIKKN PDPWAKNLNEKDY L E K P T T T P A P R P P T P A P T I A S Q P L S L R P E A S R P A A G G A V H T R G L D F A S D K P F W V L V V V G G V L A C Y S L L V T V A F I I F W V R S K R S  R L L H S D Y M N M T P R R P G P T R K H Y Q P  Y A P P R D F A A Y R S R V K F S R S A D A P A   Y Q Q G Q N Q L Y N E L N L G R R E E Y D V L D K R R G R D P E M G G K P Q R R K N P Q E G L Y  N E L Q K D K M A E A Y S E I G M K G E R R R G  K G H D G L Y Q G L S T A T K D T Y D A L H M Q  A L P P R 3. BCMA-Clone 7 <VH, Clone 7>, SEQ ID NO: 29 Q L Q Q S G P E L V K S G A S V K M S C K A S G  Y T F T S Y V M H W V K Q K P G Q G L E W I G F  I I P Y N D D T K Y N E K F K G K A S L T S D K  S S S T A F M E L S S L T S E D S A V Y Y C A R  W N Y D G Y F D V W G A G T T V T V S S <VL, Cone 7> SEQ ID NO: 30 D V V M T Q T P L S L P V S L G D Q A S I S C R S S Q S L V H S N G N T Y L H W Y L Q K P G Q S P K L L I Y K V S N R F S G V P D R F S G S G S G T D F T L K I S R V E A E D L G V Y F C S Q I T H V P Y T F G G G T K L E I R R
BCMA-TF CAR containing Clone 7, Scfv (VH-linker-VL) was prepared; the CAR sequence is similar to SEQ ID NO: 28 except VH and VL.

(68) TABLE-US-00014 4. BCMA scFv (clone 7B5B4) <VH, Clone 7B5B4>, SEQ ID NO: 31 Q L Q Q S G P E L V K S G A S V K M S C K A S G  Y T F T S Y V M H W V K Q K P G Q G L E W I G F  I I P Y N D D T K Y N E K F K G K A S L T S D K  S S S T A Y M E L S S L T S E D S A V Y Y C A R  W D F D G Y F D V W G A G T T V T V S S <VL, Clone 7B5B4>, SEQ ID NO: 32 D V V M T Q T P L S L P V S L G D Q A S I S C R  S S Q S L V H S N G N T Y L H W Y L Q K P G Q S  P K L L I Y K V S N R F S G V P D R F S G S G S  G T D F T L K I S R V E A E D L G V Y F C S Q I  T H V P Y T F G G G T K L E I R R
BCMA-TF CAR containing Clone 7B5B4, ScFv (VH-linker-VL) was prepared; the CAR sequence is similar to SEQ ID NO: 28 except and VL,

Example 5. Generation of CAR-Encoding Lentivirus

(69) DNAs encoding the CARs (Examples 2-4) were synthesized and subcloned into a third-generation lentiviral vector with EF1a promoter by Syno Biological (Beijing, China). All CAR lentiviral constructs were sequenced in both directions to confirm CAR sequence and used for lentivirus production. Ten million growth-arrested HEK293FT cells (Thermo Fisher) were seeded into T75 flasks and cultured overnight, then transfected with the pPACKH1 Lentivector Packaging mix (System Biosciences, Palo Alto, Calif.) and 10 μg of each lentiviral vector using the CalPhos Transfection Kit (Takara, Mountain View, Calif.). The next day the medium was replaced with fresh medium, and 48 h later the lentivirus-containing medium was collected. The medium was cleared of cell debris by centrifugation at 2100 g for 30 min. The virus particles were collected by centrifugation at 112,000 g for 100 min, suspended in AIM V medium, aliquoted and frozen at −80° C. The titers of the virus preparations were determined by quantitative RT-PCR using the Lenti-X qRT-PCR kit (Takara) according to the manufacturer's protocol and the 7900HT thermal cycler (Thermo Fisher). The lentiviral titers were >1×10.sup.8 pfu/ml.

Example 6. Generation and Expansion of CAR-T Cells

(70) PBMC were suspended at 1×10.sup.6 cells/ml in AIM V-AlbuMAX medium (Thermo Fisher) containing 10% FBS and 300 U/ml IL-2 (Thermo Fisher), mixed with an equal number (1:1 ratio) of CD3/CD28 Dynabeads (Thermo Fisher), and cultured in non-treated 24-well plates (0.5 ml per well). At 24 and 48 hours, lentivirus was added to the cultures at a multiplicity of infection (MOI) of 5, along with 1 μl of TransPlus transduction enhancer (AlStem). As the T cells proliferated over the next two weeks, the cells were counted every 2-3 days and fresh medium with 300 U/ml IL-2 was added to the cultures to maintain the cell density at 1-3×10.sup.6 cells/ml.

Example 7. Flow Cytometry

(71) To measure CAR expression, 0.5 million cells were suspended in 100 μl of buffer (PBS containing 0.5% BSA) and incubated on ice with 1 μl of human serum (Jackson Immunoresearch, West Grove, Pa.) for 10 min. Then 1 μl of allophycocyanin (APC)-labeled anti-CD3 (eBioscience, San Diego, Calif.), and 2 μl of either phycoerythrin (PE)-labeled anti-TF or its isotype control antibody was added, and the cells were incubated on ice for 30 min. The cells were rinsed with 3 ml of buffer, then suspended in buffer and acquired on a FACSCalibur (BD Biosciences). Cells were analyzed for CD3 staining versus TF staining or isotype control staining.

Example 8. Generation of the Stable HeLa-CD19 Cell Line

(72) To generate HeLa cells stably expressing human CD19, a DNA encoding the human CD19 open reading frame was synthesized and subcloned into the pCD510 lentiviral vector (System Biosciences) by Syno Biological. Lentivirus containing the vector was made as described above. HeLa cells were infected with the lentivirus at an MOI of 5 and cultured in the presence of 1 μg/ml puromycin to generate resistant cells, herein called HeLa-CD19. The expression of CD19 was confirmed by flow cytometry with a CD19 antibody (BioLegend).

Example 9. Real-Time Cytotoxicity Assay (RTCA)

(73) Adherent target cells (HeLa or HeLa-CD19) were seeded into 96-well E-plates (Acea Biosciences, San Diego, Calif.) at 1×10.sup.4 cells per well and monitored in culture overnight with the impedance-based real-time cell analysis (RTCA) iCELLigence system (Acea Biosciences). The next day, the medium was removed and replaced with AIM V-AlbuMAX medium containing 10% FBS±1×10.sup.5 effector cells (CAR-T cells or non-transduced T cells), in triplicate. The cells in the E-plates were monitored for another 2-3 days with the RTCA system, and impedance was plotted over time. Cytolysis was calculated as (impedance of target cells without effector cells—impedance of target cells with effector cells)×100/impedance of target cells without effector cells. For non-adherent target cells (Raji), the E-plates were first coated with an anti-CD40 antibody (Acea Biosciences) to bind to the CD40.sup.+ Raji cells. Then 1×10.sup.4 Raji cells were plated per well and the RTCA assay was performed as described above.

Example 10. Cytokine Secretion Assay

(74) The target cells (Raji or HeLa-CD19) were cultured with the effector cells (CAR-T cells or non-transduced T cells) at a 1:1 ratio (1×10.sup.4 cells each) in U-bottom 96-well plates with 200 μl of AIM V-AlbuMAX medium containing 10% FBS, in triplicate. After 16 h the top 150 μl of medium was transferred to V-bottom 96-well plates and centrifuged at 300 g for 5 min to pellet any residual cells. The top 120 μl of supernatant was transferred to a new 96-well plate and analyzed by ELISA for human IFN-γ and IL-2 levels using kits from Thermo Fisher according to the manufacturer's protocol.

Example 11. Statistical Analysis

(75) Data were analyzed and plotted with Prism software (GraphPad, San Diego, Calif.). Comparisons between two groups were performed by unpaired Student's t test. p<0.05 was considered significant.

Example 12. Flow Cytometry with New Promab's Rabbit TF Antibody Shows Efficient Transduction of T Cells with CD19-CAR or CD22 Lentiviruses and Expression CD19 or CD22-TF-ScFv

(76) Promab Biotechnologies developed several TF antibodies that were generated against the 15 amino-acid peptide SEQ ID NO: 1.

(77) The TF peptide sequence was conjugated to carrier KLH (Keyhole limpet Hemocyanin) protein to more effectively immunize rabbits, The best clones were selected by ELISA. PBMC was collected from rabbits and used for cloning and library generation. The monoclonal TF antibody was generated by yeast display and FACS analysis with labeled 15 amino-acid peptide.

Example 13. TF Antibody Detects TF Epitope Sequence Inside CAR

(78) The best TF clones (Ab #13 and #75) were used for FACS analysis with CD19-TF and CD22-TF-CAR-T cells (FIG. 3). The FACS was done as described in Example 5. CD19-TF and CD22-TF CAR-T cells were effectively detected with two different rabbit monoclonal TF antibodies (FIG. 3). The staining with TF antibody was much better than with Fab antibody (not shown). Thus, TF-antibodies can be used in clinic for sorting and imaging of TF-positive CAR-T cells.

Example 14. CD19-TF-CAR-T Cells Demonstrate High Cytotoxicity Against CD19-Positive Hela-CD19 Cells

(79) The Real-time highly sensitive cytotoxicity assay demonstrated high activity of CD19-TF-CAR-T cells against CD19-positive Hela cells (FIG. 4). CD19-TF specifically killed Hela-CD19-positivel cells as well as CD19-CAR-T cells. CD22 and CD22-TF specifically killed Hela-CD22 target cells (not shown).

Example 15. CD19-TF-CAR-T Cells and CD22-TF-CAR-T Cells Killed Raji (CD19-Positive and CD22-Positive) Lymphoma Cells

(80) This experiment demonstrates the high cytotoxic activity of CD19-TF-CAR-T cells against Raji lymphoma cancer cells that are positive for CD19 and CD22 antigen (FIG. 5). CD19-TF CAR-T were highly cytotoxic against Raji cells with endogenous expression of CD19 (FIG. 5). No significant differences in activity was observed between CD19-TF and CD19-CAR-T cells in Raji cells (not shown).

Example 16. CD19-TF-CAR Secrets Significantly Less IFN-Gamma than CD19-CAR-T Cells

(81) We performed ELISA assay for IFN-gamma secretion by CD19 and CD19-TF-CAR-T cells against Raji cells (FIG. 6). CD19-TF CAR-T cells secreted significantly less IFN-gamma than CD19-CAR-T cells (FIG. 6). Decreased secretion of IFN-gamma by CD19-TF cells versus CD19-CAR-T cells was also observed in Hela-CD19 cells (it was equal to 6128 pg/ml by CD19-TF cells; and 8868.3 pg/ml by CD19-CAR-T cells).

Example 17. CD22-TF-CAR Secretes Significantly Less IFN-Gamma than CD22-CAR-T Cells

(82) The level of IFN-gamma secreted by CD22-TF was significantly less than by CD22-CAR-T cells against target Raji cells (FIG. 7)

Example 18. CD19-TF Secrete Less IL-2 and IL-6 than CD19-CAR-T Cells Against Raji cells

(83) The decreased secretion of IL-2 (FIG. 8) and IL-6 (FIG. 9) by CD19-TF-CAR-T cells versus CD19-CAR-T cells was observed in Raji cells. CD22-CAR-T and CD22-TF-CAR-T cells secreted very low levels of IL-2 and IL-6 in Raji cells (not shown).

Example 19. CD19-1/2TF-CAR and CD19-2TF-CAR have Same Cytotoxic Activity as CD19-CAR Against Target Hela-CD19 Cells and Raji Cells

(84) To analyze if longer and shorter TF sequences generate CD19-TF-CAR with same cytotoxic activity as CD19-CAR, we used CD19-1/2TF and CD19-2xTF as shown in FIG. 2 to test against CD19-positive target cells. Both CD19-1/2TF- and CD19-2TF-CAR-T cells were equally cytotoxic with CD19-CAR-T cells against target Hela-CD19 cells (FIG. 10) and lymphoma Raji cells (FIG. 11). This suggest that 1/2 TF and 2 TF can be used to generate CAR-T cells with same cytotoxic activity as parental CD19-CAR-T cells.

Example 20. BCMA-TF-CAR-T Cells Secrete Significantly Less IL-2 than BCMA-CAR-T Cells

(85) FIG. 12. shows that secretion of IL-2 by BCMA-TF-CAR-T cells is significantly less than by BCMA-CAR-T cells against multiple myeloma cells RPMI8226 cells.

Example 21. CD19-TF-CAR-T Cells Significantly Decrease Raji Xenograft Tumor Growth

(86) Raji-luciferase positive cells were injected into NSG mice by i.v (intravenously) and then next day CD19-TF-CAR-T cells were injected by i.v. The CD19-(no TF)-CAR-T cells were also injected and PBS was used as controls. While PBS control mice died at day 21, CD19-CAR-T cell and CD19-TF-CAR-T cell-treated mice survived (FIGS. 13A-D). The imaging on FIG. 13 shows complete elimination of Raji-luciferase positive cells, and significant decrease of bioluminescence by CD19-TF-CAR-T cells. The survival of CD19-TF-CAR-T cell treated mice was better than CD19-CAR-T cell-treated mice (FIG. 13C). The CAR-T cells were detected in mice with either CD19scFv (for CD19-CAR-T cells) or TF antibodies (for CD19-TF-CAR-T cells) in mouse blood (FIG. 13D)

REFERENCES

(87) 1. Gross, G., and Eshhar, Z. (2016). Annu Rev Pharmacol Toxicol 56, 59-83. 2. Maus, M. V., Grupp, S. A., Porter, D. L., and June, C. H. (2014). Blood 123, 2625-2635. 3. Maus, M. V., Haas, A. R., Beatty, G. L., Albelda, S. M., Levine, B. L., Liu, X., Zhao, Y., Kalos, M., and June, C. H. (2013). Cancer Immunol Res 1, 26-31. 4. Kochenderfer, J. N., Dudley, M. E., Kassim, S. H., Somerville, R. P., Carpenter, R. O., Stetler-Stevenson, M., Yang, J. C., Phan, G. Q., Hughes, M. S., Sherry, R. M., et al. (2015). J Clin Oncol 33, 540-549. 5. Golubovskaya, V., and Wu, L. (2016). Cancers (Basel) 8. 6. Maus, M. V., and June, C. H. (2013). Clin Cancer Res 19, 1917-1919. 7. Maus, M. V., and June, C. H. (2014). Clin Cancer Res 20, 3899-3901. 8. Kochenderfer, J. N., and Rosenberg, S. A. (2013). Nat Rev Clin Oncol 10, 267-276.