Engineered proteins and methods of use
11318192 · 2022-05-03
Assignee
Inventors
- Lisa Herron-Olson (St. Paul, MN, US)
- Patricia Tam (St. Paul, MN, US)
- Drew M. Catron (St. Paul, MN, US)
- Daryll A. Emery (Willmar, MN, US)
Cpc classification
A61K39/39
HUMAN NECESSITIES
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K2039/55572
HUMAN NECESSITIES
International classification
Abstract
Provided herein are proteins that include at least one B cell domain and at least one T cell domain. Also provided are compositions that include one or more of the proteins and methods for using the proteins.
Claims
1. A non-natural protein comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:5 or SEQ ID NO:6.
2. A non-natural protein comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4.
3. The protein of claim 2 wherein the protein further comprises two or more copies of the amino acid sequence, wherein the two or more copies are present as a tandem repeat.
4. The protein of claim 2 wherein the protein comprises at least three copies of the amino acid sequence, wherein the three or more copies are present as a tandem repeat.
5. A non-natural protein comprising amino acids 7-518 of the amino acid sequence of SEQ ID NO:8 or amino acids 7-365 of the amino acid sequence of SEQ ID NO:10.
6. A composition comprising the protein of claim 1.
7. The composition of claim 6 further comprising a pharmaceutically acceptable carrier.
8. The composition of claim 6 further comprising an adjuvant.
9. A composition comprising the protein of claim 2.
10. The composition of claim 9 further comprising a pharmaceutically acceptable carrier.
11. The composition of claim 9 further comprising an adjuvant.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
(25) Proteins
(26) Provided herein are proteins having at least two types of domains, a B cell epitope domain and a T cell epitope domain. As used herein, “protein” refers broadly to a polymer of two or more amino acids linked by peptide bonds. Thus, for example, the terms peptide and polypeptide are included within the definition of protein. The term protein does not connote a specific length of a polymer of amino acids. The proteins described herein are made up of modular linked epitopes, and may be referred to herein as MoLE proteins. Optionally, two or more of the domains of a protein described herein are joined by a linker.
(27) In one embodiment, a MoLE protein includes at least one B cell domain selected from FDRDYTTVWGQRAPLYYSPGYGPASLYDYKGRG (SEQ ID NO:12), SQGDDNYGLNLGKGFSAISGSSTPYVSKGLNSDRIPGTER (SEQ ID NO:13), and DESLRFYPFPTVNANKQATAFSSSQQDTDQ (SEQ ID NO:14), and at least one T cell domain selected from ESRQLQLITQYYKSQ (SEQ ID NO:15), DPFNIDHIEVISGAT (SEQ ID NO:16), and VAQQNDDNEIIVSAS (SEQ ID NO:17). In another embodiment, a MoLE protein includes at least one B cell domain selected from REVKSGKKDKYNHWDLNYESRKP (SEQ ID NO:18), KNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRS (SEQ ID NO:19), and QEHGKFGNSTT (SEQ ID NO:20), and at least one T cell domain selected from GISITGGNEKPDISI (SEQ ID NO:21) and EKVIREVKSGKKDKY (SEQ ID NO:22).
(28) A MoLE protein includes at least one B cell domain and at least one T cell domain. Exemplary MoLE proteins that include one B cell domain and one T cell domain selected from SEQ ID NOs:12-17 in different orders are identified in Table 1. Exemplary MoLE proteins that include one B cell domain and one T cell domain selected from SEQ ID NOs:18-22 in different orders are identified in Table 2. Tables 1 and 2 shows the order of domains as B cell domain followed by T cell domain; however, the domains can be present in a MoLE protein with a T cell domain followed by a B cell domain. Other embodiments of a MoLE protein described herein include two B cell domains and two T cell domains, three B cell domains and three T cell domains, etc. In one embodiment, the domains are present in a MoLE protein with a B cell domain followed by a T cell domain, for instance, in the order of B cell domain-T cell domain when the MoLE protein includes one copy of each domain, B cell domain-T cell domain-B cell domain-T cell domain when the MoLE protein includes two copies of each domain, or B cell domain-T cell domain-B cell domain-T cell domain-B cell domain-T cell domain when the MoLE protein includes three copies of each domain.
(29) TABLE-US-00001 TABLE 1 Examples of MoLE proteins that include one B cell domain and one T cell domain selected from SEQ ID NOs: 12-17. B cell T cell MoLE domain, domain, protein: SEQ ID NO SEQ ID NO 1 12 15 2 12 16 3 12 17 4 13 15 5 13 16 6 13 17 7 14 15 8 14 16 9 14 17 Each row refers to the order of the domains in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 1 is the order SEQ ID NO: 12 and 15.
(30) TABLE-US-00002 TABLE 2 Examples of MoLE proteins that include one B cell domain and one T cell domain selected from SEQ ID NOs: 18-22. B cell T cell MoLE domain, domain, protein: SEQ ID NO SEQ ID NO 10 18 20 11 18 21 12 19 20 13 19 21 14 20 20 15 20 21 Each row refers to the order of the domains in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 10 is the order SEQ ID NO: 18 and 20.
(31) Exemplary MoLE proteins that include three B cell domains and three T cell domains selected from SEQ ID NOs:12-17 in different orders are identified in Table 3. Table 3 shows the order of domains as B cell domain followed by T cell domain; however, the domains can be present in a MoLE protein with a T cell domain followed by a B cell domain. A set of B cell and T cell domains is referred to herein as a module, e.g., each MoLE protein in Tables 1-8 is a module. The set of B cell and T cell domains that includes one copy of each of SEQ ID NOs:12-17 is referred to herein as module I.
(32) TABLE-US-00003 TABLE 3 Examples of MoLE proteins that include SEQ ID NOs: 12-17. B cell T cell B cell T cell B cell T cell domain, domain, domain, domain, domain, domain, MoLE SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID protein: NO: 12 NO: 15 NO: 13 NO: 16 NO: 14 NO: 17 16 1 2 3 4 5 6 17 1 2 3 6 5 4 18 1 4 3 2 5 6 19 1 6 3 2 5 4 20 1 4 3 6 5 2 21 1 6 3 4 5 2 22 1 2 5 4 3 6 23 1 2 5 6 3 4 24 1 4 5 2 3 6 25 1 6 5 2 3 4 26 1 4 5 6 3 2 27 1 6 5 4 3 2 28 3 2 1 4 5 6 29 3 2 1 6 5 4 30 3 4 1 2 5 6 31 3 6 1 2 5 4 32 3 4 1 6 5 2 33 3 6 1 4 5 2 34 3 2 5 4 1 6 35 3 2 5 6 1 4 36 3 4 5 2 1 6 37 3 6 5 2 1 4 38 3 4 5 6 1 2 39 3 6 5 4 1 2 40 5 2 1 4 3 6 41 5 2 1 6 3 4 42 5 4 1 2 3 6 43 5 6 1 2 3 4 44 5 4 1 6 3 2 45 5 6 1 4 3 2 46 5 2 3 4 1 6 47 5 2 3 6 1 4 48 5 4 3 2 1 6 49 5 6 3 2 1 4 50 5 4 3 6 1 2 51 5 6 3 4 1 2 Each row refers to the position of the domain in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 16 is the order SEQ ID NO: 12, 15, 13, 16, 14, and 17.
(33) In another embodiment, exemplary MoLE proteins that include three B cell domains and two T cell domains selected from SEQ ID NOs:18-22 in different orders are identified in Table 4. Table 4 shows the order of domains as B cell domain followed by T cell domain; however, the domains can be present in a MoLE protein with a T cell domain followed by a B cell domain. The set of B cell and T cell domains that includes one copy of each of selected from SEQ ID NOs:18-22 is referred to herein as module II.
(34) TABLE-US-00004 TABLE 4 Examples of MoLE proteins that include SEQ ID NOs: 18-22. B cell T cell B cell T cell B cell domain, domain, domain, domain, domain, MoLE SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID protein: NO: 18 NO: 21 NO: 19 NO: 22 NO: 20 52 1 2 3 4 5 53 1 4 3 2 5 54 1 2 5 4 3 55 1 4 5 2 3 56 2 2 1 4 3 57 2 4 1 2 3 58 2 2 3 4 1 59 2 4 3 2 1 60 3 2 2 4 1 61 3 4 2 2 1 62 3 2 1 4 2 63 3 4 1 2 2 Each row refers to the position of the domain in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 1 is the order SEQ ID NO: 18, 21, 19, 22.
(35) In one embodiment, a MoLE protein includes at least one B cell domain selected from SEQ ID NO:12-14, and at least one T cell domain selected from SEQ ID NO:21 and 22. In another embodiment, a MoLE protein includes at least one B cell domain selected from SEQ ID NO:18-20 and at least one T cell domain selected from SEQ ID NO:15-17.
(36) Exemplary MoLE proteins that include one B cell domain selected from SEQ ID NOs:12-14 and one T cell domain selected from SEQ ID NOs:21-22 in different orders are identified in Table 5. Exemplary MoLE proteins that include one B cell domain selected from SEQ ID NOs:18-20 and one T cell domain selected from SEQ ID NOs:15-17 in different orders are identified in Table 6. Tables 5 and 6 shows the order of domains as B cell domain followed by T cell domain; however, the domains can be present in a MoLE protein with a T cell domain followed by a B cell domain.
(37) TABLE-US-00005 TABLE 5 Examples of MoLE proteins that include one B cell domain selected from SEQ ID NOs: 12-14 and one T cell domain selected from SEQ ID NOs: 21-22. B cell T cell MoLE domain, domain, protein: SEQ ID NO SEQ ID NO 64 12 21 65 12 22 66 13 21 67 13 22 68 14 21 69 14 22 Each row refers to the order of the domains in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 64 is the order SEQ ID NO: 12 and 20.
(38) TABLE-US-00006 TABLE 6 Examples of MoLE proteins that include one B cell domain selected from SEQ ID NOs: 18-20 and one T cell domain selected from SEQ ID NOs: 15-17. B cell T cell MoLE domain, domain, protein: SEQ ID NO SEQ ID NO 70 18 15 71 18 16 72 18 17 73 19 15 74 19 16 75 19 17 76 20 15 77 20 16 78 20 17 Each row refers to the position of the domain in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 70 is the order SEQ ID NO: 18 and 15.
(39) Exemplary MoLE proteins that include three B cell domains selected from SEQ ID NOs:12-14 and two T cell domains selected from SEQ ID NOs:21-22 in different orders are identified in Table 7. Table 7 shows the order of domains as B cell domain followed by T cell domain; however, the domains can be present in a MoLE protein with a T cell domain followed by a B cell domain.
(40) TABLE-US-00007 TABLE 7 Examples of MoLE proteins that include SEQ ID NOs: 12-14 and 21-22. B cell T cell B cell T cell B cell domain, domain, domain, domain, domain, MoLE SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID protein: NO: 12 NO: 21 NO: 13 NO: 22 NO: 14 79 1 2 3 4 5 80 1 4 3 2 5 81 1 2 5 4 3 82 1 4 5 2 3 83 2 2 1 4 3 84 2 4 1 2 3 85 2 2 3 4 1 86 2 4 3 2 1 87 3 2 2 4 1 88 3 4 2 2 1 89 3 2 1 4 2 90 3 4 1 2 2 Each row refers to the position of the domain in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 79 is the order SEQ ID NO: 12, 21, 13, 22, and 14.
(41) Exemplary MoLE proteins that include three B cell domains selected from SEQ ID NOs:18-20 and three T cell domains selected from SEQ ID NOs:15-17 in different orders are identified in Table 8. Table 8 shows the order of domains as B cell domain followed by T cell domain; however, the domains can be present in a MoLE protein with a T cell domain followed by a B cell domain.
(42) TABLE-US-00008 TABLE 8 Examples of MoLE proteins that include SEQ ID NOs: 18-20 and SEQ ID NOs: 15-17. B cell T cell B cell T cell B cell T cell domain, domain, domain, domain, domain, domain, MoLE SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID protein: NO: 18 NO: 15 NO: 19 NO: 16 NO: 20 NO: 17 91 1 2 3 4 5 6 92 1 2 3 6 5 4 93 1 4 3 2 5 6 94 1 6 3 2 5 4 95 1 4 3 6 5 2 96 1 6 3 4 5 2 97 1 2 5 4 3 6 98 1 2 5 6 3 4 99 1 4 5 2 3 6 100 1 6 5 2 3 4 101 1 4 5 6 3 2 102 1 6 5 4 3 2 103 3 2 1 4 5 6 104 3 2 1 6 5 4 105 3 4 1 2 5 6 106 3 6 1 2 5 4 107 3 4 1 6 5 2 108 3 6 1 4 5 2 109 3 2 5 4 1 6 110 3 2 5 6 1 4 111 3 4 5 2 1 6 112 3 6 5 2 1 4 113 3 4 5 6 1 2 114 3 6 5 4 1 2 115 5 2 1 4 3 6 116 5 2 1 6 3 4 117 5 4 1 2 3 6 118 5 6 1 2 3 4 119 5 4 1 6 3 2 120 5 6 1 4 3 2 121 5 2 3 4 1 6 122 5 2 3 6 1 4 123 5 4 3 2 1 6 124 5 6 3 2 1 4 125 5 4 3 6 1 2 126 5 6 3 4 1 2 Each row refers to the position of the domain in a MoLE protein from N-terminal end to C-terminal end. For instance, MoLE protein 91 is the order SEQ ID NO: 18, 15, 19, 16, 20, and 17.
(43) A MoLE protein can further include tandem repeats of a module, for instance, at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 tandem repeats. In one embodiment, a MoLE protein has no greater than 11 tandem repeats of a module. For instance, when the MoLE protein includes one copy of each type of domain (B cell domain-T cell domain, such as SEQ ID NO:12 and 15), a MoLE protein with tandem repeats can include, but is not limited to, an amino acid sequence SEQ ID NO:12-15-12-15 (two tandem repeats), or SEQ ID NO:12-15-12-15-12-15 (three tandem repeats). In another example, when the MoLE protein includes two copies of each type of domain (B cell domain-T cell domain-B cell domain-T cell domain, such as SEQ ID NO:12-15-13-16), a MoLE protein with tandem repeats can include, but is not limited to, an amino acid sequence SEQ ID NO:12-15-13-16-12-15-13-16 (two tandem repeats). In yet another example, when the MoLE protein includes module I or module II present as tandem repeats, a MoLE protein with tandem repeats can be, but is not limited to, at least two copies of module I, or at least two copies of module II.
(44) Examples of MoLE proteins disclosed in Table 3 as MoLE protein 16 include, but are not limited to, SEQ ID NOs:1, 3, 5, and amino acids 7-518 of SEQ ID NO:8 (see
(45) Examples of MoLE proteins disclosed in Table 4 as MoLE protein 52 include, but are not limited to, SEQ ID NOs:2, 4, 6, and amino acids 7-365 of SEQ ID NO:10 (see
(46) In one embodiment, a MoLE protein described herein includes a linker between the B cell and T cell domains. A linker is an amino acid sequence that joins protein domains in a fusion protein. A linker can be flexible or rigid, and in one embodiment is flexible. In one embodiment, a linker can be at least 3, at least 4, at least 5, or at least 6 amino acids in length. It is expected that there is no upper limit on the length of a linker used in a fusion protein described herein; however, in one embodiment, a linker is no greater than 10, no greater than 9, no greater than 8, or no greater than 7 amino acids in length. Many linkers are known to a skilled person (see Chen et al. 2013, Adv, Drug Deliv. Rev., 65(10):1357-1369). Specific examples of linkers include, but are not limited to, GSGS (SEQ ID NO:23) and GPGPG (SEQ ID NO:24). A MoLE protein can include more than one type of linker. For instance, in a MoLE protein some linkers can be GSGS (SEQ ID NO:23) and others can be GPGPG (SEQ ID NO:24).
(47) Proteins described herein have immunological activity. “Immunological activity” refers to the ability of a protein to elicit an immunological response in an animal. An immunological response to a protein is the development in an animal of a cellular and/or antibody-mediated immune response to the protein. Usually, an immunological response includes but is not limited to one or more of the following effects: the production of antibodies, B cells, helper T cells, suppressor T cells, and/or cytotoxic T cells, directed to an epitope or epitopes of the protein. “Epitope” refers to the site on an antigen to which specific B cells and/or T cells respond so that antibody is produced. The immunological activity may be protective. “Protective immunological activity” refers to the ability of a protein to elicit an immunological response in an animal that prevents or inhibits infection by a gram-negative microbe, such as E. coli. In one embodiment, the E. coli strain CFT073 (ATCC® 700928™) is used to evaluate protective immunological activity. Whether a protein has protective immunological activity can be determined by methods known in the art such as, for example, methods described in Examples 12-32. For example, a protein described herein, or combination of proteins described herein, protects an animal against challenge with a gram-negative microbe, such as E. coli. A protein described herein may have seroactive activity. “Seroactive activity” refers to the ability of a protein to react with antibody present in convalescent serum from an animal infected with a gram-negative microbe, such as E. coli. A protein described herein may have immunoregulatory activity. “Immunoregulatory activity” refers to the ability of a protein to act in a nonspecific manner to enhance an immune response to a particular antigen. Methods for determining whether a protein has immunoregulatory activity are known in the art.
(48) A MoLE protein may be “structurally similar” to a reference protein if the amino acid sequence of the MoLE protein possesses a specified amount of sequence similarity and/or sequence identity compared to the reference protein. Thus, a protein may be “structurally similar” to a reference protein if, compared to the reference protein, it possesses a sufficient level of amino acid sequence identity, amino acid sequence similarity, or a combination thereof.
(49) A reference protein can be any protein disclosed herein, including the proteins listed in Tables 1-8. In one embodiment, a reference protein is module I (e.g., SEQ ID NO:1) or module II (e.g., SEQ ID NO:2). A reference protein can include tandem repeats of any protein disclosed herein, including the proteins listed in Tables 1-8. In another embodiment, a reference protein includes tandem repeats of module I or tandem repeats of module II. In another embodiment, a reference protein is module I or module II that includes one or more linker (e.g., any MoLE protein disclosed in Table 3 or 4 where there is a linker between domains), or tandem repeats of module I or module II that includes one or more linker. In some embodiments when a reference protein includes one or more linker, the one or more linker is not considered when determining whether a protein is structurally similar to a reference protein. In another embodiment, a reference protein is SEQ ID NO:5, 6, 8, or 10.
(50) A B cell domain and a T cell domain may be “structurally similar” to a reference domain if the amino acid sequence of the domain possesses a specified amount of sequence similarity and/or sequence identity compared to the reference domain. Thus, a domain may be “structurally similar” to a reference domain if, compared to the reference domain, it possesses a sufficient level of amino acid sequence identity, amino acid sequence similarity, or a combination thereof. A B cell domain that is structurally similar to a reference B cell domain has B cell activity. A T cell domain that is structurally similar to a reference T cell domain has T cell activity. Examples of reference B cell domains are SEQ ID NOs:12, 13, 14, 18, 19, and 20. Examples of reference T cell domains are SEQ ID NOs:15, 16, 17, 21, and 22.
(51) Protein Sequence Similarity and Protein Sequence Identity
(52) Structural similarity of two proteins can be determined by aligning the residues of the two proteins (for example, a candidate protein and any appropriate reference protein described herein) to optimize the number of identical amino acids along the lengths of their sequences; gaps in either or both sequences are permitted in making the alignment in order to optimize the number of identical amino acids, although the amino acids in each sequence must nonetheless remain in their proper order. A candidate protein is the protein being compared to the reference protein. A candidate protein can be isolated, for example, from a microbe engineered to produce the candidate protein using recombinant techniques, or chemically or enzymatically synthesized.
(53) Structural similarity of two domains can be determined by aligning the residues of the two domains (for example, a candidate domain and any appropriate reference domain described herein) to optimize the number of identical amino acids along the lengths of their sequences; gaps in either or both sequences are permitted in making the alignment in order to optimize the number of identical amino acids, although the amino acids in each sequence must nonetheless remain in their proper order. A candidate domain is the domain being compared to the reference domain. A candidate domain can be isolated, for example, from a microbe engineered to produce the candidate domain using recombinant techniques, or chemically or enzymatically synthesized.
(54) Unless modified as otherwise described herein, a pair-wise comparison analysis of amino acid sequences can be carried out using the BESTFIT algorithm in the GCG package (version 10.2, Madison Wis.). Alternatively, amino acid sequences may be compared using the Blastp program of the BLAST 2 search algorithm, as described by Tatiana et al. (FEMS Microbiol Lett, 174:247-250 (1999)), and available on the National Center for Biotechnology Information (NCBI) website. The default values for all BLAST 2 search parameters may be used, including matrix=BLOSUM62; open gap penalty=11, extension gap penalty=1, gap x_dropoff=50, expect=10, wordsize=3, and filter on.
(55) In the comparison of two amino acid sequences, structural similarity may be referred to by percent “identity” or may be referred to by percent “similarity.” “Identity” refers to the presence of identical amino acids. “Similarity” refers to the presence of not only identical amino acids but also the presence of conservative substitutions. A conservative substitution for an amino acid in a protein may be selected from other members of the class to which the amino acid belongs. For example, it is well-known in the art of protein biochemistry that an amino acid belonging to a grouping of amino acids having a particular size or characteristic (such as charge, hydrophobicity, or hydrophilicity) can be substituted for another amino acid without altering the activity of a protein. For example, nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and tyrosine. Polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine and glutamine. The positively charged (basic) amino acids include arginine, lysine and histidine. The negatively charged (acidic) amino acids include aspartic acid and glutamic acid. Thus, conservative substitutions include, for example, Lys for Arg and vice versa to maintain a positive charge; Glu for Asp and vice versa to maintain a negative charge; Ser for Thr so that a free —OH is maintained; and Gln for Asn to maintain a free —NH.sub.2.
(56) Thus, as used herein, reference to a protein as described herein and/or reference to the amino acid sequence of one or more SEQ ID NOs can include a protein with at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence similarity to the reference amino acid sequence.
(57) Alternatively, as used herein, reference to a protein as described herein and/or reference to the amino acid sequence of one or more SEQ ID NOs can include a protein with at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence identity to the reference amino acid sequence.
(58) A MoLE protein that is structurally similar to a reference protein has immunological activity (including protective immunological activity, seroactive activity, and/or immunoregulatory activity). A B cell domain that is structurally similar to a reference B cell domain has B cell activity, and a T cell domain that is structurally similar to a reference T cell domain has T cell activity. A candidate B cell domain has B cell activity if antibody produced by immunizing an animal with the candidate B cell domain specifically binds to the reference B cell domain. A candidate T cell domain has T cell activity if cells from a mouse immunized with the candidate T cell are stimulated to produce cytokines when exposed to the reference T cell domain.
(59) A protein as described herein also can be designed to include one or more additional sequences such as, for example, the addition of C-terminal and/or N-terminal amino acids. In one embodiment, additional amino acids may facilitate purification by trapping on columns or use of antibodies. Such additional amino acids include, for example, histidine-rich tags that allow purification of proteins on nickel columns. In one embodiment, additional amino acids are those that may signal for acylation or promote mucosal uptake. Such gene modification techniques and suitable additional sequences are well known in the molecular biology arts.
(60) A protein described herein can include one or more modifications. A “modification” of a protein includes a protein that is chemically or enzymatically derivatized at one or more constituent amino acids. Such a modification can include, for example, a side chain modification, a backbone modification, an N-terminal modification, and/or a C-terminal modification such as, for example, acetylation, hydroxylation, methylation, amidation, and the attachment of a carbohydrate and/or lipid moiety, a cofactor, and the like, and combinations thereof. Modified proteins as described herein may retain the biological activity—such as, for example, immunological activity—of the unmodified protein or may exhibit a reduced or increased biological activity compared to the unmodified protein.
(61) Polynucleotides
(62) A protein described herein also may be identified in terms of the polynucleotide that encodes the protein. Thus, this disclosure provides polynucleotides that encode a protein as described herein or hybridize, under standard hybridization conditions, to a polynucleotide that encodes a protein as described herein, and the complements of such polynucleotide sequences.
(63) As used herein, reference to a polynucleotide as described herein and/or reference to the nucleic acid sequence of one or more SEQ ID NOs can include polynucleotides having a sequence identity of at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to an identified reference polynucleotide sequence.
(64) In this context, “sequence identity” refers to the identity between two polynucleotide sequences. Sequence identity is generally determined by aligning the bases of the two polynucleotides, for example, aligning the nucleotide sequence of the candidate sequence and a nucleotide sequence that includes a nucleotide sequence disclosed herein, such as nucleotides 19-1569 of SEQ ID NO:7 (which encode an example of module I) or nucleotides 19-1110 of SEQ ID NO:9 (which encode an example of module II) to optimize the number of identical nucleotides along the lengths of their sequences; gaps in either or both sequences are permitted in making the alignment in order to optimize the number of shared nucleotides, although the nucleotides in each sequence must nonetheless remain in their proper order. A candidate sequence is the sequence being compared to a known sequence—e.g., a nucleotide sequence that includes a nucleotide sequence described herein, for example, nucleotides 19-1569 of SEQ ID NO:7 or nucleotides 19-1110 of SEQ ID NO:9. For example, two polynucleotide sequences can be compared using the Blastn program of the BLAST 2 search algorithm, as described by Tatusova et al., (FEMS Microbiol Lett., 174:247-250 (1999)), and available on the world wide web at ncbi.nlm.nih.gov/BLAST/. The default values for all BLAST 2 search parameters may be used, including reward for match=1, penalty for mismatch=−2, open gap penalty=5, extension gap penalty=2, gap x_dropoff=50, expect=10, wordsize=11, and filter on.
(65) Finally, a polynucleotide can include any polynucleotide that encodes a protein as described herein. Thus, the nucleotide sequence of the polynucleotide may be deduced from the amino acid sequence that is to be encoded by the polynucleotide.
(66) Compositions
(67) A composition as described herein may include at least one protein described herein, or a number of proteins that is an integer greater than one (e.g., at least two, at least three, and so on), in any combination. Unless a specific level of sequence similarity and/or identity is expressly indicated herein (e.g., at least 80% sequence similarity, at least 85% sequence similarity, at least 90% sequence identity, etc.), reference to the amino acid sequence of an identified SEQ ID NO includes variants having the levels of sequence similarity and/or the levels of sequence identity described herein.
(68) A recombinantly-produced protein may be expressed from a vector that permits expression of the protein when the vector is introduced into an appropriate host cell. A host cell may be constructed to produce one or more proteins described herein and, therefore can include one or more vectors that include at least one polynucleotide encoding a protein described herein. Thus, each vector can include one or more polynucleotides as described herein—i.e., a polynucleotide that encodes a protein as described herein. Examples of host cells include, but are not limited to, E. coli.
(69) Optionally, a protein described herein can be covalently bound to a carrier protein to improve the immunological properties of the protein. Useful carrier proteins are known in the art, and include, for instance, cholera toxin subunit B and mutant heat labile enterotoxin. The chemical coupling of a protein described herein can be carried out using known and routine methods. For instance, various homobifunctional and/or heterobifunctional cross-linker reagents such as bis(sulfosuccinimidyl) suberate, bis(diazobenzidine), dimethyl adipimidate, dimethyl pimelimidate, dimethyl superimidate, disuccinimidyl suberate, glutaraldehyde, m-maleimidobenzoyl-N-hydroxy succinimide, sulfo-m-maleimidobenzoyl-N-hydroxysuccinimide, sulfosuccinimidyl 4-(N-maleimidomethyl) cycloheane-1-carboxylate, sulfosuccinimidyl 4-(p-maleimido-phenyl) butyrate and (1-ethyl-3-(dimethyl-aminopropyl) carbodiimide can be used (Harlow and Lane, Antibodies, A Laboratory Manual, generally and Chapter 5, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, N.Y. (1988)).
(70) A composition described herein optionally further includes a pharmaceutically acceptable carrier. “Pharmaceutically acceptable” refers to a diluent, carrier, excipient, salt, etc., that is compatible with the other ingredients of the composition, and not deleterious to the recipient thereof. Typically, the composition includes a pharmaceutically acceptable carrier when the composition is used as described herein. Exemplary pharmaceutically acceptable carriers include buffer solutions and generally exclude blood products such as, for example, whole blood and/or plasma. The compositions as described herein may be formulated in pharmaceutical preparations in a variety of forms adapted to the chosen route of administration, including routes suitable for stimulating an immune response to an antigen. Thus, a composition as described herein can be administered via known routes including, for example, oral; parenteral including intradermal, transcutaneous and subcutaneous, intramuscular, intravenous, intraperitoneal, etc.; and topically, such as, intranasal, intrapulmonary, intramammary, intravaginal, intrauterine, intradermal, transcutaneous and rectally, etc. It is foreseen that a composition can be administered to a mucosal surface, such as by administration to the nasal or respiratory mucosa (e.g., via a spray or aerosol), in order to stimulate mucosal immunity, such as production of secretory IgA antibodies, throughout the animal's body.
(71) A composition as described herein can also be administered via a sustained or delayed release implant. Implants suitable for use are known and include, for example, those disclosed in International Publication No. WO 2001/037810 and/or International Publication No. WO 1996/001620. Implants can be produced at sizes small enough to be administered by aerosol or spray. Implants also can include nanospheres and microspheres.
(72) A composition is administered in an amount sufficient to provide an immunological response to a protein described herein. The amount of protein present in a composition can vary. For instance, the dosage of protein can be between 0.01 micrograms (μg) and 3000 milligrams (mg), typically between 10 μg and 2000 ug. For an injectable composition (e.g. subcutaneous, intramuscular, etc.) the protein can be present in the composition in an amount such that the total volume of the composition administered is 0.5 ml to 5.0 ml, typically 1.0-3.0 ml. The amount administered will vary depending on various factors including, but not limited to, the specific proteins or cells chosen, the weight, physical condition and age of the animal, and the route of administration. Thus, the absolute weight of the protein included in a given unit dosage form can vary, and depends upon factors such as the species, age, weight and physical condition of the animal, as well as the method of administration. Such factors can be determined by one skilled in the art.
(73) The formulations may be conveniently presented in unit dosage form and may be prepared by methods well known in the art of pharmacy. All methods of preparing a composition including a pharmaceutically acceptable carrier include the step of bringing the active compound (e.g., a protein described herein) into association with a carrier that constitutes one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing the active compound into association with, for instance, a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into the desired formulations.
(74) A composition including a pharmaceutically acceptable carrier can also include an adjuvant. An “adjuvant” refers to an agent that can act in a nonspecific manner to enhance an immune response to a particular antigen, thus potentially reducing the quantity of antigen necessary in any given immunizing composition, and/or the frequency of injection necessary in order to generate an adequate immune response to the antigen of interest. Adjuvants may include, for example, IL-1, IL-2, emulsifiers, muramyl dipeptides, dimethyldiocradecylammonium bromide (DDA), avridine, aluminum hydroxide, oils, saponins, alpha-tocopherol, polysaccharides, emulsified paraffins (available from under the tradename EMULSIGEN from MVP Laboratories, Ralston, Nebr.), ISA-70, RIBI and other substances known in the art.
(75) In another embodiment, a composition can include a biological response modifier, such as, for example, IL-2, IL-4 and/or IL-6, TNF, IFN-alpha, IFN-gamma, and other cytokines that effect immune cells. A composition can also include an antibiotic, preservative, anti-oxidant, chelating agent, etc. Such components are known in the art.
(76) Methods of Use
(77) Also provided are methods of using the compositions described herein. The methods include administering to an animal an effective amount of a composition described herein. As used herein, an “effective amount” of a composition described herein is the amount able to elicit the desired response in the recipient. The composition can be administered at a time that maternal antibody may be present, for instance, as early as one day of age, or at a later time during the life of the animal. The animal can be, for instance, avian (including, for instance, chickens or turkeys), bovine (including, for instance, cattle), caprine (including, for instance, goats), ovine (including, for instance, sheep), porcine (including, for instance, swine), bison (including, for instance, buffalo), equine (including, for instance, horses), a companion animal (including, for instance, a dog or a cat), members of the family Cervidae (including, for instance, deer, elk, moose, caribou and reindeer), or a human. Examples of companion animals include dogs and cats. In one embodiment, an animal is a mouse. In one embodiment, an animal is a hooved animal.
(78) The methods described herein refer to gram-negative microbes. As used herein, a gram-negative microbe includes, but is not limited to, members of the family Vibrionaceae (including, for instance, Vibrio cholerae), Campylobacter spp. (including, for instance, C. jejuni), members of the family Enterobacteriaceae (including, for instance, Klebsiella spp., E. coli, Shigella spp., Salmonella spp., Proteus spp., Serratia spp., and Yersinia spp.), members of the family Pasteurellaceae, preferably Pasteurella spp. (including, for instance, P. multocida and P. haemolytica), and members of the family Pseudomonadaceae, preferably Pseudomonas spp., (including, for instance, Pseudomonas aeruginosa). Examples of Klebsiella spp. include K. pneumoniae and K. oxytoca. Examples of Salmonella spp. include Salmonella enterica serovars Bredeney, Dublin, Agona, Blockley, Enteriditis, Typhimurium, Hadar, Heidelberg, Montevideo, Muenster, Newport senftenberg, Salmonella cholerasuis, and S. typhi. Examples of strains of E. coli include, for example, E. coli serotypes O1a, O2a, O78, and O157; different O:H serotypes including 0104, 0111, 026, 0113, 091; hemolytic strains of enterotoxigenic E. coli such as K88.sup.+, F4.sup.+, F18ab.sup.+, and F18ac.sup.+; enteropathogenic (EPEC), enterohemorrhagic (EHEC), enteroinvasive (EIEC) and enteroaggregative (EAEC) strains of E. coli; and E. coli able to cause extra-intestinal infections, such as uropathogenic strains. In one embodiment, the gram-negative microbe is a pathogenic microbe.
(79) In some embodiments, a method may further include additional administrations (e.g., one or more booster administrations) of the composition to the animal to enhance or stimulate a secondary immune response. A booster can be administered at a time after the first administration, for instance, one to eight weeks, preferably two to four weeks, after the first administration of the composition. Subsequent boosters can be administered one, two, three, four, or more times annually. Without intending to be limited by theory, it is expected that in some embodiments annual boosters will not be necessary, as an animal will be challenged in the field by exposure to microbes expressing proteins having epitopes that are structurally related to epitopes present on proteins of the composition administered to the animal.
(80) In one embodiment, a method includes making antibody to a protein described herein, for instance by inducing the production of antibody in an animal, or by recombinant techniques. The antibody produced includes antibody that specifically binds at least one protein present in the composition. In this embodiment, an “effective amount” is an amount effective to result in the production of antibody in the animal. Methods for determining whether an animal has produced antibodies that specifically bind a protein present in a composition of described herein can be determined using routine methods. Also provided is antibody that specifically binds to a protein described herein, and compositions including such antibodies.
(81) As used herein, an antibody that can “specifically bind” a protein is an antibody that interacts with the epitope of the antigen that induced the synthesis of the antibody, or interacts with a structurally related epitope. At least some of the epitopes present in the proteins described herein are epitopes that are conserved in the proteins of different species and different genera of microbes. Accordingly, antibody produced using a protein described herein is expected to bind to proteins expressed by more than one species of microbe, and provide broad spectrum protection against gram-negative microbes.
(82) In one embodiment, a method includes treating an infection in an animal, caused by a gram-negative microbe. As used herein, the term “infection” refers to the presence of a gram-negative microbe in an animal's body, which may or may not be clinically apparent. Treating an infection can be prophylactic or, alternatively, can be initiated after the animal is infected by the microbe. Treatment that is prophylactic—e.g., initiated before a subject is infected by a microbe or while any infection remains subclinical—is referred to herein as treatment of a subject that is “at risk” of infection. As used herein, the term “at risk” refers to an animal that may or may not actually possess the described risk. Thus, typically, an animal “at risk” of infection by a microbe is an animal present in an area where animals have been identified as infected by the microbe and/or is likely to be exposed to the microbe even if the animal has not yet manifested any detectable indication of infection by the microbe and regardless of whether the animal may harbor a subclinical amount of the microbe. Accordingly, administration of a composition can be performed before, during, or after the animal has first contact with the microbe. Treatment initiated after the animal's first contact with the microbe may result in decreasing the severity of symptoms and/or clinical signs of infection by the microbe, completely removing the microbe, and/or decreasing the likelihood of experiencing a clinically evident infection compared to an animal to which the composition is not administered. The method includes administering an effective amount of a composition described herein to an animal having, or at risk of having, an infection caused by a gram-negative microbe, and determining whether the number of microbes causing the infection has decreased. In this embodiment, an “effective amount” is an amount effective to reduce the number of the specified microbes in an animal or reduce the likelihood that the animal experiences a clinically-evident infection compared to an animal to which the composition is not administered. Methods for determining whether an infection is caused by a gram-negative microbe are routine and known in the art, as are methods for determining whether the infection has decreased. The successful treatment of a gram-negative microbial infection in an animal is disclosed in Examples 12-32, which demonstrates the protection against disease caused by E. coli in a mouse model by administering a composition described herein. This mouse model is a commonly accepted model for the study of disease caused by E. coli.
(83) In another embodiment, a method includes treating one or more symptoms or clinical signs of certain conditions in an animal that may be caused by infection by a gram-negative microbe. The method includes administering an effective amount of a composition described herein to an animal having or at risk of having a condition, or exhibiting symptoms and/or clinical signs of a condition, and determining whether at least one symptom and/or clinical sign of the condition is changed, preferably, reduced. In one embodiment, the animal has a condition caused by an enteropathogenic (EPEC), enterohemorrhagic (EHEC), enterotoxigenic (ETEC), enteroinvasive (EIEC) and/or enteroaggregative (EAEC) strain of E. coli. Symptoms and/or clinical signs caused by a gram-negative microbial infection are known to the person skilled in the art. Examples of symptoms and/or clinical signs include, but are not limited to, sepsis; endotoxic shock; osteomyelitis; pneumonia; peritonitis; endocarditis; wound infection; reactive arthritis, meningitis, urinary tract infections (UTI), kidney failure, Guillian-Barre, Reiter syndrome, enteric diarrheal disease and other extra-intestinal diseases. Examples of conditions include, but are not limited to, mastitis, fecal shedding of a microbe, metritis, strangles, intrauterine infections, odema disease, enteritis, chronic reproductive infections, and laminitis.
(84) Treatment of symptoms and/or clinical signs associated with conditions caused by infection by a gram-negative microbe can be prophylactic or, alternatively, can be initiated after the development of a condition described herein. As used herein, the term “symptom” refers to subjective evidence of a disease or condition experienced by the patient and caused by infection by a microbe. As used herein, the term “clinical sign” or, simply, “sign” refers to objective evidence of disease or condition caused by infection by a microbe. Symptoms and/or clinical signs associated with conditions referred to herein and the evaluations of such symptoms are routine and known in the art. Treatment that is prophylactic, for instance, initiated before a subject manifests symptoms or signs of a condition caused by a microbe, is referred to herein as treatment of a subject that is “at risk” of developing the condition. Thus, typically, an animal “at risk” of developing a condition is an animal present in an area where animals having the condition have been diagnosed and/or is likely to be exposed to a microbe causing the condition even if the animal has not yet manifested symptoms or signs of any condition caused by the microbe. Accordingly, administration of a composition can be performed before, during, or after the occurrence of the conditions described herein. Treatment initiated after the development of a condition may result in decreasing the severity of the symptoms or signs of one of the conditions, or completely removing the symptoms or signs. In this embodiment, an “effective amount” is an amount effective to prevent the manifestation of symptoms or signs of a disease, decrease the severity of the symptoms or signs of a disease, and/or completely remove the symptoms or signs.
(85) Also provided is a method for decreasing colonization by a gram-negative microbe, for instance blocking the attachment sites of a gram-negative microbe, including tissues of the skeletal system (for instance, bones, cartilage, tendons and ligaments), muscular system, (for instance, skeletal and smooth muscles), circulatory system (for instance, heart, blood vessels, capillaries and blood), nervous system (for instance, brain, spinal cord, and peripheral nerves), respiratory system (for instance, nose, trachea lungs, bronchi, bronchioles, alveoli), digestive system (for instance, mouth, salivary glands, esophagus, liver, stomach, large and small intestine), excretory system (for instance, kidney, ureter, bladder, and urethra), endocrine system (for instance, hypothalamus, pituitary, thyroid, pancreas and adrenal glands), reproductive system (for instance, ovaries, oviduct, uterus, vagina, mammary glands, testes, and seminal vesicles), lymphatic/immune systems (for instance, lymph, lymph nodes and vessels, mononuclear or white blood cells, such as macrophages, neutrophils, monocytes, eosinophils, basophils, and lymphocytes, including T cells and B cells), and specific cell lineages (for instance, precursor cells, epithelial cells, stem cells), and the like.
(86) Decreasing colonization in an animal may be performed prophylactically or, alternatively, can be initiated after the animal is colonized by the microbe. Treatment that is prophylactic—e.g., initiated before a subject is colonized by a microbe or while any colonization remains undetected—is referred to herein as treatment of a subject that is “at risk” of colonization by the microbe. Thus, typically, an animal “at risk” of colonization by a microbe is an animal present in an area where animals have been identified as colonized by the microbe and/or is likely to be exposed to the microbe even if the animal has not yet manifested any detectable indication of colonization by the microbe and regardless of whether the animal may harbor a sub-colonization number of the microbe. Accordingly, administration of a composition can be performed before, during, or after the animal has first contact with the microbe. Treatment initiated after the animal's first contact with the microbe may result in decreasing the extent of colonization by the microbe, completely removing the microbe, and/or decreasing the likelihood that the animal becomes colonized by the microbe compared to an animal to which the composition is not administered. Thus, the method includes administering an effective amount of a composition described herein to an animal colonized by, or at risk of being colonized by, a gram-negative microbe. In this embodiment, an “effective amount” is an amount sufficient to decrease colonization of the animal by the microbe, where decreasing colonization refers to one or more of: decreasing the extent of colonization by the microbe, completely removing the microbe, and/or decreasing the likelihood that the animal becomes colonized by the microbe compared to an animal to which the composition is not administered. Methods for evaluating the colonization of an animal by a microbe are routine and known in the art. For instance, colonization of an animal's intestinal tract by a microbe can be determined by measuring the presence of the microbe in the animal's feces. It is expected that decreasing the colonization of an animal by a microbe will reduce transmission of the microbe to other animals of the same or different species.
(87) Also provided is the use of antibody to target a microbe expressing a protein having an epitope structurally related to an epitope present on a protein described herein. A composition described herein can be used to provide for active or passive immunization against bacterial infection. Generally, the composition can be administered to an animal to provide active immunization. However, the composition can also be used to induce production of immune products, such as antibodies, which can be collected from the producing animal and administered to another animal to provide passive immunity. Immune components, such as antibodies, can be collected to prepare compositions (preferably containing antibody) from serum, plasma, blood, colostrum, etc. for passive immunization therapies. Antibody compositions including monoclonal antibodies and/or anti-idiotypes can also be prepared using known methods. Chimeric antibodies include human-derived constant regions of both heavy and light chains and murine-derived variable regions that are antigen-specific (Morrison et al., Proc. Natl. Acad. Sci. USA, 1984, 81(21):6851-5; LoBuglio et al., Proc. Natl. Acad. Sci. USA, 1989, 86(11):4220-4; Boulianne et al., Nature, 1984, 312(5995):643-6). Humanized antibodies substitute the murine constant and framework (FR) (of the variable region) with the human counterparts (Jones et al., Nature, 1986, 321(6069):522-5; Riechmann et al., Nature, 1988, 332(6162):323-7; Verhoeyen et al., Science, 1988, 239(4847):1534-6; Queen et al., Proc. Natl. Acad. Sci. USA, 1989, 86(24):10029-33; Daugherty et al., Nucleic Acids Res., 1991, 19(9): 2471-6). Alternatively, certain mouse strains can be used that have been genetically engineered to produce antibodies that are almost completely of human origin; following immunization the B cells of these mice are harvested and immortalized for the production of human monoclonal antibodies (Bruggeman and Taussig, Curr. Opin. Biotechnol., 1997, 8(4):455-8; Lonberg and Huszar, Int. Rev. Immunol., 1995; 13(1):65-93; Lonberg et al., Nature, 1994, 368:856-9; Taylor et al., Nucleic Acids Res., 1992, 20:6287-95). Passive antibody compositions and fragments thereof, e.g., scFv, Fab, F(ab′).sub.2 or Fv or other modified forms thereof, may be administered to a recipient in the form of serum, plasma, blood, colostrum, and the like. However, the antibodies may also be isolated from serum, plasma, blood, colostrum, and the like, using known methods for later use in a concentrated or reconstituted form such as, for instance, lavage solutions, impregnated dressings and/or topical agents and the like. Passive immunization preparations may be particularly advantageous for the treatment of acute systemic illness, or passive immunization of young animals that failed to receive adequate levels of passive immunity through maternal colostrum. Antibodies useful for passive immunization may also be useful to conjugate to various drugs or antibiotics that could be directly targeted to bacteria expressing during a systemic or localized infection a protein having an epitope structurally related to an epitope present on a protein described herein.
(88) Animal models, in particular mouse models, are available for experimentally evaluating the compositions described herein. These mouse models are commonly accepted models for the study of disease caused by gram-negative microbes. In those cases where a gram-negative microbe causes disease in an animal, for instance a cow, the natural host can be used to experimentally evaluate the compositions described herein.
(89) However, protection in a mouse model is not the only way to assess whether a composition can confer protection to an animal against infection by a gram-negative microbe. The adaptive immune response consists of two primary divisions: the humoral (antibody) response and the cellular (T cell) response. Following infection by a bacterial pathogen, dendritic cells at the infection site encounter microbial antigens and produce signaling molecules such as, for example, surface receptors and cytokines in response to conserved molecular patterns associated with the specific bacterium. These signals are shaped by the nature of the pathogen and ideally lead to the appropriate antibody and T cell responses that protect the host from disease. While some bacterial diseases are controlled primarily through antibody functions, others require T cell responses or both antibody and T cell responses for protection. The goal of vaccine biology is to identify the immune responses that provide protection and then design a vaccine to reproduce one or more of these responses in humans.
(90) Antibodies can have many different functions in conferring protection against infection such as, for example, complement fixation, opsonization, neutralization, and/or agglutination. Moreover, some subclasses of antibodies are better than others at specific functions; for example, for complement fixation the following hierarchy exists for human IgG subclasses: IgG3>IgG1>IgG2>IgG4.
(91) Antibody immunological functions can be studied in a variety of ways. For instance, Western blots are used to identify antigen-specific binding based on size of separated proteins, while the standard enzyme-linked immunosorbant assay (ELISA) is used to produce quantitative information about antibody titers within serum. Antibody surface binding studies are used to determine whether antibody in serum are able to recognize antigens on the surface of intact bacteria, an important indicator of whether the antibodies have the potential to work in vivo. Thus, one skilled in the art recognizes that antibody binding assays such as a Western blot, ELISA (e.g., using human antisera), and/or surface binding correlate positively with the specifically-bound antigens providing immunological activity against microbial infection. However, one skilled in the art further recognizes that a lack of antibody binding in an assay such as, for example, a Western blot, ELISA, or surface binding assay does not mean that the assayed antigen fails to provide immunological activity against microbial infection.
(92) Antibodies can mediate bacterial death by blocking the acquisition of nutrients or initiating complement-mediated membrane perforation that leads to osmotic lysis. Bactericidal antibodies can be assayed by mixing serum with live cultures and measuring for the presence of viable bacteria under appropriate conditions known to those skilled in the art. Techniques such as opsonophagocytosis assays (OPA), in which antibody and complement-bound bacteria are combined with human or mouse phagocytes to determine levels of bacterial killing, are useful for studying antibody function. A similar oxidative burst assay can be used to assess the level of reactive oxygen species (ROS) by fresh human or mouse neutrophils following interaction with antibody and complement-bound bacteria.
(93) In some cases, one can determine that a protein described herein possesses cell-mediated immunological activity against a gram-negative microbe and, therefore, the protein may exhibit immunological activity in the absence of inducing the production of antibodies. Cytotoxic or CD8 T cells primarily kill infected cells directly through various effector mechanisms, while helper CD4 T cells function to provide important signaling in the way of cytokines. These T cell classes can be further subdivided based on the cytokines they produce, and different subclasses are effective against different bacterial pathogens. T cells are often studied by assessing their phenotypes with flow cytometry, where antibodies are used to visualize the levels of specific surface markers that enable classification of the T cells as, for example, a recently activated CD4.sup.+ T cell, a memory CD8.sup.+ T cell, etc. In addition, cytokines and other products of T cells can be studied by isolating the T cells from lymphoid tissue and restimulating them with cognate antigen. Following antigen stimulation the T cells produce cytokines that may be visualized by, for example, intracellular cytokine staining coupled with flow cytometry, or collecting the cell supernatants and using Luminex bead technology to measure 15-25 cytokines simultaneously.
(94) Thus, in addition to mouse models, those of ordinary skill in the art recognize that immunological activity commensurate with the methods described herein may correlate with any one or more of the following: Western blot data showing that serum from animals exposed to a microbial pathogen contains antibody that specifically binds to a protein described herein, Western blot data showing that serum from animals exposed to protein described herein contains antibody that specifically binds to a gram-negative microbe, cell surface binding assays demonstrating that antibody that specifically binds to a protein described herein specifically binds to a gram-negative microbe, opsonophagocytosis data, and cytokine induction.
(95) Also provided is a method for detecting antibody that specifically binds proteins described herein. These methods are useful in, for instance, detecting whether an animal has antibody that specifically binds a protein described herein, and diagnosing whether an animal may have a condition caused by a microbe expressing proteins that share epitopes with the proteins described herein. Such diagnostic systems may be in kit form. The methods include contacting an antibody with a preparation that includes a protein described herein to result in a mixture. The antibody may be present in a biological sample, for instance, blood, milk, or colostrum. The method further includes incubating the mixture under conditions to allow the antibody to specifically bind the protein to form a protein:antibody complex. As used herein, the term “protein:antibody complex” refers to the complex that results when an antibody specifically binds to a protein. The preparation that includes the proteins described herein may also include reagents, for instance a buffer, that provide conditions appropriate for the formation of the protein:antibody complex. The protein:antibody complex is then detected. The detection of antibodies is known in the art and can include, for instance, immunofluorescence or peroxidase. The methods for detecting the presence of antibodies that specifically bind to proteins described herein can be used in various formats that have been used to detect antibody, including radioimmunoassay and enzyme-linked immunosorbent assay.
(96) Kits
(97) Also provided are kits. In one embodiment, a kit is for detecting antibody that specifically binds a protein described herein. The antibody detected may be obtained from an animal suspected of having an infection caused by a gram-negative microbe. In another embodiment, a kit is for detecting a protein described herein. In yet another embodiment, a kit is for using a protein described herein, such as using a protein to produce antibody, treat a condition, or treat an infection.
(98) The kit includes at least one of the proteins described herein (e.g., one, at least two, at least three, etc.), or an antibody described herein in a suitable packaging material in an amount sufficient for at least one assay or use. Optionally, other reagents such as buffers and solutions are also included. For instance, a kit may also include a reagent to permit detection of an antibody that specifically binds to a protein described herein, such as a detectably labeled secondary antibody designed to specifically bind to an antibody obtained from an animal. Instructions for use of the packaged antibody or protein are also typically included. As used herein, the phrase “packaging material” refers to one or more physical structures used to house the contents of the kit. The packaging material is constructed by routine methods, generally to provide a sterile, contaminant-free environment. The packaging material may have a label which indicates that the proteins can be used for detecting antibody that specifically binds a protein described herein, or using a protein described herein. In addition, the packaging material contains instructions indicating how the materials within the kit are employed to detect the antibody or administer a protein to an animal. As used herein, the term “package” refers to a container such as glass, plastic, paper, foil, and the like, capable of holding within fixed limits the proteins, and other reagents, for instance a secondary antibody. Thus, for example, a package can be a microtiter plate well to which microgram quantities of proteins have been affixed. A package can also contain a secondary antibody. “Instructions for use” typically include a tangible expression describing the reagent concentration or at least one assay method parameter, such as the relative amounts of reagent and sample to be admixed, maintenance time periods for reagent/sample admixtures, temperature, buffer conditions, and the like.
Exemplary Embodiments
(99) Embodiment 1. A non-natural protein comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:5 or SEQ ID NO:6, wherein the protein protects an animal against infection with E. coli.
(100) Embodiment 2. A non-natural protein comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:3, wherein the protein reacts with convalescent serum from an animal infected with E. coli.
(101) Embodiment 3. The protein of any one of Embodiments 1 or 2 wherein the protein further comprises two or more copies of the amino acid sequence, wherein the two or more copies are present as a tandem repeat.
(102) Embodiment 4. The protein of any one of Embodiments 1 to 3 wherein the protein comprises at least three copies of the amino acid sequence, wherein the three or more copies are present as a tandem repeat.
(103) Embodiment 5. A non-natural protein comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:4, wherein the protein reacts with convalescent serum from an animal infected with E. coli.
(104) Embodiment 6. The protein of Embodiment 5 wherein the protein further comprises two or more copies of the amino acid sequence, wherein the two or more copies are present as a tandem repeat.
(105) Embodiment 7. The protein of Embodiment 5 or 6 wherein the protein comprises at least three copies of the amino acid sequence, wherein the three or more copies are present as a tandem repeat.
(106) Embodiment 8. The protein of any of one of Embodiments 1-7 wherein the protein includes a linker.
(107) Embodiment 9. The protein of Embodiment 8 wherein the protein includes a linker.
(108) Embodiment 10. The protein of Embodiment 8 or 9 wherein at least one linker comprises the amino acid sequence GSGS (SEQ ID NO:23).
(109) Embodiment 11. A non-natural protein comprising a B cell domain selected from the group consisting of SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14, and a T cell domain selected from the group consisting of SEQ ID NO:15, SEQ ID NO:16, and SEQ ID NO:17.
(110) Embodiment 12. A non-natural protein comprising a B cell domain selected from the group consisting of SEQ ID NO:18, SEQ ID NO:19, and SEQ ID NO:20, and a T cell domain selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:22.
(111) Embodiment 13. The protein of Embodiment 11 or 12 wherein the B cell domain and T cell domain are present in the order B cell domain-T cell domain.
(112) Embodiment 14. A non-natural protein comprising amino acids 7-518 of the amino acid sequence of SEQ ID NO:8 or amino acids 7-365 of the amino acid sequence of SEQ ID NO:10.
(113) Embodiment 15. A non-natural protein comprising amino acids 7-422 of the amino acid sequence of SEQ ID NO:26 or amino acids 7-461 of the amino acid sequence of SEQ ID NO:28.
(114) Embodiment 16. A non-natural protein selected from protein 1-9 of Table 1, protein 10-15 of Table 2, protein 16-51 of Table 3, protein 52-63 of Table 4, protein 64-69 of Table 5, protein 70-78 of Table 6, protein 79-90 of Table 7, or protein 91-126 of Table 8, or having at least 80% sequence identity to the amino acid sequence of protein 1-9 of Table 1, protein 10-15 of Table 2, protein 16-51 of Table 3, protein 52-63 of Table 4, protein 64-69 of Table 5, protein 70-78 of Table 6, protein 79-90 of Table 7, or protein 91-126 of Table 8.
Embodiment 17. The protein of Embodiment 16 wherein the protein further comprises a linker located between a B cell domain and a T cell domain.
Embodiment 18. The protein of Embodiment 16 wherein the protein further comprises a linker located between each B cell domain and T cell domain.
Embodiment 19. A non-natural protein comprising:
(115) a first domain comprising an amino acid sequence having at least 80% identity to amino acids 1-33 of SEQ ID NO:1,
(116) a second domain comprising an amino acid sequence having at least 80% identity to amino acids 34-48 of SEQ ID NO:1,
(117) a third domain comprising an amino acid sequence having at least 80% identity to amino acids 49-88 of SEQ ID NO:1, and
(118) a fourth domain comprising an amino acid sequence having at least 80% identity to amino acids 89-103 of SEQ ID NO:1,
(119) a fifth domain comprising an amino acid sequence having at least 80% identity to amino acids 104-133 of SEQ ID NO:1, and
(120) a sixth domain comprising an amino acid sequence having at least 80% identity to amino acids 34-148 of SEQ ID NO:1,
(121) wherein the first, third, and fifth domains have B cell activity and the second, fourth, and sixth domains have T cell activity, and wherein the protein protects an animal against infection with E. coli.
(122) Embodiment 20. A non-natural protein comprising:
(123) a first domain comprising an amino acid sequence having at least 80% identity to amino acids 1-23 of SEQ ID NO:2,
(124) a second domain comprising an amino acid sequence having at least 80% identity to amino acids 24-38 of SEQ ID NO:2,
(125) a third domain comprising an amino acid sequence having at least 80% identity to amino acids 39-75 of SEQ ID NO:2, and
(126) a fourth domain comprising an amino acid sequence having at least 80% identity to amino acids 76-90 of SEQ ID NO:2, and
(127) a fifth domain comprising an amino acid sequence having at least 80% identity to amino acids 91-101 of SEQ ID NO:2,
(128) wherein the first, third, and fifth domains have B cell activity and the second and fourth domains have T cell activity, and wherein the protein protects an animal against infection with E. coli.
(129) Embodiment 21. The protein of any one of Embodiments 1-10, 19, or 20 wherein the animal is an avian, a bovine, a caprine, an ovine, a porcine, a bison, an equine, a companion animal, a member of the family Cervidae, or a human.
(130) Embodiment 22. The protein of any one of Embodiments 1-10, 19, or 20 wherein the E. coli is CFT073.
(131) Embodiment 23. A composition comprising the protein of any one of Embodiments 1-20.
(132) Embodiment 24. The composition of Embodiment 23 further comprising a pharmaceutically acceptable carrier.
(133) Embodiment 25. The composition of Embodiment 23 or 24 further comprising an adjuvant.
(134) Embodiment 26. A method comprising:
(135) administering to a subject an amount of the composition of any one of Embodiments 23 to 25 effective to induce the subject to produce antibody that specifically binds to the protein, produce helper T cells, suppressor T cells, and/or cytotoxic T cells directed to an epitope of a protein present in the composition, or a combination thereof.
(136) Embodiment 27. A method for treating an infection in a subject, the method comprising:
(137) administering an effective amount of the composition of any one of Embodiments 23 to 25 to a subject having or at risk of having an infection caused by a gram-negative microbe.
(138) Embodiment 28. A method for treating a symptom in a subject, the method comprising:
(139) administering an effective amount of the composition of any one of Embodiments 23 to 25 to a subject having or at risk of having an infection caused by a gram-negative microbe.
(140) Embodiment 29. A method for decreasing colonization in a subject, the method comprising:
(141) administering an effective amount of the composition of any one of Embodiments 23 to 25 to a subject colonized by a gram-negative microbe.
(142) Embodiment 30. A method for treating a condition in a subject, the method comprising:
(143) administering an effective amount of the composition of any one of Embodiments 23 or 25 to a subject in need thereof, wherein the subject has or is at risk of having a condition caused by a gram-negative microbe.
(144) Embodiment 31. The method of any one of Embodiments 26 to 30 wherein the gram-negative microbe is a pathogenic microbe that is a member of the family Vibrionaceae, a member of the family Enterobacteriaceae, a member of the family Pasteurellaceae, a member of the family Pseudomonadaceae, or a Campylobacter spp.
Embodiment 32. A method for treating an infection in a subject, the method comprising:
(145) administering an effective amount of a composition to a subject having or at risk of having an infection caused by a gram-negative microbe, wherein the composition comprises antibody that specifically binds to a protein of the composition of any one of Embodiments 1 to 24.
(146) Embodiment 33. A method for treating a symptom in a subject comprising:
(147) administering an effective amount of a composition to a subject having or at risk of having an infection caused by a gram-negative microbe, wherein the composition comprises antibody that specifically binds to a protein of the composition of any one of Embodiments 1 to 24.
(148) Embodiment 34. A method for decreasing colonization in a subject, the method comprising:
(149) administering an effective amount of a composition to a subject colonized by a gram-negative microbe, wherein the composition comprises antibody that specifically binds to a protein of the composition of any one of Embodiments 1 to 24.
(150) Embodiment 35. A method for treating a condition in a subject, the method comprising:
(151) administering an effective amount of a composition to a subject in need thereof, wherein the composition comprises antibody that specifically binds to a protein of the composition of any one of Embodiments 1 to 24, wherein the subject has or is at risk of having a condition caused by a gram-negative microbe.
(152) Embodiment 36. The method of any one of Embodiments 32 to 35 wherein the gram-negative microbe is a pathogenic microbe that is a member of the family Vibrionaceae, a member of the family Enterobacteriaceae, a member of the family Pasteurellaceae, a member of the family Pseudomonadaceae, or a Campylobacter spp.
Embodiment 37. The method of any one of Embodiments 26 to 36 wherein the subject is a mammal or an avian.
Embodiment 38. The method of Embodiment 37 wherein the mammal is a human or a bovine.
Embodiment 39. The method of Embodiment 37 wherein the avian is a domesticated fowl.
Embodiment 40. The method of Embodiment 39 wherein domesticated fowl is a chicken or a turkey.
Embodiment 41. The method of any one of Embodiments 31 or 36 wherein the member of the family Enterobacteriaceae is E. coli or Klebsiella spp.
EXAMPLES
(153) The present invention is illustrated by the following examples. It is to be understood that the particular examples, materials, amounts, and procedures are to be interpreted broadly in accordance with the scope and spirit of the invention as set forth herein.
Example 1
Selection of E. coli Isolates
(154) Four avian pathogenic strains of E. coli were used in the following mouse sepsis studies. The avian strains were isolated from commercial chicken and turkey flocks showing clinical signs of colibacillosis. The avian isolates were given the following designations; APEC-280 (chicken); APEC-13 (chicken); APEC-374 (chicken) and APEC-J4 (turkey).
Example 2
Preparation of E. coli Seed Stocks
(155) To preserve the original isolates, a master seed stock of each isolate was prepared by inoculating the appropriate isolate into 200 ml of tryptic soy broth (TSB, Difco Laboratories, Detroit, Mich.) containing 300 μM 2,2-dipyridyl (Sigma-Aldrich St. Louis, Mo.). The culture was grown while stirring at 200 rpm for 6 hours at 37° C. and collected by centrifugation at 10,000×g. The bacterial pellet was re-suspended into 100 ml TSB broth containing 20% glycerol, and sterilely dispensed into 2 ml cryogenic vials (1 ml per vial) and stored at −90° C. until use. The master seed stock was expanded into a working seed. One vial of the previously prepared master seed was inoculated into 200 ml TSB, containing 300 μM 2,2-dipyridyl (Sigma). The culture was grown while stirring at 200 rpm for 6 hours at 37° C. and collected by centrifugation at 10,000×g. The bacterial pellet was resuspended into 100 ml TSB broth containing 20% glycerol, and sterilely dispensed into 2 ml cryogenic vials (1 ml per vial) and stored at −90° C. until use.
Example 3
Synthesis and Cloning of the Trimer-1 and Trimer-2 Proteins
(156) The DNA coding sequences (SEQ ID NO:7 and 9) for the Trimer-1 protein (SEQ ID NO:8) and the Trimer-2 protein (SEQ ID NO:10) were produced by chemical synthesis (InVitrogen GeneArt; Life Technologies Inc., Grand Island, N.Y.) and inserted into the pMK-RQ vector using flanking NdeI and XhoI restriction sites engineered at the 5-prime and 3-prime termini, respectively. A sequence encoding a series of six histidines was engineered immediately after the AUG methionine start codon at the 5-prime terminus. Trimer-1 and Trimer-2 constructs were subcloned into the pET29b expression vector using the flanking NdeI and XhoI restriction sites and transformed into E. coli BL21(DE3) using standard recombinant DNA techniques. Clones were selected and verified by DNA sequencing (ACGT, Inc., Wheeling, Ill.).
Example 4
Expression and Purification of Recombinant Proteins
(157) Recombinant polypeptides Trimer-1 and Trimer-2 were expressed in E. coli and purified using standard methods. In brief, frozen bacterial stocks (100 μl) were used to inoculate 20 ml of Luria-Bertani (LB) Broth containing the appropriate selective antibiotic (kanamycin for pET29b), and the culture was grown at 37° C. in a shaking incubator at 250 rpm. After 16 hours, the culture was diluted into 1 L of LB Broth containing the appropriate selective antibiotic, grown to an optical density (600 nm) of 0.6, and induced by the addition of 1 M IPTG to a final concentration of 1 mM. Alternatively, for larger batches, the culture was used to seed a 10 L fermenter that was induced with IPTG to a final concentration of 1 mM. Bacterial cell pellets were harvested by centrifugation at 4,000×g for 20 minutes at 4° C., washed in phosphate buffered saline (PBS, 8.0 g/l NaCl, 0.2 g/l KCl, 1.44 g/l Na.sub.2HPO.sub.4 and 0.24 g/l KH.sub.2PO.sub.4 pH 7.4), and stored at −80° C. until lysis. Insoluble inclusion bodies were enriched for through treatment with BUGBUSTER (Millipore) and were solubilized in an 8M urea buffer. Anion exchange (AEX) chromatography was utilized to remove endotoxin followed by a second AEX chromatography step to exchange the sample into a final buffer consisting of 20 mM sodium phosphate, 51 mM N-Octyl-β-D-glucopyranoside (nOG), 300 mM sodium chloride, and 300 mM urea (pH 9.5). The protein concentration was determined using the BCA method (Thermo Scientific, Rockford, Ill.) and polypeptide purity was measured by SDS-PAGE and densitometry (LI-COR Odyssey; LI-COR, Lincoln, Nebr.).
Example 5
Preparation of Nalidixic Acid Resistant E. coli
(158) The selected E. coli isolates from Example 1 were made nalidixic acid resistant. The purpose of inducing resistance to a known antibiotic in the challenge strain is to be able to differentiate the challenge strain from other E. coli strains that may contaminate challenged samples due to their prevalence in the environment. To induce antibiotic resistance, each isolate was grown in increasing concentrations of nalidixic acid. Briefly, two 1-liter stock solutions of TSB containing 35 gm Tryptic Soy; 5 gm yeast extract and 2,2-dipyridyl at 25 μg was prepared and autoclaved for 30 minutes and subsequently cooled to 4° C. Nalidixic acid was added to one bottle of TSB by membrane filtration through a 0.2 μm filter to a final concentration of 150 μg/ml. The TSB containing 150 μg/ml nalidixic acid was diluted in 20 ml stock (50 ml conical tubes) solution using the TSB without nalidixic acid as the diluent to obtain the following concentrations: 0 (no nalidixic acid); 25 μg/ml; 50 μg/ml; 75 μg/ml; 100 μg/ml and non-diluted 150 μg/ml.
(159) The isolates were removed from frozen storage and plated onto sheep blood agar and incubated at 37° C. for 24 hours at which point a single colony was picked and sterilely inoculated into one of the non-nalidixic acid tubes and incubated for 3 hours at 37° C. while stirring at 200 rpm. At three hours post inoculation 2 ml of the culture was transferred into 20 ml of the 25 μg/ml nalidixic acid tubes that was pre-warmed to 37° C. The cultures were allowed to grow at 37° C. while rapidly stirring at 200 rpm for 3 hours. This process was repeated two times and then transferred to the next concentration of nalidixic acid. If growth did not occur the process was repeated in the previous concentration and then transferred to the next increasing concentration. This was done for each concentration until growth was established at the highest concentration of nalidixic acid. Once growth was established at the 150 μg/ml level, the cultures were then plated onto EMB containing 150 μg/ml nalidixic acid. A single colony of each isolate was selected and transferred into 100 ml TSB containing 150 μg/ml nalidixic acid (media as described above). The cultures were allowed to grow at 37° C. for 4.5 hours or until an OD of 1.0 at 540 nm was achieved. The cultures were centrifuged at 8000 rpm for 20 minutes at which point the supernatants were discarded and the pellets re-suspended in 90 ml of TSB media as described above but containing 20% glycerol and 25 μg/ml 2,2-dipyridyl. One ml aliquots of each bacterial suspension were dispensed into 2 ml cryovials and stored at −90° C. until use.
Example 6
Preparation of E. coli Challenge Strains
(160) In order to use these isolates as challenge strains, each isolate was dosed in mice to determine an approximate LD-80. Briefly, the nalidixic acid resistant strains previously prepared in Example 5 were subcultured from frozen stocks; 100 μl/100 ml into freshly prepared TSB containing 35 gm TSB; 5 gm yeast extract and 2,2-dipyridyl at 25 μg/liter. The cultures were stirred at 100 rpm for 14 hours at which point each was subcultured in the same media as described above that was pre-warmed to 37° C. From the overnight cultures 100 μl was sterilely transferred into 20 ml of the TSB media. The cultures were allowed to grow for 2 hours while shaking at 200 rpm at 37° C. After the 2 hour time period, 10 ml of each culture was transferred to 100 ml of pre-warmed TSB and incubated at 37° C. The cultures were allowed to grow until an OD of 1.2 at 540 nm was reached; at which point the culture was centrifuged at 8000 rpm for 15 minutes and each isolate was re-suspended into 50 ml cold PBS pH 7.2. The cultures were kept on ice until use.
Example 7
Serial Passage in Mice
(161) To enhance the virulence of each isolate, each organism was serially passaged in the new host species (mice). Briefly, using the cultures as described above in Example 3, two mice were subcutaneously injected with either 0.1 or 0.2 cc at 1.0×10.sup.9 CFU/ml of each isolate. Twenty-four hours post-inoculation mice were morbid but did not die. Mice were euthanized by cervical dislocation and each liver was cultured using a flamed loop that was plated onto blood agar and eosin methylene blue (EMB) agar containing 150 μg/ml nalidixic acid. Plates were incubated at 37° C. for 24 hours. A number of colonies from the 0.2 dose had grown on both the EMB and blood plate indicating the isolates had gone systemic. These colonies were streaked for isolation and again passed through mice using the same regimen. This time the 0.2 cc dose had approximately 20-50 colonies. This was repeated; livers cultured and plates had greater than 100 colonies. The liver cultured isolates were passed two additional times in mice (five serial passes total) which resulted in all mice dying at 24 hours post challenge; clearly demonstrating that each of the isolates adapted to grow in the new host species by the enhancement of virulence with death as the outcome parameter.
Example 8
Preparation of Frozen Working Seeds (Mouse Pass 5)
(162) The nalidixic acid resistant E. coli isolates of serial mouse pass five were subcultured from EMB plates and expanded into frozen working seeds. Briefly single colonies from the EMB plates were subcultured into 20 ml of TSB containing 32 g TSB; 5 g yeast extract and 2,2-dipyridyl at 25 μg/liter. The cultures were allowed to stir at 200 rpm for 2 hours at which point they were subcultured in the same media that was pre-warmed to 37° C. After the 2 hour time period, 10 ml of each culture was transferred to 100 ml of pre-warmed TSB as described above except the concentration of 2,2-dipyridyl was 25 μg/l. These cultures were allowed to grow until they reached an OD 1.0 at 540 nm at which point they were centrifuged at 8000 rpm for 10 minutes and resuspended into 90 ml cold TSB as described above, plus the addition of 20% glycerol. One ml aliquots of each bacterial suspension were dispensed into 2 ml cryovials; labeled and stored at −90° C. until use.
Example 9
Serial Passage of APEC-280 in Chickens
(163) The previous working seed APEC-280 of Example 1 that had been made nalidixic acid resistant as described in Example 5 was passed in chickens and expanded into a new working seed. This was done to enhance the virulence of APEC-280 isolate. Briefly, two seven week old specific pathogen free leghorn hens obtained from Valo BioMedia, (Adel, Iowa) were IV injected with either 0.1 or 0.2 cc at 1.0×10.sup.8 CFU/ml of the APEC-280 isolate. Twenty-four hours post inoculation chickens were morbid but did not die. Chickens were euthanized by cervical dislocation and each liver was cultured using a flamed loop and plated onto blood agar and EMB agar containing 150 μg/ml nalidixic acid. Plates were incubated at 37° C. for 24 hours. A number of colonies from the 0.2 dose had grown on both the EMB and blood plate indicating the isolates had gone systemic. These colonies were streaked for isolation and again passed through chickens using the same regimen. This time the 0.2 cc dose had approximately 20-50 colonies. This was repeated; livers were cultured and plates now had greater than 100 colonies. The liver cultured isolates were again passed two more consecutive times in chickens (five serial passes total) which resulted in all chickens dying at 24 hours post challenge, clearly demonstrating that the APEC-280 isolate adapted to grow in the new host species by the enhancement of virulence with death as the outcome parameter. This seed was expanded into a new working seed using the same culture methodology of Example 8 and used as the challenge strain in chickens and turkeys as described in the following experiments.
Example 10
Sepsis Lethal Dose Preparation
(164) The E. coli isolates, now nalidixic acid resistant and virulent in mice, were dose titrated to induce mortality in 80-100% of mice challenged subcutaneously. Briefly, 24 hours before challenge, 100 ml of TSB containing 35 g of tryptic soy; 5 g yeast extract and 25 μg/ml 2,2-dipyridyl per liter was inoculated from the frozen stocks (100 μl) of Example 8 and incubated for 14 hours at 37° C. while stirring at approximately 100 rpm. Fourteen hours post inoculation of the above culture; 100 μl was then inoculated into 20 ml of pre-warmed TSB as described above in 50 ml conical tubes; incubated at 37° C. while stirring at 200 rpm to an OD of 0.8 at 540 nm. Once the cultures reached an OD 0.8; 10 ml of each culture was sterilely inoculated into 100 ml of pre-warmed TSB containing 35 g of tryptic soy; 5 g yeast extract and 25 μg/ml 2,2-dipyridyl per liter; incubated at 37° C. while stirring at 200 rpm until an OD of 0.92-0.95 at 540 nm was reached. Immediately upon reaching the desired OD, the cultures were transferred to 250 ml centrifuge bottles at which point 100 ml of 4° C. PBS was added to stop growth. The cultures were centrifuged for 20 minutes using a JA14 Beckman rotor at 8,000×g. After centrifugation, the supernatants were removed using individual 50 ml pipets and the supernatants discarded. Then 20 ml of 4° C. PBS was added back to the individual pellets and evenly resuspended by pipetting. The bacterial suspension was transferred to a 50 ml conical tube and vortexed vigorously (30 seconds) to evenly disperse the bacterial pellets. Each bacterial suspension was transferred to a sterile 250 ml centrifuge bottle, at which point it was brought back to its original volume of 100 ml by adding 80 ml of 4° C. PBS and mixing thoroughly.
Example 11
Sepsis Lethal Dose Titration
(165) The bacterial suspensions of Example 10 were tested in mice at different dilutions: 1) direct 0.1 cc of non-diluted stock bacterial suspension, 2) stock suspension diluted 1:2 (1 ml into 1 ml) in cold PBS pH 7.4; 3) stock suspension diluted 1:10 (1 ml into 9 ml) in cold PBS pH 7.4 and 4) stock suspension diluted 1:100 (1 ml into 99 ml) in cold PBS pH 7.4. Each dilution was given to 10 mice via subcutaneous injection using a volume of 0.1 cc. Mice were observed for 7 days post challenge for mortality. These data showed that the non-diluted bacterial stock suspension derived from isolates APEC-280, APEC-13, APEC-374 and APEC-J4 killed 100% of the mice within a 24 hour time period, as compared to the 1:2 diluted stock suspension, which killed 30% of the mice at 24 hours and 50% of the mice at the 48 hour time period. Furthermore, no mice receiving the 1:10 dilution died within the observation period. Based on this preliminary evaluation, the challenge dose of the APEC isolates was determined to be a 1:2 dilution of the stock suspension of approximately 2.0×10.sup.8 CFU/ml. Thus, the frozen APEC isolates of Mouse Pass 5 were used at a mouse dose of approximately 2.0×10.sup.7 CFU in a 0.1 ml volume.
Example 12
Enzyme-Linked Immunosorbent Assay (ELISA)
(166) The immunological response to individual recombinant proteins was determined by measuring the IgG titers by ELISA. In brief, 100 μl of polypeptide at 2 μg/ml, solubilized in 5 M urea, was added to each well of a 96-well EIA/RIA plate (Corning/Costar 3590) and incubated overnight at 4° C. All remaining steps were performed at room temperature. The plate was washed three times with PBS wash buffer (PBS containing 0.05% Tween 20) followed by the addition of 200 μl/well sample buffer consisting of PBS containing 0.05% Tween 20 and 1% bovine serum albumin. After 90 minutes, the sample buffer was replaced with 100 μl/well PBS sample buffer. Serial 1:3 dilutions of the primary antisera were performed in the plate by the addition of 50 μl to the first row, mixing 10 times, and transfer of 50 μl to the next row. The plate was incubated for 90 minutes followed by three washes and addition of 100 μl/well of an HRP conjugated goat anti-mouse IgG, heavy chain specific antibody (Jackson ImmunoResearch, West Grove, Pa.). After a 90 minute incubation period the plate was washed four times followed by the addition of 100 μl TMB (BioFx; Surmodics, Eden Prairie, Minn.)/well. Color was allowed to develop for 30 minutes, and the reaction was stopped by the addition of 100 μl stop reagent (BioFx). The absorbance was measured at a wavelength of 450 nm, and the titer was calculated as the inverse of the dilution corresponding to an absorbance of 1.0. Controls included a standardized primary serum included on each plate to monitor assay variability and wells that were uncoated to subtract background. The limit of detection for the assay was the inverse of the initial serum dilution.
Example 13
Evaluation of Vaccine Efficacy in Mice Challenged with Different Strains and Serotypes of E. coli
(167) Experimental Overview of Sepsis Experiments
(168) The overall goal of the following studies was to evaluate the efficacy of Trimer-1 and Trimer-2 as vaccine antigens to control various disease conditions caused by gram-negative bacteria. Four different strains of E. coli were used for the following experimental challenges; APEC-280, APEC-13, APEC-J4, and APEC-374 of Example 8.
(169) In this first study, we evaluated the efficacy of Trimer-1 against challenge with four different strains of E. coli: APEC-280; APEC-13; APEC-J4 and APEC-374. The outcome parameters used to evaluate vaccine efficacy were 1) efficacy of a single protein, Trimer-1, against systemic challenge and 2) ability of Trimer-1 to cross-protect against different strains and/or serotypes.
(170) Briefly, 180 female Harlan CF-1 mice obtained from Charles River Laboratory (Wilmington, Mass.) weighing 16-22 grams were equally divided into 4 experimental groups (45 mice/group) designated as 1-4 (Table 9). Each of these groups was further divided into 3 subgroups so that each subgroup consisted of 15 mice designated now as 1 (A, D, E); 2 (F, I, J); 3 (K, N, O) and 4 (P, S, T) (Table 9). Each subgroup represented a vaccine formulation consisting of an adjuvanted placebo control and Trimer-1 formulated at 100 μg or 150 μg total protein. Thus, all groups consisted of an adjuvanted placebo and two vaccine formulations with different doses of Trimer-1.
(171) TABLE-US-00009 TABLE 9 Experimental Design. Total Vaccine Antigen Volume Vaccine Challenge Groups Mice Vaccine (ug) Adjuvant (ul) # Vaccines Route strain Group-1 A 15 PBS N/A AlOH 100 2 SC APEC-280 D 15 Trimer-1 100 AlOH 100 2 SC APEC-280 E 15 Trimer-1 150 AlOH 100 2 SC APEC-280 Group-2 F 15 PBS N/A AlOH 100 2 SC APEC-13 I 15 Trimer-1 100 AlOH 100 2 SC APEC-13 J 15 Trimer-1 150 AlOH 100 2 SC APEC-13 Group-3 K 15 PBS N/A AlOH 100 2 SC APEC-J4 N 15 Trimer-1 100 AlOH 100 2 SC APEC-J4 O 15 Trimer-1 150 AlOH 100 2 SC APEC-J4 Group-4 P 15 PBS N/A AlOH 100 2 SC APEC-374 S 15 Trimer-1 100 AlOH 100 2 SC APEC-374 T 15 Trimer-1 150 AlOH 100 2 SC APEC-374
(172) Mice were housed in polycarbonate cages (Ancore Corporation, Bellmore, N.Y.) at 5 mice per cage with food and water supplied ad libitum. All mice were allowed to acclimate one week prior to the first vaccination. Mice were vaccinated two times at 21 day intervals and challenged 21 days post second vaccination. Groups were challenged with one of four challenge strains (Table 9).
Example 14
Vaccine Preparation and Vaccination
(173) Vaccines containing recombinant Trimer-1 protein were prepared at 100 μg and 150 μg protein per dose in PBS formulated with 20 percent (v/v) ALHYDROGEL (Invivogen, San Diego, Calif.) in a final volume of 0.1 ml (Table 9). The placebo vaccines were prepared by substituting PBS for the aqueous protein suspension of the above described formulation. Mice were vaccinated two times at 21 day intervals.
Example 15
Preparation of Challenge Organisms
(174) The four E. coli isolates APEC-280; APEC-13; APEC-J4 and APEC-374 as previously described in Example 1 were used as the challenge strains. Briefly, each isolate from a frozen stock of Example 8 was streaked onto a blood agar plate and incubated at 37° C. 18 hours. A single colony was subcultured into 50 ml of TSB (Difco) containing 25 μg per ml of 2,2′ dipyridyl (Sigma). The cultures were allowed to grow for 12 hours at 37° C. while rotating at 100 rpm, at which point they were subcultured 1:100 into a final volume 50 ml of TSB as described above. The subcultures were incubated at 37° C. for 3 hours while rotating at 200 rpm, and allowed to reach an optical density (540 nm) of 0.6-0.8. Each culture was then subcultured a final time by transferring 10 ml into 90 ml of pre-warmed TSB containing 25 μg per ml of 2,2′ dipyridyl and incubated at 37° C. for approximately 4 hours while rotating at 200 rpm until an optical density of 0.90-0.95 at 540 nm was reached. The growth of each culture was stopped by adding 100 ml of PBS at 4° C. The cultures were then centrifuged at 10,000×g for 15 minutes at 4° C. to pellet the bacteria. The bacterial pellets were washed once by centrifugation in PBS at 4° C. Twenty five milliliters of cold PBS was added to each bacterial pellet and vortexed vigorously for 30 seconds to thoroughly resuspend the pellets. This was followed by 75 ml of cold PBS added to each bacterial suspension for a final volume of 100 ml. Each culture was then diluted 1:2 in cold PBS and used for challenge. Just prior to challenge, 1 ml of the final bacterial suspension was serially diluted 10-fold and plated onto blood agar and EMB agar (containing 100 μg/ml of nalidixic acid) to enumerate the number of colony-forming units (CFU) per mouse dose.
Example 16
Challenge
(175) Twenty one days after the second vaccination, all mice in groups 1 (A, D, E); 2 (F, G, J); 3 (K, N, O) and 4 (P, S, T) (Table 9) were subcutaneously challenged with 0.1 ml of the appropriate challenge strain. Group 1 (A, D, E) was challenged with APEC-280 at 1.0×10.sup.7 colony forming units. Group 2 (F, G, J) was challenged with APEC-13 at 4.5×10.sup.7 colony forming units. Group 3 (K, N, O) was challenged with APEC-J4 at 8.0×10.sup.7 colony forming units; while group 4 (P, S, T) was challenged with APEC-374 at 5.5×10.sup.7 colony forming units. Mortality was recorded daily for 10 days post-challenge. Table 10 shows the total mortality and percent survival of all groups following challenge for the 10 day observation period.
(176) TABLE-US-00010 TABLE 10 Total Mortality and Percent Livability following Challenge using APEC-280, APEC 13, APEC J4 and APEC 374. Number Dead on Indicated Days Post Challenge Challenge Total Percent Treatments 1 2 3 4 5 6 7 8 9 10 Strain Mortality Survivability Group-1 A) Placebo Adjuvanted 0 15 0 0 0 0 0 0 0 0 APEC-280 15/15 0 D) Trimer-1 100 μg 0 6 0 0 0 0 0 0 0 0 APEC-280 6/15 60 E) Trimer-1 150 μg 0 2 1 0 0 0 0 0 0 0 APEC-280 3/15 80 Group-2 F) Placebo Adjuvanted 0 7 2 0 2 2 0 0 0 0 APEC-13 13/15 13 I) Trimer-1 100 μg 0 3 0 0 0 0 0 0 0 0 APEC-13 3/15 80 J) Trimer-1 150 μg 0 2 0 2 0 0 0 0 0 0 APEC-13 4/15 73 Group-3 K) Placebo Adjuvanted 4 4 2 0 0 0 0 0 0 0 APEC-J4 10/15 33 N) Trimer-1 100 μg 0 0 0 0 0 0 0 0 0 0 APEC-J4 0/15 100 O) Trimer-1 150 μg 0 1 0 0 0 0 0 0 0 0 APEC-J4 1/15 93 Group-4 P) Placebo Adjuvanted 3 0 12 0 0 0 0 0 0 0 APEC-374 15/15 0 S) Trimer-1 100 μg 10 0 0 0 0 0 0 0 0 0 APEC-374 10/15 33 T) Trimer-1 150 μg 2 11 1 0 0 0 0 0 0 0 APEC-374 14/15 7
Example 17
Challenge Results
(177) Both doses of Trimer-1 showed excellent efficacy against systemic challenge using APEC-280; APEC-13 and APEC-J4 (Table 10;
(178) Results were comparable when using APEC-13 as the challenge strain. Group 2 (F, I, J) challenged with APEC 13, as illustrated in
(179) Similar results were obtained in group 3 (K, N, O) challenged with APEC J4 (Table 10;
(180) In contrast to the other E. coli isolate tested, only moderate protection was achieved against challenge by APEC-374 (Table 10;
(181) Overall, these studies demonstrated that Trimer-1 protected against multiple different strains of E. coli in a lethal murine sepsis model.
Example 18
Efficacy of Trimer-1 and Trimer-2 Against a Virulent E. coli Challenge in a Mouse Sepsis Model
(182) The efficacy of recombinant Trimer-1 and Trimer-2 was evaluated using a live virulent E. coli challenge with APEC-280 in mice, with death as the endpoint. The outcome parameters used to evaluate vaccine efficacy against APEC-280 were 1) titration of the antigenic dose of Trimer-1 and Trimer-2 to establish the range of protection against APEC-280, 2) duration of protection for Trimer-1 at both 3 and 8 weeks post-vaccination, and 3) correlation of antibody titers with survival.
(183) Briefly, 165 female Harlan CF-1 mice obtained from Charles River Laboratory (Wilmington, Mass.) weighing 16-22 grams were equally divided into 11 treatment groups (n=15 mice/group) designated as indicated (Table 11). Mice were vaccinated two times at 21 day intervals and challenged with APEC-280 at 3 or 8 weeks post second vaccination. Mice were housed in polycarbonate cages (Ancore Corporation, Bellmore, N.Y.) at 5 mice per cage with food and water supplied ad libitum. All mice were allowed to acclimate one week prior to the first vaccination.
Example 19
Vaccine Preparation and Vaccination
(184) Vaccines containing Trimer-1 or Trimer-2 were prepared at three different concentrations to establish an appropriate dose range of the specific recombinant protein. Trimer-1 was also evaluated to determine duration of immunity (DOI) at 3 and 8 weeks post second vaccination. Dose levels of 50 μg, 100 μg and 150 μg total protein were prepared in PBS formulated with 20 percent (v/v) ALHYDROGEL (Invivogen, San Diego, Calif.) in a final volume of 0.1 ml (Table 11). To evaluate the duration of immunity; mice were divided into two groups. Mice in groups A-I were used for establishing the duration of immunity at 3 weeks post second vaccination for Trimer-1 and Trimer-2 while mice in groups J-P were used to evaluate the duration of immunity 8 weeks post second vaccination (Table 11). Mice in groups A-I were vaccinated two times at 21 day intervals with the appropriate vaccine formulation and challenged 21 days post second vaccination; mice in groups M-P were vaccinated using the same regimen but were challenged 8 weeks post second vaccination (Table 11). Blood was taken from both groups on the day of first vaccination and again at 24 hours pre-challenge. Mice in groups A and P served as the placebo controls. The placebo vaccines of groups A and P were prepared by substituting PBS for the aqueous protein suspension as described in the above procedure.
(185) TABLE-US-00011 TABLE 11 Experimental Design. Total Vaccine Antigen Volume Vaccine Rest Challenge Group Mice Vaccine (μg) Adjuvant (ul) # Vax Route Period Strain A 15 PBS N/A AlOH 100 2 SC 3 APEC-280 C 15 Trimer-1 150 AlOH 100 2 SC 3 APEC-280 D 15 Trimer-1 100 AlOH 100 2 SC 3 APEC-280 E 15 Trimer-1 50 AlOH 100 2 SC 3 APEC-280 G 15 Trimer-2 150 AlOH 100 2 SC 3 APEC-280 H 15 Trimer-2 100 AlOH 100 2 SC 3 APEC-280 I 15 Trimer-2 50 AlOH 100 2 SC 3 APEC-280 M 15 Trimer-1 150 AlOH 100 2 SC 8 APEC-280 N 15 Trimer-1 100 AlOH 100 2 SC 8 APEC-280 O 15 Trimer-1 50 AlOH 100 2 SC 8 APEC-280 P 15 PBS N/A AlOH 100 2 SC 8 APEC-280
Example 20
Preparation of Challenge Organism
(186) The E. coli APEC-280 isolate previously described in Example 1 was used as the challenge strain. Briefly, the isolate from a frozen stock of Example 8 was streaked onto a blood agar plate and incubated at 37° C. 18 hours. A single colony was subcultured into 50 ml of TSB (Difco) containing 25 μg per ml of 2,2′ dipyridyl (Sigma). The culture was allowed to grow for 12 hours at 37° C. while rotating at 100 rpm at which point was subcultured 1:100 into a final volume 50 ml of TSB as described above. The culture was incubated at 37° C. for 3 hours while rotating at 200 rpm, and allowed to reach an optical density (540 nm) of 0.6-0.8. The culture was then subcultured a final time by transferring 10 ml into 90 ml of pre-warmed TSB containing 25 μg per ml of 2,2′ dipyridyl (Sigma) and incubated at 37° C. for approximately 4 hours while rotating at 200 rpm until an optical density of 0.92-0.95 at 540 nm was reached. The growth of the culture was stopped by adding 100 ml of PBS at 4° C. The culture was then centrifuged at 10,000×g for 15 minutes at 4° C. to pellet the bacteria. The bacterial pellet was washed once by centrifugation in PBS at 4° C. The final pellet was re-suspended back into 100 ml of cold PBS. This culture was then diluted 1:2 in cold PBS and used for challenge. Just prior to challenge, 1 ml of the final bacterial suspension was serially diluted 10-fold and plated onto blood agar and EMB agar (containing 100 μg/ml of nalidixic acid) to enumerate the number of colony-forming units (CFU) per mouse dose.
Example 21
Challenge Results
(187) After the second vaccination, all mice in groups A-I (3 week DOI) and M-P (8 week DOI) were subcutaneously challenged with 0.1 ml at 1.0×10.sup.7 colony forming units (CFU) of the virulent APEC-280 isolate to evaluate the protective efficacy of the recombinant proteins. Mortality was recorded daily for 10 days post-challenge. Table 12 shows the total mortality and percent survival of all groups following challenge with APEC-280 for the 10 day observation period.
(188) TABLE-US-00012 TABLE 12 Total Mortality and Percent Livability following Challenge using APEC-280. Duration of Number Dead/ Percent Immunity Challenge Number Tested Survival Treatments (DOI) Strain (% Mortality) (%) A) Placebo 3 APEC-280 15/15 (100) 0 Adjuvanted C) Trimer-1 150 μg 3 APEC-280 1/15 (7) 93 D) Trimer-1 100 μg 3 APEC-280 8/14 (57) 43 E) Trimer-1 50 μg 3 APEC-280 12/15 (80) 20 G) Trimer-2 150 μg 3 APEC-280 6/13 (46) 54 H) Trimer-2 100 μg 3 APEC-280 4/15 (27) 73 I) Trimer-2 50 μg 3 APEC-280 6/15 (40) 60 M) Trimer-1 150 μg 8 APEC-280 2/15 (13) 87 N) Trimer-1 100 μg 8 APEC-280 1/14 (7) 93 O) Trimer-1 50 μg 8 APEC-280 11/14 (79) 21 P) Placebo 8 APEC-280 14/15 (93) 7 Adjuvanted
(189) Trimer-1 showed excellent immunogenicity (
(190) Trimer-2 was also efficacious when challenged at 3 weeks post second vaccination.
(191) The difference in these results between Trimer-1 and Trimer-2 could possibly be due to random chance or variation in the animal model at the time of challenge.
(192) In this study, we compared the duration of immunity for Trimer-1 following challenge at both 3 and 8 week resting periods. The efficacy observed after an 8 week resting period was similar to that of the 3 week resting period, with the top two doses of 150 and 100 ug reaching statistical significance (
Example 22
Serology Results
(193)
Example 23
Mucosal Immunization with Trimer-1
(194) The mucosal surface is a primary site of infection for many bacteria, including gram-negatives, whose portals of entry include the gastrointestinal tract, lung, and urinary tract. A protective immune response that includes IgA production at the mucosal surface may be critical to the design of an effective vaccine against these types of infections. However, mucosal delivery of protein antigens can be challenging in terms of protecting the antigen and enhancing its translocation to mucosa-associated lymphoid tissue. To circumvent these difficulties, a variety of delivery systems and mucosal adjuvants have been developed. Nonetheless, there is currently no way to predict whether a protein will be taken up and presented in manner that will induce a strong mucosal immune response. To test this capability, vaccines were administered intranasally using a formulation that contained cholera toxin (CT), which is an adjuvant known to promote a mucosal immune response.
(195) Female CBA/J mice (The Jackson Laboratory, Bar Harbor, Me.) were received at 5-6 weeks of age and acclimated for 1 week prior to immunization. Mice were housed under SPF conditions at 5 mice per cage with food and water supplied ad libitum. Three immunizations of 100 μg given two weeks apart were administered in a total volume of 20 delivered intranasally (IN) at 10 μl/nare (Table 13). The vaccine antigens were diluted in PBS and admixed with cholera toxin to yield 2 μg/dose. Ovalbumin, which has been used as a model antigen by many researchers and is capable of inducing a mucosal response, was included as a comparator. Blood and urine were harvested at 2 weeks after the third vaccination and evaluated for IgG by ELISA, performed as described in Example 12 above. A HRP-conjugated goat anti-mouse IgA, heavy-chain specific secondary antibody (Jackson Immunoresearch), was substituted in the procedure to quantify levels of IgA.
(196) TABLE-US-00013 TABLE 13 Experimental design for mucosal immunization with Trimer-1. Antigen/ Vaccine Immunizing Mice dose volume antigen(s) (N) (μg) Adjuvant (μl) # Vax Route Placebo 5 NA 2 ug CT 20 3 IN Ovalbumin 5 100 2 ug CT 20 3 IN Trimer-1 5 100 2 ug CT 20 3 IN
Example 24
Serology Results
(197) Levels of IgG in serum were approximately three times higher for ovalbumin compared with Trimer-1, but a good response was observed against both antigens (Table 14). The level of serum IgA produced against Trimer-1 was comparable to that of ovalbumin. In urine, Trimer-1 induced slightly higher levels of IgA and comparable levels of IgG. No antibodies to ovalbumin or Trimer-1 were detected in the placebo. The results indicate that Trimer-1 is capable of inducing a mucosal immune response that is comparable to that of a model antigen such as ovalbumin.
(198) TABLE-US-00014 TABLE 14 IgG and IgA produced in serum and urine in response to intranasal (IN) vaccination with Trimer-1. Target Titer Immunizing Dose protein in IgG IgA antigen(s) (ug) Adjuvant ELISA Serum Urine Serum Urine Placebo NA CT Ovalbumin; ND ND ND ND Trimer-1 Ovalbumin 100 CT Ovalbumin 9.5 × 10.sup.4 18 1.2 × 10.sup.3 142 Trimer-1 100 CT Trimer-1 3.1 × 10.sup.4 14 2.0 × 10.sup.3 229 ND, not detected
Example 25
Mucosal Immune Response and Protection Against Urinary Tract Infection by Different Formulations of Trimer-1
(199) The objective of this study was to evaluate a variety of formulations and prime-boost immunization regimens to evaluate the potential of Trimer-1 to induce a mucosal immune response and also to protect against E. coli urinary tract infection (UTI). The adjuvant formulations used for the prime (first vaccination) and boost (second, third, and fourth vaccinations) is shown in Table 15. Cholera toxin (CT) and double-mutant labile toxin (dmLT) are well-established mucosal adjuvants and were employed for IN vaccinations only. Squalene forms an oil in water nanoemulsion and has been used for both mucosal and systemic vaccination, while aluminum hydroxide is typically used only for the systemic route. Monophosphoryl lipid A (MPLA) is a TLR4 agonist capable of causing a shift to a Th1 type of immune response.
(200) TABLE-US-00015 TABLE 15 Prime and boost adjuvants used to test induction of a mucosal response and protection against urinary tract infection. Prime Boost Group Adjuvant Route Adjuvant Route A None (PBS) IN None (PBS) IN C Cholera toxin (CT) IN CT IN E CT + squalene (50%) IN CT + squalene (50%) IN G Double-mutant labile IN dmLT IN toxin (dmLT) H Aluminum hydroxide SC CT IN (20%) (AlOH) I AlOH + monophosphoryl SC CT IN lipid A (MPLA) J Squalene SC CT IN
(201) TABLE-US-00016 TABLE 16 Experimental Design. Total Antigen/ Vaccine Mice Dose Volume Rest Challenge Group (N) Vaccine (μg) Adjuvant (μl) # Vax Period Strain A 3 PBS N/A See Table 20 4 3 UPEC-25 (Placebo) 15 C 5 Trimer-1 100 20 4 3 UPEC-25 E 4 Trimer-1 100 20 4 3 UPEC-25 G 5 Trimer-1 100 20 4 3 UPEC-25 H 4 Trimer-1 100 20 4 3 UPEC-25 I 5 Trimer-1 100 20 4 3 UPEC-25 J 5 Trimer-1 100 20 4 3 UPEC-25
(202) Female C3H/HeOuJ mice (The Jackson Laboratory) were received at 5-6 weeks of age and acclimated for 1 week prior to immunization. Mice were housed under SPF conditions at 5 mice per cage with food and water supplied ad libitum. Mice were immunized with 100 μg of Trimer-1 four times, with two weeks between each of the first three vaccinations and a four week interval between the third and fourth vaccinations. All vaccines were formulated and administered as described in Tables 15 and 16. The compositions included CT (Sigma, St. Louis, Mo.) at 2 μg/dose, dmLT (provided by John Clements, Tulane University, New Orleans, La.) at 2 μg/dose, squalene (Addavax; InvivoGen, San Diego, Calif.) prepared according to the manufacturer's recommendations at a final concentration of 50% (v/v), AlOH (ALHYDROGEL, InvivoGen) at a final concentration of 20% (v/v), and MPLA (InvivoGen) at 10 μg/dose. Subcutaneous (SC) immunizations were injected in a 100 μl volume, and IN immunizations were administered in a 20 μl volume (10 μl per nare).
(203) IgG and IgA titers were evaluated by ELISA in serum, urine, and feces at two weeks after the fourth vaccination (Week 10). Blood was processed for serum and urine was collected over a period of 2-3 days. Fecal pellets were suspended in 150 μl/pellet of PBS containing a protease inhibitor cocktail, 1% bovine serum albumin, 0.05% Tween 20, 50% glycerol, 0.1% sodium azide. Pellets were processed by vortexing to obtain a homogenous slurry. Solid debris was removed by centrifugation at 12,000×g for 5-10 minutes, and the supernatant was retained for testing. All serum, urine, and fecal samples were stored at −20° C. until they were tested by ELISA (Example 12).
(204) The mice were challenged after a 3 week rest period. In brief, mice were anesthetized with ketamine/xylazine, the bladder was catheterized using sterile polyethylene tubing (BD INTRAMEDIC™ polyethylene tubing, 0.28/0.61 mm inner/outer diameter) 1 inch in length. A 20 μl volume of bacteria was administered transurethrally (TU) using a syringe infusion pump at a rate of 1 μl per second. To increase the percentage of naïve control mice that develop chronic infection of the bladder and kidney, the challenge was delivered in two doses as a primary infection followed by superinfection containing the same number of CFU, which was delivered within 1-2 hours of the primary infection.
(205) At 7 days after infection, the bladder and left kidney were harvested and homogenized in 200 μl and 400 μl, respectively, of PBS. Ten-fold dilutions of the homogenates were plated on Levine EMB agar and incubated at 37° C. overnight. The colonies were counted and expressed as the total CFU per bladder or kidney. Based on the dilution scheme, the calculated limit of detection (LOD) was 8 CFU for bladder and 16 CFU for kidney.
Example 26
Preparation of Challenge Organism for UTI
(206) UPEC-25 is a clinical isolate of E. coli obtained from a patient with a urinary tract infection. Frozen stocks of UPEC-25 were prepared as follows. The isolate was plated onto blood agar and incubated at 37° C. overnight. A single colony was inoculated into 25 ml TSB followed by overnight incubation at 37° C. with agitation at 250 rpm. The next day, the organism was subcultured at a 1/100 dilution into TSB and incubated at 37° C. with agitation at 250 rpm. Growth was monitored every 1-2 hours using a spectrophotometer at a wavelength of 600 nm. At an OD of 0.6-0.8, the cells were pelleted by centrifugation at 5,000×g (4° C.) for 10 minutes. The supernatant was removed, and the cell pellet was resuspended in the original culture volume of PBS, followed by centrifugation at 5,000×g (4° C.) for 10 minutes. After removing the supernatant, the pellet was resuspended at one-tenth the original volume in TSB containing 20% glycerol, distributed into cryovials, and immediately frozen and stored at −80° C.
(207) The challenge dose for UTI was prepared as follows. On Day 1, a cryovial aliquot was thawed quickly and mixed by vortexing, and a 20 μl volume was transferred into 10 ml LB broth in a 50 ml conical tube. The culture was incubated without agitation (i.e., stationary) at 37° C. for 20-24 hours. On Day 2, 10 μl of the culture was subcultured into 10 ml LB broth and incubated without agitation, overnight at 37° C. On Day 3, the 10 ml culture was transferred into a 1 L flask containing 500 ml pre-warmed LB broth, incubated under stationary conditions at 37° C., and allowed to grow to an OD of approximately 0.6, which typically occurred over a 2-3 hour period. The cells were harvested by centrifugation for 10 minutes at 5,000×g, 4° C., and resuspended in an appropriate volume of sterile PBS to achieve the targeted challenge dose in a volume of 20 μl. The actual challenge dose delivered was determined by serial dilution and plating on EMB agar.
Example 27
Challenge Results
(208) All vaccinated groups showed protection against urinary tract infection at 7 days after challenge with UPEC-25, regardless of the adjuvant or vaccination regimen (
Example 28
Serology Results
(209) IgG and IgA titers in serum, urine, and feces are shown in
Example 29
Increased Immune Response and Protection Against Urinary Tract Infection with Escalating Doses of Trimer-1
(210) C3H/HeOuJ mice were immunized with the group E formulation of CT+squalene as described in Example 25. The vaccine formulation contained either 25, 100, or 200 μg of Trimer-1 per dose (Table 17). The vaccines were administered IN at 10 μl/nare, with the highest dose of 200 μg administered in two successive rounds of immunization. Mice received four vaccinations, two weeks apart, with a two week rest period before challenge. Blood, urine, and feces were collected after the fourth vaccination, just prior to challenge. These samples were processed individually and evaluated for serology as described previously in Example 25. Mice were challenged with UPEC-25 and processed for CFU in the bladder and kidney as described in Examples 25 and 26.
(211) TABLE-US-00017 TABLE 17 Experimental Design. Total Antigen/ Vaccine Rest Mice dose Volume Vaccine Period Challenge Group (N) Vaccine (μg) Adjuvant (μl) # Vax Route (weeks) Strain A 14 PBS N/A N/A 20 4 IN 2 UPEC-25 B 12 Trimer-1 25 CT + squalene 20 4 IN 2 UPEC-25 C 12 Trimer-1 100 CT + squalene 20 4 IN 2 UPEC-25 D 12 Trimer-1 200 CT + squalene 2 × 20 4 IN 2 UPEC-25
Example 30
Challenge Results
(212) Mice received a challenge dose of 2.5×10.sup.6 CFU for both the primary and superinfection. At seven days after infection, vaccinated mice showed reduced colonization in the bladder (
Example 31
Serology Results
(213) Levels of IgG in serum and urine increased in parallel with the immunizing dose of Trimer-1 (
Example 32
Hyper-Immunization of Holstein Steers with Trimer-1 and Preparation of Polyclonal Antibody
(214) Four 4-month-old Holstein Steers identified by ear tags were divided into two equal groups designated as Groups A (Tag numbers-141, 38) and Group B (Tag numbers-143, 50). Steers were vaccinated subcutaneously four times at 21 day intervals using Trimer-1 prepared in two different adjuvants: aluminum hydroxide and ENABL C3 (Vaxliant, Omaha, Nebr.). The vaccine of Group A was prepared using 400 μg per dose of total protein in PBS, formulated with 20 percent REHYDRAGEL HPA (General Chemical; Berkeley Heights; New Jersey) in a final injectable volume of 2 ml. The antigen/aluminum hydroxide suspension was stirred for 24 hours at 4° C. to allow maximum adsorption of the protein to the adjuvant.
(215) The vaccine of Group B was prepared using 400 μg of total protein per dose in PBS, formulated with 20% ENABL C3 (Vaxliant Omaha, Nebr.) in a final injectable volume of 2 ml.
(216) Twenty one days after the fourth vaccination, 2.0 liters of blood from each steer was pooled separately and allowed to clot at 4° C. for 24 hours. The serum was separated from whole blood by centrifugation at 3000×g for 30 minutes. The serum; approximately 800 ml per sample was again centrifuged at 10,000×g for 30 minutes to remove any contaminating cell debris and then aliquoted into 25 ml volumes in sterile 50 ml conical tubes (Fisher Scientific) and frozen at −80° C. until use. Serum titers were evaluated by ELISA as described in Example 12 with Trimer-1 coated on the plate and using a goat anti-bovine IgG HRP-conjugate (Jackson Immunoresearch) as the secondary. Each calf responded immunologically to vaccination generating high titers after the fourth vaccination.
(217)
Example 33
Cross-Reactivity of Antibodies with Membrane Proteins from Klebsiella pneumoniae and Multiple Strains of E. coli
(218) The hyperimmunized serum of Group B produced against the Trimer-1 protein of Example 32 was used to evaluate cross-reactivity with membrane-associated antigens of bacteria from different genera and species. Membrane proteins were derived from Klebsiella pneumoniae of bovine origin, E. coli CFT073 of human origin and an Avian Pathogenic E. coli isolate designated as APEC-280. The outer membrane protein profiles were examined by SDS-PAGE. Briefly, each of the isolates to be examined was inoculated into TSB containing 300 μM 2,2-dipyridyl and incubated at 37° C. Following incubation for 12 hours, the cultures were subcultured (1:100) into 500 ml of the same media and incubated at 37° C. After 8 hours each culture was centrifuged at 10,000×g for 20 minutes, resuspended in 40 ml of osmotic shock buffer (7.3 g/l Tris Base; 1.86 g/l EDTA, pH 8.9), and disrupted by sonication, to yield a suspension. The suspensions were centrifuged at 32,000×g for 12 minutes to clarify or remove large cellular debris. The supernatants were collected and solubilized by the addition of 4% sodium lauroyl sarcosinate at 4° C. for 24 hours. The outer membrane protein-enriched fractions were collected by centrifugation at 32,000×g for 2.5 hours at 4° C. The protein pellets were resuspended in 200 μl Tris-buffer (pH 7.2).
(219) The purified extracts of each isolate were subjected to electrophoresis followed by western blot analysis using the Trimer-1 hyper-immunized serum of group B (as described in Example 32). In brief, the outer membrane preparations were size-fractionated on an SDS-PAGE gel using a 4% stacking gel and 7.5% resolving gel. A 10 μl sample of the outer membrane fraction was combined with 10 μl of SDS reducing sample buffer (62.5 mM Tris-HCL ph 6.8, 20% glycerol, 2% SDS, 5% β-mercaptoethanol) and boiled for 4 minutes. Samples were electrophoresed at 18 mA constant current for 5 hour at 4° C. using a Protein II xi cell and model 1000/500 power supply (BioRad Laboratories, Richmond, Calif.).
(220) Western blot analysis revealed that the Trimer-1 positive antisera reacted against multiple membrane-associated proteins of Klebsiella pneumoniae (lane 3), E. coli APEC-280 (lane 4) and E. coli CFT073 (lane 5) (
Example 34
Efficacy of Trimer-1 as a Therapeutic Agent Against an Existing Infection of Virulent E. coli in a Mouse UTI Model
(221) The therapeutic efficacy of recombinant Trimer-1 was evaluated using a live virulent E. coli challenge with UPEC-25 in mice, with colonization of the bladder and kidney as the endpoint. The outcome parameters used to evaluate vaccine efficacy against UPEC-25 were 1) level of colonization in bladder and kidney at 14 days post-infection, and 2) correlation of antibody titers with survival.
(222) Briefly, 30 female C3H/HeOuJ mice obtained from Jackson Laboratory (Bar Harbor, Me.) at 5-6 weeks of age were equally divided into 2 treatment groups (n=15 mice/group) designated as indicated (Table 18). Mice were vaccinated five times at 1 to 3 day intervals after being challenged with UPEC-25 at Day 0. Mice were housed in polycarbonate cages (Ancore Corporation, Bellmore, N.Y.) at 5 mice per cage with food and water supplied ad libitum. All mice were allowed to acclimate one week prior to the first vaccination.
(223) TABLE-US-00018 TABLE 18 Experimental Design. Total Vaccine Antigen Volume Vaccine Challenge Group Mice Vaccine (μg) Adjuvant (ul) # Vax Route Strain A 15 PBS N/A AlOH + dmLT 100 1 SC UPEC-25 squalene + dmLT 20 4 IN B 15 Trimer-1 100 AlOH + dmLT 100 1 SC UPEC-25 squalene + dmLT 20 4 IN
Example 35
Vaccine Preparation and Vaccination
(224) Vaccines contained Trimer-1 or adjuvant-only placebo. Trimer-1 was used to determine duration of therapeutic immunity (DOI) at 2 weeks post initial infection. Vaccines were prepared by combining 100 μg Trimer-1 in phosphate buffered saline PBS formulated with 2 μg double mutant heat labile toxin (dmLT) per dose in a final volume of either 0.1 ml (for SC prime immunization, including 20 percent [v/v] ALHYDROGEL [Invivogen, San Diego, Calif.]) or 0.02 ml (for IN immunization, including 50 percent [v/v] squalene [Addavax, Invivogen, San Diego, Calif.]) (Table 18). The placebo vaccines were prepared by substituting PBS for the aqueous protein suspension as described in the above procedure. Mice were vaccinated five times in total. The first vaccination was a dual vaccination at day 1 post challenge during which each mouse received one subcutaneous and one intranasal vaccination on the same day. Thereafter, mice received only a single intranasal immunization per day, starting at day 4, and repeating at 1 day intervals for three days in total (i.e., on Day 4, 5 and 6). Blood was collected from both groups on the day before challenge and at 10 days post challenge.
Example 36
Preparation of Challenge Organism
(225) UPEC-25 is a clinical isolate of E. coli obtained from a patient with a urinary tract infection. The frozen stock and challenge culture of UPEC-25 were prepared as described previously in Example 26.
Example 37
Challenge Results
(226) All mice in groups A-B were transurethrally challenged with 0.02 ml containing 1.4×10.sup.6 colony forming units (CFU) of the virulent UPEC-25 isolate as described in Example 25, to evaluate the protective efficacy of the Trimer-1 vaccine. Colonization of the bladder and kidney were evaluated by sacrificing mice at 2 weeks post-infection and enumerating bacteria in the tissue by plating tissue homogenates on selective media.
(227) Trimer-1 showed excellent efficacy and immunogenicity in reducing colonization following transurethral challenge with UPEC-25 isolate at 2 weeks following challenge. The reduction in colonization of both bladder (
Example 38
Serology Results
(228)
Example 39
Synthesis, Cloning, Expression, and Purification of Trimer-3, Trimer-4, and Monomer-1
(229) The DNA coding and polypeptide sequences for Trimer-3 (SEQ ID NO:25 and 26), Trimer-4 (SEQ ID NO:27 and 28), and Monomer-1 (SEQ ID NO:29 and 30) were synthesized and cloned as described in Example 3. Trimer-3 was created by replacing the B cell domains of Trimer-1 with those of Trimer-2, yielding a polypeptide with the B cell domains of Trimer-2 and the T cell domains of Trimer-1. Similarly, Trimer-4 was created by replacing the B cell domains of Trimer-2 with those of Trimer-1. An additional construct, Monomer-1, consisted of module II (SEQ ID NO: 4) with a His tag appended to the N-terminus and GSGS (SEQ ID NO:23) linkers between the B and T cell domains (SEQ ID NO:29 and 30). Recombinant polypeptides Trimer-3, Trimer-4, and Monomer-1 were expressed and purified as described in Example 4.
Example 40
Comparative Immunogenicity of Trimer-1, Trimer-2, Trimer-3, Trimer-4, and Monomer-1
(230) A primary objective of this study w as to determine whether exchanging the B cell domains between Trimer-1 and Trimer-2 would generate polypeptides (Trimer-3 and Trimer-4) capable of inducing an immune response. A second objective was to determine if a single module of the MoLE (Monomer-1) would be immunogenic.
(231) Female CBA/J mice were procured and housed as described in Example 25. Mice were distributed into groups, and a blood sample was taken prior to immunization. The prime immunization consisted of a dose of 100 μg antigen formulated in 20% AlOH plus 2 μg dmLT and administered SC (Table 19). Three weeks later, mice were boosted with a dose of 50 antigen formulated in 50% squalene plus 2 μg dmLT and administered IN. Two weeks after the boost a blood sample was obtained, and the level of serum IgG against the immunizing antigen was determined by ELISA (Example 12).
(232) TABLE-US-00019 TABLE 19 Experimental Design Total Antigen/ Vaccine Mice Immunizing dose Vaccine Volume Group (N) antigen (μg) Adjuvant Route # Vax (μl) B 4 Trimer-1 100 AlOH + dmLT SC 1 100 50 squalene + dmLT IN 1 20 C 3 Trimer-2 100 AlOH + dmLT SC 1 100 50 squalene + dmLT IN 1 20 D 4 Monomer-1 100 AlOH + dmLT SC 1 100 50 squalene + dmLT IN 1 20 E 4 Trimer-3 100 AlOH + dmLT SC 1 100 50 squalene + dmLT IN 1 20 F 4 Trimer-4 100 AlOH + dmLT SC 1 100 50 squalene + dmLT IN 1 20
Example 41
Serology Results
(233) Immunization with Trimer-3 or Trimer-4 induced IgG antibody titers that were equivalent to those produced by Trimer-1 or Trimer-2 (
Example 42
Effect of Adjuvant, Route, and Schedule on Serology, T Cell Responses, and Protection Against UTI
(234) C3H/HeOuJ mice were procured and housed as described in Example 25. Of the 15 mice per group, 3 were terminated 1 day prior to challenge and used for T cell studies, while the remaining 12 were challenged to determine vaccine efficacy. Mice in Groups B, C, and E were immunized with 100 μg Trimer-1 formulated with the adjuvant according to the routes described in Table 20. Immunized mice were evaluated in parallel with naïve mice as a negative control (Group A). Mice in Groups B and C received a total of four vaccinations two weeks apart with a two week rest. Group E was vaccinated twice, four weeks apart, with a four week rest. Blood and urine were collected after the last vaccination, just prior to challenge. Samples were processed individually (Example 23) and evaluated by ELISA as described in Example 12, with several modifications. Serum and urine IgA were measured using an anti-heavy chain IgA-specific HRP conjugate, and the samples were tested at a single dilution (1:100 for serum and 1:10 for urine) and were reported directly as optical density (OD). Mice were challenged with UPEC-25 and processed for CFU in the bladder and kidney at 14 days post-infection using methodology described in Examples 25 and 26.
(235) Mice used for T cell studies were euthanized, and their spleens were removed and processed to lyse red blood cells. Splenic lymphocytes (1×10.sup.6 cells in 0.2 ml RPMI-1640 containing 10% fetal bovine serum) were cultured with 12.5 μg of antigen for 48 hours, and the release of cytokines into cell supernatants was measured according to the manufacturer's protocol (BD Cytometric Bead Array (CBA), BD Biosciences, San Jose, Calif.). For intracellular cytokine staining (ICS), splenocytes were cultured at 2×10.sup.6 cells/well and stimulated with antigen for 6 hours. The antigen consisted of 12.5 μg Trimer-1 for CBA and ICS and also a mixture of the corresponding T cell domains from Trimer-1 for CBA. Transport was blocked by the addition of brefeldin (GolgiPlug) for 2 hours, after which cell fixation/permeabilization and staining was performed according to the manufacturer's protocol (BD Biosciences, San Jose, Calif.). Cells were analyzed by flow cytometry (FACSCanto, BD Biosciences, San Jose, Calif.) with a gating strategy to exclude B220/CD45r+, CD11c+, and CD11b+ cells and determine the percentage of antigen-specific CD3+CD4+CD44+ and CD3+CD8+CD44+ T memory cells producing TNFα and IFNγ. For both CBA and ICS, unstimulated splenocytes served as a negative control, and these values were subtracted to calculate the net response to antigen.
(236) TABLE-US-00020 TABLE 20 Experimental Design Total Antigen/ Vaccine Rest Mice Dose Volume Vaccine Period Challenge Group (N) Vaccine (μg) Adjuvant (μl) # Vax Route (weeks) Strain A 15 None N/A N/A N/A 0 N/A N/A UPEC-25 B 15 Trimer-1 100 Squalene + dmLT 20 4 IN 2 UPEC-25 C 15 Trimer-1 100 AlOH + dmLT 50 1 ID 2 UPEC-25 Squalene + dmLT 20 3 IN E 15 Trimer-1 100 AlOH + dmLT 50 2 ID 4 UPEC-25
Example 43
Challenge Results
(237) Mice received a challenge dose of 1.8×10.sup.6 CFU for both the primary and superinfection. At 14 days after infection, Groups B and C, which were immunized via the IN mucosal route and adjuvanted in squalene+dmLT for both the prime and boost (Group B) or the boost only (Group C), showed superior efficacy in terms of the mitigated and prevented fraction compared with a strictly parenteral ID vaccination adjuvanted in AlOH+dmLT (Group E) (
Example 44
Serology Results
(238) Titers of IgG1 were significantly lower in Group A compared with Group E, but mean IgG2a titers were equivalent, suggesting that class switching occurred in response to vaccination by each of the vaccine regimens used in Groups B, C, and E (
Example 45
Results for Development of Antigen-Responsive T Cells
(239) Induction of antigen-responsive T cells was evaluated as a potential indicator of vaccine efficacy. The release of TNFα, IL-2, IFNγ, and IL-17A showed distinct differences among the three vaccinated groups (
Example 46
Results for Induction of T Memory Cells
(240) Induction of T memory cells is essential for a vaccine to induce durable, long-term adaptive immunity. In mice, CD44 is a cell surface marker for T memory cells and was used to quantify the level of antigen-specific T memory cells that were induced by Trimer-1 within the CD4 and CD8 subsets (
Example 47
The Serological Response to Vaccination of Trimer-1 in Turkeys
(241) This experiment evaluated the serological response to vaccination in turkeys vaccinated with Trimer-1. Briefly, sixty (N=60) day of age Nicholas turkey poults (hens obtained from Select Genetics, Willmar Minn.) were placed in an isolation facility, comingled and grown to four weeks of age. Turkeys were vaccinated two times at 21 day intervals and on day 42 (21 days after second vaccination) blood was taken from all birds to evaluate the antibody response to Trimer-1.
Example 48
Vaccine Preparation of Trimer-1
(242) The vaccine containing the recombinant Trimer-1 protein was prepared with 100 μg and 500 μg per dose of total protein in PBS formulated with 25% REHYDRAGEL HPA; (General Chemical; Berkeley Heights; New Jersey) in a final injectable volume of 0.5 ml. The antigen/aluminum hydroxide suspension was stirred for 24 hours at 4° C. to allow maximum adsorption of the protein to the adjuvant. The placebo vaccine was prepared as described above in PBS minus the antigen in the aqueous suspension of the final formulation. The final vaccine formulation was plated on blood agar to determine sterility of the vaccine prior to use.
(243) TABLE-US-00021 TABLE 21 Experimental design. Total Antigen Vaccine Number of Vaccine Group Turkey Vaccine (μg) Adjuvant Volume Vaccines Route A 20 Placebo N/A AlOH 0.5 ml 2 SC B 20 Trimer-1 100 AlOH 0.5 ml 2 SC C 20 Trimer-1 500 AlOH 0.5 ml 2 SC
Example 49
Vaccination
(244) At 4 weeks of age all birds were tagged with numbered wing bands and randomly allocated into three equal groups (20 birds per group) designated as Groups A through C. Turkeys in Group A were placebo-vaccinated, while birds in Groups B and C received the Trimer-1 vaccines at 100 μg and 500 μg, respectively. All birds were vaccinated subcutaneously in the lower neck region two times at 21 day intervals. Blood was taken from all birds at first vaccination (pre-immune) and again at 21 days after first vaccination. Serum was collected from coagulated blood and stored at −80° C.
Example 50
Serology Results
(245) The serological response to vaccination was analyzed in pooled serum by ELISA with the vaccine antigen (Trimer-1) coated on the plate and calculated as the geometric mean titer.
Example 51
The Serological Response of Vaccination with Trimer-1 in Chickens
(246) This study evaluated the serological response of vaccination of Trimer-1 in chickens. Briefly, twenty (N=20) specific pathogen free Leghorn hens were obtained from Valo BioMedia, (Adel, Iowa) and grown to 7 weeks of age prior to study initiation. The hens were tagged with numbered wing bands, randomly allocated into two equal groups (10 birds per group) designated as Groups A and B and commingled for the duration of the study. Chickens were vaccinated two times at 21 day and on day 42 (21 days after second vaccination) blood was taken from all birds.
Example 52
Vaccine Preparation and Vaccination
(247) The vaccine containing the recombinant Trimer-1 protein was prepared at 200 μg total protein per dose in PBS. The aqueous Trimer-1 suspension was formulated into a water-in-oil emulsion. The composition of the vaccine was: 44.44% antigen suspension in PBS, 50% white mineral oil, 3% Span85 and 2.56% Tween85 to give a dose of 200 μg total protein in an injectable volume of 0.5 ml. The placebo vaccine was prepared by substituting PBS for the aqueous protein suspension of the above described formulation. Chickens in Group A were vaccinated with the placebo vaccine while chickens in Group B received the oil-adjuvanted Trimer-1 vaccine. Birds were vaccinated subcutaneously in the lower neck region two times at 21 day intervals. Blood was taken from all birds at first vaccination (pre-immune), 14 days after first vaccination and again at 21 days post first vaccination or at time of challenge. Serum was collected from coagulated blood and split into two duplicate sample sets and stored at −80° C.
(248) TABLE-US-00022 TABLE 22 Experimental design. Total Antigen Vaccine Number of Vaccine Group Chicken Vaccine (μg) Adjuvant Volume Vaccines Route A 10 Placebo N/A Oil 0.5 ml 2 SC Emulsion B 10 Trimer-1 200 Oil 0.5 ml 2 SC Emulsion
Example 53
Serology Results
(249)
(250) The complete disclosure of all patents, patent applications, and publications, and electronically available material (including, for instance, nucleotide sequence submissions in, e.g., GenBank and RefSeq, and amino acid sequence submissions in, e.g., SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq) cited herein are incorporated by reference in their entirety. Supplementary materials referenced in publications (such as supplementary tables, supplementary figures, supplementary materials and methods, and/or supplementary experimental data) are likewise incorporated by reference in their entirety. In the event that any inconsistency exists between the disclosure of the present application and the disclosure(s) of any document incorporated herein by reference, the disclosure of the present application shall govern. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.
(251) Unless otherwise indicated, all numbers expressing quantities of components, molecular weights, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless otherwise indicated to the contrary, the numerical parameters set forth in the specification and claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the doctrine of equivalents to the scope of the claims, each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques.
(252) Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. All numerical values, however, inherently contain a range necessarily resulting from the standard deviation found in their respective testing measurements.
(253) All headings are for the convenience of the reader and should not be used to limit the meaning of the text that follows the heading, unless so specified.