Nucleic acid molecule and vector inducing endosperm development in seed plant without fertilization, transgenic seed plant capable of developing endosperm without fertilization and method for constructing same
11319545 · 2022-05-03
Assignee
Inventors
- Masaru Takagi (Tsukuba, JP)
- Miho Ikeda (Tsukuba, JP)
- Nobutaka Mitsuda (Tsukuba, JP)
- Yoshimi Oshima (Tsukuba, JP)
Cpc classification
C12N15/8201
CHEMISTRY; METALLURGY
International classification
Abstract
As a means for artificially inducing functional endosperm in a seed plant without fertilization, provided is a nucleic acid molecule that contains a base sequence encoding a polypeptide capable of inducing endosperm development, said nucleic acid molecule being to be transferred into the genome of the seed plant and expressed therein so as to induce endosperm development in the seed plant without fertilization.
Claims
1. A method of producing a transgenic seed plant capable of developing endosperm without fertilization, comprising introducing a nucleic acid molecule comprising a nucleotide sequence encoding a polypeptide having an endosperm development-inducing function into a seed-plant cell, wherein said nucleotide sequence is operably linked to a heterologous seed-specific promoter, wherein the polypeptide comprises an amino acid sequence having at least 95% amino acid sequence identity to the amino acid sequence as set forth in SEQ ID NO:1; expressing the polypeptide in the transgenic seed plant cell; and selecting a transgenic plant comprising said transgenic seed plant cell that develops endosperm without fertilization.
2. The method of claim 1, wherein the nucleotide sequence encoding the polypeptide having the endosperm development-inducing function comprises a nucleotide sequence having at least 90% nucleotide sequence identity to the nucleotide sequence as set forth in SEQ ID NO: 2.
3. The method of claim 1, wherein the nucleic acid molecule further comprises a nucleotide sequence of a terminator region, and the nucleotide sequence encoding the polypeptide having the endosperm development-inducing function is operably linked to the nucleotide sequence of the terminator region.
4. The method of claim 1, wherein said introducing comprises a vector which comprises the nucleic acid molecule.
5. The method of claim 4, wherein the vector is an Agrobacterium vector.
6. The method of claim 4, wherein the vector is a plant virus vector.
7. The method of claim 1, wherein the selection step comprises evaluating the transgenic plant in an unfertilized state for the presence of endosperm.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
DESCRIPTION OF EMBODIMENTS
(18) The present invention will now be described in detail with reference to specific embodiments. However, the present invention is not limited to the following embodiments and can be implemented in any form without departing from the spirit of the present invention.
(19) The patent publications, published unexamined patent applications, and non-patent literatures cited in this specification are incorporated herein by reference in their entirety for all purposes.
(20) [1. Nucleic Acid Molecule and Vector for Inducing Endosperm Development in Seed Plant]
(21) (1-1. Overview)
(22) One aspect of the present invention provides a nucleic acid molecule for inducing endosperm development in a seed plant without fertilization by being introduced into and expressed in a genome of the seed plant (hereinafter, referred to as “the inventive nucleic acid molecule” as appropriate).
(23) The inventive nucleic acid molecule contains a base sequence encoding a polypeptide having an endosperm development-inducing function (hereinafter, referred to as “an endosperm development-inducing polypeptide” as appropriate). The inventive nucleic acid molecule may optionally contain a base sequence encoding a polypeptide having a transcriptional regulatory function (hereinafter, referred to as “a transcriptional regulatory polypeptide” as appropriate). Furthermore, the inventive nucleic acid molecule may optionally contain a promoter region, a terminator region, and any other sequence.
(24) Another aspect of the present invention also provides a vector carrying the inventive nucleic acid molecule (hereinafter, referred to as “the inventive vector” as appropriate).
(25) (1-2. Base sequence encoding endosperm development-inducing polypeptide)
(26) The inventive nucleic acid molecule has a base sequence encoding a polypeptide having an endosperm development-inducing function (or an endosperm development-inducing polypeptide).
(27) In the present invention, the endosperm development-inducing polypeptide preferably has a non-limiting amino acid sequence selected from or similar to the following amino acid sequences: Amino acid sequence of polypeptide At5g07260 in Arabidopsis thaliana (SEQ ID NO: 1) Amino acid sequence of polypeptide At5g26660 in Arabidopsis thaliana (SEQ ID NO: 3) Amino acid sequence of polypeptide At5g01200 in Arabidopsis thaliana (SEQ ID NO: 5) Amino acid sequence of polypeptide At2g38090 in Arabidopsis thaliana (SEQ ID NO: 7) Amino acid sequence of polypeptide At5g58900 in Arabidopsis thaliana (SEQ ID NO: 9) Amino acid sequence of polypeptide At3g16350 in Arabidopsis thaliana (SEQ ID NO: 11) Amino acid sequence of polypeptide Os05g0543600 in Oryza sativa (SEQ ID NO: 13) Amino acid sequence of polypeptide Os01g0142500 in Oryza sativa (SEQ ID NO: 15) Amino acid sequence of polypeptide Os01g0853700 in Oryza sativa (SEQ ID NO: 17) Amino acid sequence of polypeptide Os04g0569100 in Oryza sativa (SEQ ID NO: 19)
(28) As will be understood from Examples described later, the polypeptides At5g07260, At5g26660, At5g01200, At2g38090, At5g58900 and At3g16350 in Arabidopsis thaliana and the polypeptides Os05g0543600, Os01g0142500, 0501g0853700 and Os04g0569100 in Oryza sativa each have an endosperm development-inducing function when expressed in the plant cells. Accordingly, all the polypeptides can be preferably used as the endosperm development-inducing polypeptides in the present invention.
(29) A polypeptide having an amino acid sequence similar to each of these polypeptides most certainly have very similar effects due to the structural similarity when expressed in the plant cells, and can preferably be used as the endosperm development-inducing polypeptide in the present invention.
(30) Specifically, the amino acid sequence of the endosperm development-inducing polypeptide in the present invention desirably has a sequence homology of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, particularly preferably at least 99% with an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17 and 19 as described above.
(31) Furthermore, the amino acid sequence of the endosperm development-inducing polypeptide desirably has a sequence identity of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, particularly preferably at least 99% with an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17 and 19 as described above.
(32) The term “homology” between two amino acid sequences indicates the appearance rate of identical or similar amino acid residues at the respective positions when the two amino acid sequences are aligned, and the term “identity” between the two amino acid sequences indicates the appearance rate of identical amino acid residues at the respective positions when the two amino acid sequences are aligned.
(33) In addition, “homology” and “identity” between two amino acid sequences can be determined by, for example, the Basic Local Alignment Search Tool (BLAST) program (Altschul et al., J. Mol. Biol., (1990), 215(3): 403-10).
(34) The amino acid sequence alignment of the polypeptide At5g26660 in Arabidopsis thaliana and the polypeptide Os05g0543600 in Oryza sativa (SEQ ID NOs: 3 and 13, respectively) are each shown in
(35) In particular, it is found that the amino acid sequences of the polypeptide At5g26660 in Arabidopsis thaliana and the polypeptide Os05g0543600 in Oryza sativa (SEQ ID NOs: 3 and 13, respectively) share a motif having the amino acid sequence represented by Formula (Ia), and the amino acid sequences of the polypeptides At5g01200, At2g38090 and At5g58900 in Arabidopsis thaliana and the polypeptides Os01g0142500 and Os01g0853700 in Oryza sativa (SEQ ID NOs:5, 7, 9, 15 and 17, respectively) share a motif having the amino acid sequence represented by Formula (Ib):
(36) TABLE-US-00003 (Ia) [F/V][K/Q][A/Q]KLRKGLWSPEED[E/D]KL[L/Y]N[H/Y] I[I/T]RHG[H/V]GCWSSVPKLAGLQRCGKSCRLRWINYLRPDL KRG[A/S]FSQ[D/Q]EE[D/S]LI[I/V][A/E]LH[A/E] [A/I]LGNRWSQIA[S/T][H/R]LPGRTDNEIKNFWNSCLKKKL R[Q/R][K/R]G[I/L]DP[A/T]THKP[I/L] (Ib) ERKKGVPWTE[E/D]EH[R/K/L][Q/L/R/S]FL[M/L]GLKK YG[K/R]GDWRNI[A/S][R/K][N/S/Y]FV[T/I/Q][T/S] RTPTQVASHAQKYF[I/L]R[Q/L][V/L/N][N/S/T][G/D] GKDKRR[S/A]SIHDITTVN[I/L]
(37) In Formulae (Ia) and (Ib), each amino acid residue is represented by a one-letter code. In addition, positions where two or more amino acid residues are displayed separating by slashes (/) in square brackets ([ ]) indicate that one of these amino acid residues is present.
(38) Accordingly, the polypeptides having the motifs represented by Formulae (Ia) and (Ib) most certainly induce endosperm development when expressed in plant cells. Thus, the polypeptides having the motifs represented by Formulae (Ia) and (Ib) can also be preferably used as the endosperm development-inducing polypeptide in the present invention.
(39) The base sequence encoding such an endosperm development-inducing polypeptide preferably has a non-limiting base sequence selected from or similar to the following base sequences: Base sequence of gene At5g07260 in Arabidopsis thaliana (SEQ ID NO: 2) Base sequence of gene At5g26660 in Arabidopsis thaliana (SEQ ID NO: 4) Base sequence of gene At5g01200 in Arabidopsis thaliana (SEQ ID NO: 6) Base sequence of gene At2g38090 in Arabidopsis thaliana (SEQ ID NO: 8) Base sequence of gene At5g58900 in Arabidopsis thaliana (SEQ ID NO: 10) Base sequence of gene At3g16350 in Arabidopsis thaliana (SEQ ID NO: 12) Base sequence of gene Os05g0543600 in Oryza sativa (SEQ ID NO: 14) Base sequence of gene Os01g0142500 in Oryza sativa (SEQ ID NO: 16) Base sequence of gene Os01g0853700 in Oryza sativa (SEQ ID NO: 18) Base sequence of gene Os04g0569100 in Oryza sativa (SEQ ID NO: 20)
(40) Specifically, the base sequence encoding the endosperm development-inducing polypeptide in the present invention has a sequence identity of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, particularly preferably at least 99% with a base sequence selected from the group consisting of SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18 and 20 as described above.
(41) The sequence identity between two base sequences can be determined using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol. 48: 443-453) by, for example, the Needle program of the EMBOSS package, preferably version 5.00 or higher (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., 2000, Trends Genet. 16: 276-277).
(42) (1-3. Base Sequence Encoding Transcriptional Regulatory Polypeptide)
(43) The inventive nucleic acid molecule preferably has a base sequence encoding a polypeptide having a transcriptional regulatory function (i.e., a transcriptional regulatory polypeptide) in addition to the base sequence encoding the endosperm development-inducing polypeptide described above. In this case, it is preferred that the base sequence encoding the endosperm development-inducing polypeptide and the base sequence encoding the transcriptional regulatory polypeptide be linked in-frame.
(44) In the present invention, the transcriptional regulatory polypeptide preferably has a non-limiting amino acid sequence selected from or similar to the following amino acid sequences: Amino acid sequence of SRDX polypeptide produced by modification of the transcriptional regulatory region of gene SUPERMAN in Arabidopsis thaliana (SEQ ID NO: 21) Amino acid sequence of the transcriptional regulatory region BRD polypeptide of gene At2g36080 in Arabidopsis thaliana (SEQ ID NO: 23) Amino acid sequence of the transcriptional regulatory region WUS-box polypeptide of gene WUSCHEL in Arabidopsis thaliana (SEQ ID NO: 25) Amino acid sequence of the transcriptional regulatory region L2R polypeptide of gene AtMYBL2 in Arabidopsis thaliana (SEQ ID NO: 27)
(45) The SRDX, BRD, WUS-box, and L2R polypeptides described above are expression products of transcriptional regulatory domains used in the Chimeric repressor silencing technology (CRES-T) developed by the present inventors. Specifically, the SRDX polypeptide, the BRD polypeptide, the WUS-box polypeptide, and the L2R polypeptide are described in detail in, for example, WO2003/055993A, JP2009-213426 A, Ikeda et al., Plant Cell, (2009), 21:3493-3505, and Matsui et al., Plant J., (2008), 55:954-967, respectively.
(46) When the base sequences encoding these SRDX, BRD, WUS-box, and L2R polypeptides are linked in-frame with the endosperm development-inducing polypeptide described above and then introduced to be expressed into plant cells, the induction of endosperm development can be enhanced in the endosperm development-inducing polypeptide. Accordingly, all these polypeptides can be suitably used as the transcriptional regulatory polypeptide in the present invention.
(47) In addition, a polypeptide having an amino acid sequence similar to each of these polypeptides most certainly has identical effects due to the structural similarity when expressed in plant cells, and thus can be suitably used as the transcriptional regulatory polypeptide in the present invention.
(48) Specifically, the amino acid sequence of the transcriptional regulatory polypeptide in the present invention desirably has a sequence homology of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, particularly preferably at least 99% with an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 23, 25 and 27 as described above.
(49) The amino acid sequence of the transcriptional regulatory polypeptide desirably has a sequence identity of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, particularly preferably at least 99% with an amino acid sequence selected from the group consisting of SEQ ID NOs: 21, 23, 25 and 27 described above.
(50) It is known that the SRDX, BRD, WUS-box, and L2R polypeptides each have a motif having an amino acid sequence represented by Formula (IIa), (IIb), (IIc), or (IId) and that these motifs each play an important role in the transcriptional regulatory function. Accordingly, a polypeptide containing a motif having an amino acid sequence represented by Formula (IIa), (IIb), (IIc), or (IId) can also be suitably used as a transcriptional regulatory polypeptide:
(51) TABLE-US-00004 (IIa) [L/F]DLN[L/F][X]P (IIb) [L/V][R/K]LFGVX[M/V/L] (IIc) TLXLFP (IId) TLXLFR
(52) In Formulae (IIa) to (IId), each amino acid residue is represented by a one-letter code. In addition, positions where two or more amino acid residues are displayed separating by slashes (/) in square brackets ([ ]) indicate that one of these amino acid residues is present. X represents any amino acid residue.
(53) The base sequence encoding such a transcriptional regulatory polypeptide preferably has a non-limiting base sequence selected from or similar to the following base sequences: Base sequence of SRDX produced by modification of the transcriptional regulatory region of gene SUPERMAN (SEQ ID NO: 22) Base sequence of the transcriptional regulatory region BRD of gene At2g36080 (SEQ ID NO: 24) Base sequence of the transcriptional regulatory region WUS-box of gene WUSCHEL (SEQ ID NO: 26) Base sequence of the transcriptional regulatory region L2R of gene AtMYBL2 (SEQ ID NO: 28)
(54) Specifically, the base sequence encoding the transcriptional regulatory polypeptide in the present invention desirably has a sequence identity of at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, particularly preferably at least 99% with an amino acid sequence selected from the group consisting of SEQ ID NOs: 22, 24, 26 and 28 as described above.
(55) (1-4. Promoter Region)
(56) The inventive nucleic acid molecule preferably has a promoter region. It is preferred that the promoter region be usually located at the 5′ side of the base sequence encoding the endosperm development-inducing polypeptide so as to be functionally linked to the endosperm development-inducing polypeptide.
(57) The promoter region may be a promoter derived from a virus, from a microorganism, from a plant, or from any other organism.
(58) With the functional site, the promoter may be a promoter that functions in the entire plant or only in the peripheral sites including a female gametophyte and its progenitor cells. It may further be a promoter that specifically functions during treatment with specific chemicals or under a specific growth environment.
(59) The promoter region may have any base sequence. For example, the promoter regions have any base sequence among the following promoters: 35S promoter of Cauliflower mosaic virus (CaMV) (SEQ ID NO: 29) Promoter of gene At5g07260 in Arabidopsis thaliana (SEQ ID NO: 30) Promoter of gene At5g26660 in Arabidopsis thaliana (SEQ ID NO: 31) Promoter of gene At5g01200 in Arabidopsis thaliana (SEQ ID NO: 32) Promoter of gene At2g38090 in Arabidopsis thaliana (SEQ ID NO: 33) Promoter of gene At5g58900 in Arabidopsis thaliana (SEQ ID NO: 34) Promoter of gene At3g16350 in Arabidopsis thaliana (SEQ ID NO: 35) Promoter of actin gene in Oryza sativa (SEQ ID NO: 36) Promoter of ubiquitin 1 gene in Zea mays (SEQ ID NO: 37) Promoter of gene Os05g0543600 in Oryza sativa (SEQ ID NO: 38) Promoter of gene Os01g0142500 in Oryza sativa (SEQ ID NO: 39) Promoter of FST gene in Oryza sativa (SEQ ID NO: 40) Promoter of gene Os01g0853700 in Oryza sativa (SEQ ID NO: 41) Promoter of gene Os04g0569100 in Oryza sativa (SEQ ID NO: 42)
(60) A promoter composed of a base sequence having an identity of at least 80%, preferably at least 85%, or at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, particularly preferably at least 99% with each base sequence of SEQ ID NOs: 29 to 42 can also be preferably used as the promoter region in the inventive nucleic acid molecule.
(61) (1-5. Terminator Region)
(62) The inventive nucleic acid molecule preferably has a terminator region. It is preferred that the terminator region be usually located at the 3′ side of the base sequence encoding the endosperm development-inducing polypeptide so as to be functionally linked to the endosperm development-inducing polypeptide.
(63) The terminator region may be a terminator derived from a virus, from a plant, or from any other organism.
(64) With the functional site, the terminator may be a terminator that functions in the entire plant, or a terminator that functions only in the peripheral parts including a female gametophyte and its progenitor cell. It may further be a terminator that specifically functions during treatment with specific chemicals or under a specific growth environment.
(65) The terminator region may have any base sequence. For example, the terminator regions have any base sequence of the following terminators: Terminator of the nopaline synthase gene in Agrobacterium (SEQ ID NO: 43) Terminator of the heat shock protein gene in Arabidopsis thaliana (SEQ ID NO: 44)
(66) A terminator composed of a base sequence having an identity of at least 80%, preferably at least 85%, or at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, particularly preferably at least 99% with each base sequence of SEQ ID NO: 43 or 44 can also be preferably used as a terminator region in the inventive nucleic acid molecule.
(67) (1-6. Other Genetic Elements)
(68) The inventive nucleic acid molecule may have one or more other genetic element. Examples of the other genetic elements include antibiotic resistance genes, restriction enzyme sequences, and homologous recombinant sequences.
(69) (1-7. Structure of Nucleic Acid)
(70) The inventive nucleic acid molecule has a base sequence encoding the endosperm development-inducing polypeptide described above, and preferably has an optional base sequence encoding a transcriptional regulatory polypeptide, an optional promoter region, an optional terminator region and/or any other genetic element. In particular, if the inventive nucleic acid molecule has optional elements other than the base sequence encoding the endosperm development-inducing polypeptide, the base sequence encoding the transcriptional regulatory polypeptide is usually linked in-frame with the base sequence encoding the endosperm-inducing polypeptide. At the same time, the promoter region is located at the 5′ side of the base sequence encoding the endosperm development-inducing polypeptide while the transcriptional regulatory region and/or the terminator region is located at the 3′ side of the base sequence encoding the endosperm development-inducing polypeptide, where these regions are each functionally linked to the base sequence encoding the endosperm development-inducing polypeptide. After the inventive nucleic acid molecule is introduced into plant cells of seed plants, preferably incorporated into genomes, these genetic elements are in functional cooperation with each other and the endosperm development-inducing polypeptide is autonomously expressed. In other words, the inventive nucleic acid molecule preferably functions as a chimeric gene cassette.
(71) (1-8. Vector)
(72) The inventive nucleic acid molecule is usually carried in the vector to be introduced into plant cells and incorporated into genomes.
(73) Such a vector (the inventive vector) may have any form, i.e., a linear or circular form. Particularly preferred is a circular form, such as a plasmid form. Specific examples of the vectors include plant virus vectors and Agrobacterium vectors.
(74) A method using the plant virus vector comprises in-vitro transcription of cDNA in a plant virus genome into which a target gene is inserted; inoculation of the resulting RNA as a vector into a plant to be infected therewith; and expression of the target gene in the plant by the proliferative capacity and systemic transfer ability of the virus itself. Examples of plant virus vectors include cauliflower mosaic virus (CaMV) vectors, cucumber mosaic virus (CMV) vectors, tobacco mosaic virus (TMV) vectors, and potato X virus (PVX) vectors.
(75) A method using the Agrobacterium vector (T-DNA vector) is based on a technique using a transfer DNA (T-DNA) sequence of a Ti plasmid of Agrobacterium. The T-DNA sequence has a right border sequence (RB sequence) and a left border sequence (LB sequence) at two ends and incorporates genes in the region between these sequences into plant genomes. A T-DNA binary system in a combination of two plasmids, that is, a binary plasmid and a helper plasmid, through modification of Ti plasmid has already been established, and extensively used in introduction of foreign genes by genetic transformation of plants.
(76) The inventive nucleic acid molecule is preferably carried on the vector such that the base sequence encoding the inventive endosperm development-inducing polypeptide is incorporated into plant genomes and functionally expressed.
(77) In the case that the inventive nucleic acid molecule has a promoter region and a terminator region in addition to the base sequence encoding the endosperm development-inducing polypeptide and functions as a chimeric gene cassette that can be autonomously expressed in plant cells, the vector does not necessarily have regulatory elements, such as promoters and terminators, and needs to have only the elements necessary for incorporation into plant genomes (e.g., flanking sequences for homologous recombination, or LB sequence and RB sequence of T-DNA).
(78) In contrast, in the case that the inventive nucleic acid molecule has no promoter region and no terminator region and functions as a chimeric gene cassette that can be autonomously expressed in plant cells, the vector preferably has not only the elements necessary for the incorporation into plant genomes but also regulatory elements, such as promoters and terminators, so as to induce the expression of the endosperm development-inducing polypeptide contained in the inventive nucleic acid molecule. Alternatively, when the inventive vector may be incorporated into plant genomes, the base sequence encoding the endosperm development-inducing polypeptide contained in the inventive nucleic acid molecule is functionally linked and cooperated with regulatory elements, such as promoters and terminators, in plant genomes such that the endosperm-inducing polypeptide is expressed.
(79) The inventive vector may be used in combination with any other helper plasmid as needed. Examples of the other helper plasmid include helper plasmids having a vir region for a T-DNA vector.
(80) The inventive vector can be readily produced by appropriate combination of various gene recombination techniques well known to those skilled in the art.
(81) [2. Transgenic Seed Plant Capable of Developing Endosperm without Fertilization and Method of Producing Transgenic Seed Plant]
(82) Another aspect in the present invention provides a method of producing a transgenic seed plant that can develop an endosperm without fertilization (hereinafter, referred to as “the inventive method”).
(83) The inventive method comprises introducing to express the inventive nucleic acid molecule or the inventive vector described above into the genome of a seed plant. Two or more inventive nucleic acid molecules or inventive vectors may be used in combination.
(84) The target seed plants are, not limited to, usually angiosperms. Non-limiting examples of the angiosperms include plant species belonging to, for example, Solanaceae, Fabaceae, Brassicaceae, Gramineae, Asteraceae, Nelumbonaceae, Rosaceae, Cucurbitaceae, and Liliaceae. Specific examples include tobacco, Arabidopsis thaliana, alfalfa, barley, kidney bean, canola, cowpea, cotton, corn, clover, lotus, lentil, Lupinus, millet, oats, pea, peanut, rice, rye, sweet clover, sunflower, sweet pea, soybean, sorghum, triticale, jicama, velvet bean, broad bean, wheat, wisteria, nut plants, redtop, leek, snapdragon, celery, groundnut, asparagus, Scopolia japonica, Avena fatua, hedge bamboo, oilseed rape, bromegrass, bush violet, camellia, hemp, red pepper, chickpea, chenopodium, witloof, citrus, coffee tree, job's tears, cucumber, pumpkin, Bermuda grass, duckweed, datura, urimibae, digitalis, Japanese yam, oil palm, oleander, fescue, strawberry, geranium, day-lily, para rubber tree, henbane, sweet potato, lettuce, Lens esculenta, lily, linseed, ryegrass, tomato, origanum, apple, mango, cassava, Medicago polymorpha, African linaria, sainfoin, geranium, Chinese fountain grass, petunia, garden pea, green bean, timothy, bluegrass, cherry tree, buttercup, radish, currant, castor oil plant, raspberry, sugar cane, salpiglossis, Senecio, Setaria, white mustard, eggplant, sorghum, Stenotaphrum secundatum, cacao, Trifolium, blue melilot, wheat, and grape. Among these plants are preferred Arabidopsis thaliana, rice, corn, wheat and barley, and fruits.
(85) The inventive nucleic acid molecule or the inventive vector described above may be introduced into the genomes of seed plants by any method. For example, the inventive vector may be biologically transmitted to seed plants or introduced into tissues of seed plants by, for example, an agroinfiltration process, a PEG-calcium phosphate process, an electroporation process, a liposome process, a particle gun process, and a microinjection process, to be incorporated into the genomes of seed plants. Alternatively, the inventive nucleic acid molecule may be directly incorporated into the genomes of plants by a known process, such as a CRISPR/Cas9 system, without use of the inventive vector. In an alternative process, the inventive nucleic acid molecule or the inventive vector is introduced into a tissue fragment of a seed plant to cultivate the tissue fragment into a plant that is a re-differentiated individual having a genome into which the inventive vector is introduced and constantly expressing the inventive nucleic acid molecule.
(86) The inventive method described above can incorporate the inventive nucleic acid molecule containing the base sequence encoding the endosperm development-inducing polypeptide into the genomes to yield a transgenic plant expressing the endosperm development-inducing polypeptide. Such a transgenic plant can develop an endosperm without fertilization by expression of the endosperm-inducing polypeptide. It is noted that the resultant endosperm is a functional endosperm that can nurture an embryo different from a non-functional endosperm that develops in a conventional unfertilized plant.
(87) The subject plants of the present invention include transgenic seed plants produced by the inventive method described above, transgenic seed plants containing the inventive nucleic acid molecules or the inventive vectors in their genomes, transgenic seed plants capable of developing functional endosperms without fertilization, and progenies or fragments of those plants. The term “progeny of plant” refers to a progeny produced by sexual or asexual reproduction of the plant and includes a clone of the plant. For example, the progeny of the plant can be produced from proliferation materials (e.g., seeds, fruits, ears, tubers, root tubers, stumps, calluses, and protoplasts) of the plant or its progeny. In the present invention, the term “plant or progeny, or part thereof” indicates a seed (including germinated seed or immature seed), an organ or part thereof (including leaf, root, stem, flower, stamen, pistil, and fragment thereof), plant cultured cells, callus, and protoplast in the plant or its progeny plant.
EXAMPLES
(88) The present invention will now be described in more detail with reference to Examples. It should be noted that the present invention is not limited to the following Examples and can be implemented in any form without departing from the spirit of the present invention. In primer base sequences described below where capital and small letters are mixed, the capital letters indicate regions complementary to the base sequence in the target genes for amplification whereas small letters indicate additional sequences.
(89) [Overview]
(90) In Example 1, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene At5g07260, and the product was linked with the promoter cauliflower mosaic virus (CAMV) 35S such that the linked gene fragment operated downstream of the promoter CAMV 35S to produce a transforming plasmid (Construct A) having the chimeric gene ProCaMV 35S:At5g07260SRDX (Chimeric gene A). Construct A was then introduced into an Arabidopsis thaliana plant, and the effect of Construct A on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant and the analysis of the ability to nurture the fertilized embryo.
(91) In Example 2, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene At5g26660, and the product was linked with the promoter CAMV 35S such that the linked gene fragment operated at the promoter CAMV 35S to produce a transforming plasmid (Construct B) having the chimeric gene ProCaMV 35S:At5g26660SRDX (Chimeric gene B). Construct B was then introduced into an Arabidopsis thaliana plant, and the effect of Construct B on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant.
(92) In Example 3, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene At5g01200, and the product was linked with the promoter CAMV 35S such that the linked gene fragment operated downstream of the promoter CAMV 35S to produce a transforming plasmid (Construct C) having the chimeric gene ProCaMV 35S:At5g01200SRDX (Chimeric gene C). Construct C was then introduced into an Arabidopsis thaliana plant, and the effect of Construct C on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant and the analysis of the ability to nurture the fertilized embryo.
(93) In Example 4, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene At2g38090, and the product was linked with the promoter CAMV 35S such that the linked gene fragment operated downstream of the promoter CAMV 35S to produce a transforming plasmid (Construct D) having the chimeric gene ProCaMV 35S:At2g38090SRDX (Chimeric gene D). Construct D was then introduced into an Arabidopsis thaliana plant, and the effect of Construct D on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant.
(94) In Example 5, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to gene At5g58900, and the product was linked with the CAMV 35S promoter such that the linked gene fragment operated downstream of the promoter CAMV 35S to produce a transforming plasmid (Construct E) having the chimeric gene ProCaMV 35S:At5g58900SRDX (Chimeric gene E). Construct E was then introduced into an Arabidopsis thaliana plant, and the effect of Construct E on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant.
(95) In Example 6, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene At3g16350, and the product was linked with the promoter CAMV 35S such that the linked gene fragment operated downstream of the promoter CAMV 35S to produce a transforming plasmid (Construct F) having the chimeric gene ProCaMV 35S: At3g16350SRDX (Chimeric gene F). Construct F was then introduced into an Arabidopsis thaliana plant, and the effect of Construct F on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant and the analysis of the ability to nurture the fertilized embryo.
(96) In Example 7, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene At5g01200, and the product was linked with the promoter At5g01200 such that the linked gene fragment operated downstream of the promoter At5g01200 to produce a transforming plasmid (Construct G) having the chimeric gene ProAt5g01200: At5g01200SRDX (Chimeric gene G). Construct G was then introduced into an Arabidopsis thaliana plant, and the effect of Construct F on the promotion of spontaneous endosperm development in Arabidopsis thaliana was determined by the morphological observation of the resultant transformed plant and the analysis of the ability to nurture the fertilized embryo.
(97) In Example 8, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene Os05g0543600, and the product was linked with the promoter Zea mays UBQ1 such that the linked gene fragment operated downstream of the promoter Zea mays UBQ1 to produce a transforming plasmid (Construct H) having the chimeric gene ProZmUBQ1:Os05g0543600SRDX (Chimeric gene H). Construct H was then introduced into an Oryza sativa callus, and the effect of Construct H on the promotion of spontaneous endosperm development in Oryza sativa was determined by the morphological observation of the resultant transformed plant.
(98) In Example 9, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene Os01g0142500, and the product was linked with the promoter Zea mays UBQ1 such that the linked gene fragment operated downstream of the promoter Zea mays UBQ1 to produce a transforming plasmid (Construct I) having the chimeric gene ProZmUBQ1: Os01g0142500SRDX (Chimeric gene I). Construct I was then introduced into an Oryza sativa callus, and the effect of Construct I on the promotion of spontaneous endosperm development in Oryza sativa was determined by the morphological observation of the resultant transformed plant.
(99) In Example 10, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene Os01g0853700, and the product was linked with the promoter Oryza sativa FST such that the linked gene fragment operated downstream of the promoter Oryza sativa FST to produce a transforming plasmid (Construct J) having the chimeric gene ProOsFST:Os01g0853700SRDX (Chimeric gene J). Construct J was then introduced into an Oryza sativa callus, and the effect of Construct J on the promotion of spontaneous endosperm development in Oryza sativa was determined by the morphological observation of the resultant transformed plant.
(100) In Example 11, a gene fragment encoding SRDX, which was a transcriptional regulatory domain, was directly linked to the gene Os04g0569100, and the product was linked with the promoter Oryza sativa FST such that the linked gene fragment operated downstream of the promoter Oryza sativa FST to produce a transforming plasmid (Construct K) having the chimeric gene ProOsFST:Os04g0569100SRDX (Chimeric gene K). Construct K was then introduced into an Oryza sativa callus, and the effect of Construct K on the promotion of spontaneous endosperm development in Oryza sativa was determined by the morphological observation of the resultant transformed plant.
[Example 1] Production of Construct A (ProCaMV 35S:At5g07260SRDX) for Transformation and Arabidopsis thaliana Plant Transformation
(101) (1-1) Production of Construct A
(102) (a) Construction of Plasmid pBIG2
(103) The transforming vector pBIG-HYG (Becker, Nucleic Acid Research, (1990), 18(1):203) transferred from Michigan State University, USA, was cleaved with restriction enzymes HindIII and SstI, and the cleaved product was subjected to agarose gel electrophoretic separation to recover a pBIG-HYG DNA fragment not including GUS genes.
(104) Similarly, the plasmid p35S-GFP (Clontech Laboratories Inc., USA) was cleaved with restriction enzymes HindIII and BamHI, and the cleaved fragments were subjected to agarose gel electrophoretic separation to recover a DNA fragment containing a CAMV 35S promoter (hereinafter, referred to as “ProCaMV 35S” as appropriate).
(105) DNAs having the base sequences of SEQ ID NOs: 45 and 46 described below were synthesized by a conventional process, were heated at 70° C. for ten minutes, and then were annealed by natural cooling to yield a double-stranded DNA. This DNA fragment has a sequence where the restriction enzyme site BamHI and the restriction enzyme sites SmaI and SalI are linked to the 5′ end and the 3′ end, respectively, of the omega sequence derived from a tobacco mosaic virus (TMV) that enhances the translation efficiency. The use of this sequence can increase the expression efficiency of the gene present at the 3′ side and introduce restriction enzyme sites essential for subsequent construction of plasmid.
(106) TABLE-US-00005 (SEQ ID NO: 45) 5′-GATCCACAATTACCAACAACAACAAACAA CAAACAACATTACAATTACAGATCCCGGGGGT ACCGTCGACGAGCT-3′ (SEQ ID NO: 46) 5′-CGTCGACGGTACCCCCGGGATCTGTAATT GTAATGTTGTTTGTTGTTTGTTGTTGTTGGTA ATTGTG-3′
(107) The DNA fragment containing the ProCaMV 35S and the double-stranded DNA as synthesized above were inserted into the HindIII and SstI sites, respectively, of pBIG-HYG not including the GUS genes to produce a vector carrying ProCaMV 35S for transformation of plants. This vector is referred to as “plasmid pBIG2”.
(108) (b) Construction of Plasmid p35SRDX
(109) Two complementary DNA fragments having the base sequences of SEQ ID NOs: 47 and 48 as described below were produced where GGG and a stop codon were attached to the 5′ end and the 3′ end, restrictively, of the base sequence of SRDX, which was the transcriptional regulatory domain of the gene SUPERMAN in Arabidopsis thaliana.
(110) TABLE-US-00006 (SEQ ID NO: 47) 5′-GGGCTCGATCTGGATCTAGAACTCCGTTTGGGTTTCGCTTAAG-3′ (SEQ ID NO: 48) 5′-CTTAAGCGAAACCCAAACGGAGTTCTAGATCCAGATCGAGCCC-3′
(111) These synthesized DNA fragments were annealed and inserted into the plasmid pBIG2, which was produced by cleavage with the restriction enzyme SmaI. The products were sequenced to screen a plasmid containing the SRDX introduced in the forward direction. This plasmid is referred to as “plasmid p35SRDX”.
(112) (c) Production of Plasmid 35S:At5g07260SRDX (Construct A)
(113) The cDNA of the gene At5g07260 in Arabidopsis thaliana as a template was subjected to the polymerase chain reaction (PCR) with a 5′ end upper primer having the base sequence of SEQ ID NO: 49 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 50 described below to amplify a partial sequence where the stop codon was removed from the full-length sequence of the gene At5g07260.
(114) TABLE-US-00007 (SEQ ID NO: 49) 5′-gATGTATCATCATCTTCAAACGAGGATTTT-3′ (SEQ ID NO: 50) 5′-ACGGTGGACTGGAAGAGCATTTTGGACATT-3′
(115) The PCR was repeated 30 cycles, each cycle including a denaturing reaction at 94° C. for one minute, an annealing reaction at 50° C. for one minute, and an extending reaction at 72° C. for three minutes.
(116) The resultant amplification product without the stop codon of the gene At5g07260 was cleaved with SmaI, recovered by agarose gel electrophoresis, and inserted into the plasmid p35SRDX described above by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene At5g07260 in a reading frame of SRDX from the plasmids containing the gene At5g07260 introduced in the forward direction.
(117) The resultant plasmid for transformation carries the chimeric gene ProCaMV 35S:At5g07260SRDX where the promoter ProCaMV 35S, the gene At5g07260, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct A” as appropriate, and the chimeric gene ProCaMV 35S:At5g07260SRDX carried on Construct A is abbreviated as “Chimeric gene A” as appropriate. The schematic structure of Chimeric gene A is shown in
(118) (1-2) Development of Transformed Plant A
(119) The Arabidopsis thaliana plants were transformed with Construct A by the method described in “Transformation of Arabidopsis thaliana by vacuum infiltration” (website bch.msu.edu/pamgreen/protocol). In this case, simple soaking without vacuum was used for transmission. Construct A was introduced into a soil bacterium (Agrobacterium tumefaciens) strain GV3101 (C58C1Rifr) pMP90 (Gmr) (koncz and Schell, Molecular and General Genetics, (1986), 204[3]:383-396) by electroporation. The bacteria were cultivated in 250 mL of LB medium for two days.
(120) The bacterial cells were then collected from the culture solution and suspended in an infiltration medium (500 mL). Arabidopsis thaliana that had grown for 14 days was immersed in the solution for one minute, and then allowed to be regrown for seeding. The collected seeds were sterilized with 50% bleach and 0.02% Triton X-100 solution for seven minutes and then rinsed three times with sterile water, and the sterilized seeds were plated onto ½MS selective medium containing 30 mg/l hygromycin. Plants successfully transformed with Construct A acquired hygromycin resistance. The transgenic plants that grew in the hygromycin medium described above were screened and replanted to grow in a soil. The plant transformed with Construct A is abbreviated as “Transformed plant A” as appropriate.
[Example 2] Production of Construct B (ProCaMV 35S:At5g26660SRDX) for Transformation and Arabidopsis thaliana Plant Transformation
(121) (2-1) Production of Construct B
(122) The cDNA of the gene At5g26660 in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 51 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 52 described below as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene At5g26660.
(123) TABLE-US-00008 (SEQ ID NO: 51) 5′-gATGGGAAGACATTCTTGTTGTTTTAAGCA-3′ (SEQ ID NO: 52) 5′-AAGGCTCTGATCAAACACCATGTTATTAAG-3′
(124) The resultant amplification product without the stop codon of the gene At5g26660 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid p35SRDX having the promoter CaMV 35S and the transcriptional regulatory domain SRDX prepared in [Example 1] (1-1) (a) and (b) by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene At5g26660 in a reading frame of SRDX from the plasmids containing the gene At5g26660 introduced in the forward direction.
(125) The resultant plasmid for transformation carries the chimeric gene ProCaMV 35S:At5g26660SRDX where the promoter ProCaMV 35S, the gene At5g26660, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct B” as appropriate, and the chimeric gene ProCaMV 35S:At5g26660SRDX carried on Construct B is abbreviated as “Chimeric gene B” as appropriate. The schematic structure of Chimeric gene B is shown in
(126) (2-2) Development of Transformed Plant B by Transformation with Construct B
(127) The Arabidopsis thaliana plants were transformed with Construct B as in [Example 1] (1-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct B is abbreviated as “Transformed plant B” as appropriate.
[Example 3] Production of Construct C (ProCaMV 35S:At5g01200SRDX) for Transformation and Arabidopsis thaliana Plant Transformation
(128) (3-1) Production of Construct C
(129) The cDNA of the gene At5g01200 in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 53 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 54 described below as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene At5g01200.
(130) TABLE-US-00009 (SEQ ID NO: 53) 5′-gATGTCATCGTCGACGATGTACAGAGGAGT-3′ (SEQ ID NO: 54) 5′-ACTCCACTGCGGAAACGCATTATAATAGCT-3′
(131) The resultant amplification product without the stop codon of the gene At5g01200 was cleaved with SmaI, recovered by agarose gel electrophoresis, and inserted into the plasmid p35SRDX having the promoter CaMV 35S and the transcriptional regulatory domain SRDX prepared in [Example 1] (1-1) (a) and (b) by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene At5g01200 in a reading frame of SRDX from the plasmids containing the gene At5g01200 introduced in the forward direction.
(132) The resultant plasmid for transformation carries the chimeric gene ProCaMV 35S:At5g01200SRDX where the promoter ProCaMV 35S, the gene At5g01200, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct C” as appropriate, and the chimeric gene ProCaMV 35S:At5g01200SRDX carried on Construct C is abbreviated as “Chimeric gene C” as appropriate. The schematic structure of Chimeric gene C is shown in
(133) (3-2) Development of Transformed Plant C by Transformation with Construct C
(134) The Arabidopsis thaliana plants were transformed with Construct C as in [Example 1] (1-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct C is abbreviated as “Transformed plant C” as appropriate.
[Example 4] Production of Construct D (ProCaMV 35S:At2g38090SRDX) for Transformation and Arabidopsis thaliana Plant Transformation
(135) (4-1) Production of Construct D
(136) The cDNA of the gene At2g38090 in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 55 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 56 described below as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene At2g38090.
(137) TABLE-US-00010 (SEQ ID NO: 55) 5′-gATGAACAGAGGAATCGAAGTTATGTCACC-3′ (SEQ ID NO: 56) 5′-CATTTGGAGATACGCATTGTACGATTCGAA-3′
(138) The resultant amplification product without the stop codon of the gene At2g38090 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid p35SRDX having the promoter CaMV 35S and the transcriptional regulatory domain SRDX prepared in [Example 1] (1-1) (a) and (b) by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene At2g38090 in a reading frame of SRDX from the plasmids containing the gene At2g38090 introduced in the forward direction.
(139) The resultant plasmid for transformation carries the chimeric gene ProCaMV 35S:At2g38090SRDX where the promoter ProCaMV 35S, the gene At2g38090, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct D” as appropriate, and the chimeric gene ProCaMV 35S:At2g38090SRDX carried on Construct D is abbreviated as “Chimeric gene D” as appropriate. The schematic structure of Chimeric gene D is shown in
(140) (4-2) Development of Transformed Plant D by Transformation with Construct D
(141) The Arabidopsis thaliana plants were transformed with Construct D as in [Example 1] (1-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct D is abbreviated as “Transformed plant D” as appropriate.
[Example 5] Production of Construct E (ProCaMV 35S:At5g58900SRDX) for Transformation and Arabidopsis thaliana Plant Transformation
(142) (5-1) Production of Construct E
(143) The cDNA of the gene At5g58900 in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 57 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 58 described below as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene At5g58900.
(144) TABLE-US-00011 (SEQ ID NO: 57) 5′-gATGGAGGTTATGAGACCGTCGACGTCACA-3′ (SEQ ID NO: 58) 5′-TAGTTGAAACATTGTGTTTTGGGCGTCATA-3′
(145) The resultant amplification product without the stop codon of the gene At5g58900 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid p35SRDX having the promoter CaMV 35S and the transcriptional regulatory domain SRDX prepared in [Example 1] (1-1) (a) and (b) by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene At5g58900 in a reading frame of SRDX from the plasmids containing the gene At5g58900 introduced in the forward direction.
(146) The resultant plasmid for transformation carries the chimeric gene ProCaMV 35S:At5g58900SRDX where the promoter ProCaMV 35S, the gene At5g58900, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct E” as appropriate, and the chimeric gene ProCaMV 35S:At5g58900SRDX carried on Construct E is abbreviated as “Chimeric gene E” as appropriate. The schematic structure of Chimeric gene E is shown in
(147) (5-2) Development of Transformed Plant E by Transformation with Construct E
(148) The Arabidopsis thaliana plants were transformed with Construct E as in [Example 1] (1-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct E is abbreviated as “Transformed plant E” as appropriate.
[Example 6] Production of Construct F (ProCaMV 35S:At3g16350SRDX) for Transformation and Arabidopsis thaliana Plant Transformation
(149) (6-1) Production of Construct F
(150) The cDNA of the gene At3g16350 in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 59 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 60 described below as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene At3g16350.
(151) TABLE-US-00012 (SEQ ID NO: 59) 5′-gATGACTCGTCGGTGTTCGCATTGTAGCAA-3′ (SEQ ID NO: 60) 5′-GATAGCCTGAATCGCGCTGTTGCCTTTACT-3′
(152) The resultant amplification product without the stop codon of the gene At3g16350 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid p35SRDX having the promoter CaMV 35S and the transcriptional regulatory domain SRDX prepared in [Example 1] (1-1) (a) and (b) by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene At3g16350 in a reading frame of SRDX from the plasmids containing the gene At3g16350 introduced in the forward direction.
(153) The resultant plasmid for transformation carries the chimeric gene ProCaMV 35S:At3g16350SRDX where the promoter ProCaMV 35S, the gene At3g16350, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct F” as appropriate, and the chimeric gene ProCaMV 35S:At3g16350SRDX carried on Construct F is abbreviated as “Chimeric gene F” as appropriate. The schematic structure of Chimeric gene F is shown in
(154) (6-2) Development of Transformed Plant E by Transformation with Construct F
(155) The Arabidopsis thaliana plants were transformed with Construct F as in [Example 1] (1-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct F is abbreviated as “Transformed plant F” as appropriate.
(156) [Example 7] Production of Construct G (ProAt5g01200:At5g01200SRDX) for transformation and Arabidopsis thaliana plant transformation
(157) (7-1) Production of Construct G
(158) (a) Construction of Plasmid p35SRDX
(159) The plasmid p35SRDX into which the promoter ProCaMV 35S and the transcriptional regulatory domain SRDX were introduced was constructed as in [Example 1] (1-1) (a) and (b).
(160) (b) Construction of plasmid ProAt5g01200-SRDX-NOS
(161) In the plasmid p35SRDX, a mutation was introduced into the HindIII site at the 5′ side of the attL1 sequence by a conventional process. This plasmid was cleaved with HindIII and SmaI, and a DNA fragment containing a multicloning site was inserted into the plasmid to form pSRDX-NOS.
(162) The genome in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 61 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 62 described below to amplify a promoter region having about 2.3 kbp located in the 5′ upstream region of the coding region of the gene At5g01200.
(163) TABLE-US-00013 (SEQ ID NO: 61) 5′-GGGAAGCTTCGGACTTCTGATTGATCCATAGTTTGTCC-3′ (SEQ ID NO: 62) 5′-GGGGGATCCAGCTCCTCCTCTGTTTTTGGTGAAAACTTTC-3′
(164) The PCR was repeated 30 cycles, each cycle including a denaturing reaction at 94° C. for one minute, an annealing reaction at 50° C. for one minute, and an extending reaction at 72° C. for three minutes.
(165) The resultant amplification product of the promoter region of the gene At5g01200 (hereinafter, referred to as “ProAt5g01200” as appropriate) was cleaved with HindIII and BamHI by a conventional process and recovered by agarose gel electrophoresis. Similarly, the plasmid pSRDX-NOS described above was cleaved with HindIII and BamHI by a conventional process and recovered by agarose gel electrophoresis. The cleaved fragment of the promoter ProAt5g01200 described above was inserted into the cleaved fragment of the plasmid pSRDX-NOS by a conventional process, and the product was sequenced to screen a specific plasmid containing the 5′ upstream region of the gene At5g01200 introduced in the forward direction and having no PCR error. The resultant plasmid is referred to as “ProAt5g01200-SRDX-NOS vector”.
(166) (c) Production of ProAt5g01200:At5g01200SRDX by Insertion of At5g01200 into Plasmid
(167) The cDNA of the gene At5g01200 in Arabidopsis thaliana as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 53 and a 3′ end lower primer having the base sequence of SEQ ID NO: 54 as in [Example 3] (1-1) to amplify a partial sequence where the stop codon was removed from the gene At5g01200.
(168) The resultant amplification product without the stop codon of the gene At5g01200 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid ProAt5g01200-SRDX-NOS having the promoter ProAt5g01200 prepared in (b) described above and the transcriptional regulatory domain SRDX by a conventional process. The resulting plasmids were sequenced to screen a specific plasmid that coincided with the gene At5g01200 in a reading frame of SRDX from the plasmids containing the gene At5g01200 introduced in the forward direction.
(169) The resultant plasmid for transformation carries the chimeric gene ProAt5g01200:At5g01200SRDX where the promoter ProAt5g01200, the gene At5g01200, and the transcriptional regulatory domain SRDX are operably linked. This plasmid for transformation is abbreviated as “Construct G” as appropriate, and the chimeric gene ProCaMV 35S: At5g01200SRDX carried on Construct G is abbreviated as “Construct G” as appropriate. The schematic structure of Chimeric gene F is shown in
(170) (7-2) Development of Transformed Plant G by Transformation with Construct G
(171) The Arabidopsis thaliana plants were transformed with Construct G as in [Example 1] (1-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct G is abbreviated as “Transformed plant G” as appropriate.
(172) [Evaluation 1] Confirmation of Traits of Transformed Plants
(173) The stamens were removed (emasculated) from the buds of Transformed plants A to G, and the traits of unfertilized pods and ovules were observed. Similarly, the traits of unfertilized pod and ovule in a wild-type Arabidopsis thaliana plant were observed as a control.
(174) The longitudinal and lateral lengths of the ovules in Transformed plants A, C, and G were then measured to calculate the areas of the endosperm portions.
(175) [Evaluation 2] Analysis of Seed Coat Development in Ovules of Transformed Plants
(176) The unfertilized pods of Transformed plants A to C and G were dissected, and the extracted ovules were stained with a vanillin staining suspension (0.2 g of vanillin suspended in 10 ml of 6N HCl solution), and the stained pods were observed with an optical microscope. Similarly, the ovule from a wild-type Arabidopsis thaliana plant as a control was stained with the vanillin suspension and observed with an optical microscope.
(177) The vanillin staining suspension stains proanthocyanidin in seed coats to exhibit a red color. Accumulation of proanthocyanidin in the seed coats is known to be induced by endosperm development, and the vanillin staining is thus regarded as a marker for endosperm development. In other words, the fact that the vanillin staining was observed in the unfertilized ovules of Transformed plants A to C and F indicates that Transformed plants A to C and G can develop the endosperms without fertilization. These results prove that Constructs A to C and G having Chimeric genes A to C and G, respectively, induce spontaneous endosperm development (or endosperm development under unfertilization) in Arabidopsis thaliana.
(178) [Evaluation 3] Experiments of Nurturing Embryos by Endosperms that Spontaneously Develop in Transformed Plants
(179) The stamens were removed (emasculated) from the buds in Transformed plants A and G, and the pollen with kokoperi mutants (having a red fluorescent marker) was pollinated to unfertilized pistils.
(180) The principle of the experiment using the kokopelli mutants will now be explained with reference to
(181) In the present Examples, the kokopelli pollen was crossed with the pistils of Transformed plants A and G, and the development of embryos in the ovules in which only the egg cells was fertilized was observed to determine whether the endosperm developed without fertilization in Transformed plants A and G can nurture the fertilized embryos.
(182)
[Example 8] Production of Construct H (ProZmUBQ1:Os05g0543600SRDX) for Transformation and Oryza sativa Plant Transformation
(183) (8-1) Production of Construct H
(184) (a) Production of Plasmid pZmUBQ1_SRDX_HSP
(185) The vector pUBQ1SXG described in Yoshida et al., Front Plant Sci. (2013) 4, 383, was cleaved with restriction enzymes EcoRI and SacI, and the DNA fragment containing a Heat Shock Protein terminator produced by cleavage of the plasmid pRI201-AN (Takara Bio Inc., Japan) with the restriction enzymes EcoRI and SacI was inserted into the cleaved vector. This product is referred as “plasmid pZmUBQ1_SRDX_HSP”. This plasmid contains a Zea mays UBQ1 promoter, a region encoding the transcriptional regulatory domain SRDX, and a terminator region of the gene HSP18.2 in Arabidopsis thaliana, and has attL1 and attL2 GATEWAY recombinant sites at two ends thereof.
(186) (b) Production of Construct H
(187) The cDNA of the gene Os05g0543600 in Oryza sativa as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 63 and a 3′ end lower primer having the base sequence of SEQ ID NO: 64 as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene Os05g0543600.
(188) TABLE-US-00014 (SEQ ID NO: 63) 5′-gATGGGACGGCTGTCGTCGTG-3′ (SEQ ID NO: 64) 5′-GAAGTATTCCAAGTTGAAGTCGAATTGAGC-3′
(189) The resultant amplification product without the stop codon of the gene Os05g0543600 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid pZmUBQ1_SRDX_HSP by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene Os05g0543600 in a reading frame of SRDX from the plasmids containing the gene Os05g0543600 introduced in the forward direction.
(190) The resultant plasmid was subjected to the GATEWAY LR reaction with a pBCKH vector described in Mitsuda et al., Plant Biotech. J., (2006) 4, 325-332 to yield a plasmid for transformation based on the vector pBCKH.
(191) The resultant plasmid for transformation carries the chimeric gene ProZmUBQ1:Os05g0543600SRDX where the promoter ProZmUBQ1, the gene Os05g0543600, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct H” as appropriate, and the chimeric gene ProZmUBQ1:Os05g0543600SRDX carried on Construct H is abbreviated as “Chimeric gene H” as appropriate. The schematic structure of Chimeric gene H is shown in
(192) (8-2) Development of Transformed Plant H
(193) The Oryza sativa calluses were transformed with Construct H by the method described in “A protocol for Agrobacterium-mediated transformation in rice” (Nishimura et al. 2006, Nature Protocols, 1:2796). Construct H was introduced into a soil bacterium, i.e., Agrobacterium tumefaciens strain EHA105 (Hood et al., Transgenic Research (1993) 2: 208-218.) by electroporation.
(194) The bacterial cells were then collected and suspended in an infiltration medium (30 mL, AAM containing acetosyringone). The embryogenic calluses induced from Oryza sativa seeds for three to four weeks were immersed in this solution for one and half minutes and co-cultivated for 48 to 60 hours on a co-culture medium (2N6-AS medium). The calluses were washed and then cultivated on a selective medium (N6D-S medium) containing hygromycin for three to four weeks. Calluses successfully transformed with Construct H acquired hygromycin resistance. The transformed calluses that grew in the hygromycin medium were selected, and were cultivated on a re-differentiation medium containing hygromycin (MS-NK medium) for three to four weeks and then on a plant growing medium containing hygromycin (MS-HF medium) for three to four weeks to reproduce transformed plants. The resultant transformed plants were replanted in a soil and grown. The plant transformed with Construct H in such a procedure is abbreviated as “Transformed plant H” as appropriate.
[Example 9] Production of Construct I (ProZmUBQ1:Os01g0142500SRDX) for Transformation and Oryza sativa Plant Transformation
(195) (9-1) Production of Construct I
(196) The cDNA of the gene Os01g0142500 in Oryza sativa as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 65 and a 3′ end lower primer having the base sequence of SEQ ID NO: 66 as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene Os01g0142500.
(197) TABLE-US-00015 (SEQ ID NO: 65) 5′-gATGATGATGAGGGATGTGTGCATGGAGGT-3′ (SEQ ID NO: 66) 5′-AAACAATATGCTTCGGCTCGCGGCCAACTG-3′
(198) The resultant amplification product without the stop codon of the gene Os01g0142500 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid pZmUBQ1_SRDX_HSP by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene Os01g0142500 in a reading frame of SRDX from the plasmids containing the gene Os01g0142500 introduced in the forward direction. The resultant plasmid was then subjected to the GATEWAY LR reaction with pBCKH to yield a plasmid for transformation.
(199) The resultant plasmid for transformation carries the chimeric gene ProZmUBQ1:Os01g0142500SRDX where the promoter ProZmUBQ1, the gene Os01g0142500, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct I” as appropriate, and the chimeric gene ProZmUBQ1:Os01g0142500SRDX carried on Construct I is abbreviated as “Chimeric gene I” as appropriate. The schematic structure of Chimeric gene I is shown in
(200) (9-2) Development of Transformed Plant I by Transformation with Construct I
(201) The Oryza sativa plants were transformed with Construct I as in [Example 8] (8-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct I is abbreviated as “Transformed plant I” as appropriate.
[Example 10] Production of Construct J (ProOsFST:Os01g0853700SRDX) for Transformation and Oryza sativa Plant Transformation
(202) (10-1) Production of Construct J
(203) (a) Production of plasmid pOsFSTp-SRDX-HSP_Entry
(204) The vector pSRDX-NOS_entry described in Mitsuda et al., Plant Cell (2007) 19, 270. was cleaved with restriction enzymes EcoRI and SacI, and the DNA fragment containing a Heat Shock Protein terminator produced by cleavage of the plasmid pRI201-AN (Takara Bio Inc., Japan) with the restriction enzymes EcoRI and SacI was inserted into the cleaved vector. This product is referred to as “plasmid pSRDX-HSP_entry”. The Oryza sativa genome as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 67 described below and a 3′ end lower primer having the base sequence of SEQ ID NO: 68 described below to amplify a promotor region of FST gene in Oryza sativa.
(205) TABLE-US-00016 (SEQ ID NO: 67) 5′-GGCCGGCGCGCCTTATATATGGTCATTATATATTTGCTA-3′ (SEQ ID NO: 68) 5′-AAATTTGGATCCGCCTGCTATACCTTCCTGATCGAGTTT-3′
(206) The PCR was repeated 30 cycles, each cycle including a denaturing reaction at 98° C. for ten seconds subsequent to a denaturing reaction at 98° C. for two minutes, an annealing reaction at 55° C. for twenty seconds, and an extending reaction at 72° C. for three minutes.
(207) The resultant amplification product of the promoter region of the FST gene was cleaved with AscI and BamHI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid pSRDX-HSP_entry described above by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid having a base sequence of the FST promoter region coinciding with the genomic information. This plasmid is referred to as “plasmid pFSTp-SRDX-HSP_entry”. This plasmid contains the FST promoter in Oryza sativa, the region encoding the transcriptional regulatory domain SRDX, and the terminator region of the gene HSP18.2 in Arabidopsis thaliana, and has attL1 and attL2 GATEWAY recombinant sites at two ends thereof.
(208) (b) Production of Construct J
(209) The cDNA of the gene Os01g0853700 in Oryza sativa as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 69 and a 3′ end lower primer having the base sequence of SEQ ID NO: 70 as in [Example 1] (1-1) (a) to amplify a partial sequence where the stop codon was removed from the gene Os01g0853700.
(210) TABLE-US-00017 (SEQ ID NO: 69) 5′-GATGATGGCAGAGGCGCTTCGGGAGGTGCT-3′ (SEQ ID NO: 70) 5′-CAAGTGTCCGCATTGCATCTGCAGGAG-3′
(211) The resultant amplification product without the stop codon of the gene Os01g0853700 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid pFSTp-SRDX-HSP_entry described above by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene Os01g0853700 in a reading frame of SRDX from the plasmids containing the gene Os01g0853700 introduced in the forward direction.
(212) The resultant plasmid was subjected to the GATEWAY LR reaction with a pBCKH vector described in Mitsuda et al., Plant Biotech. J., (2006) 4, 325-332 to yield a plasmid for transformation based on the pBCKH vector.
(213) The resultant plasmid for transformation carries the chimeric gene ProOsFST:Os01g0853700SRDX where the promoter ProOsFST, the gene Os01g0853700, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct J” as appropriate, and the chimeric gene ProOsFST:Os01g0853700SRDX carried on Construct J is abbreviated as “Chimeric gene J” as appropriate. The schematic structure of Chimeric gene J is shown in
(214) (10-2) Development of Transformed Plant J by Transformation with Construct J
(215) The Oryza sativa plants were transformed with Construct J as in [Example 8] (8-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct J is abbreviated as “Transformed plant J” as appropriate.
[Example 11] Production of Construct K (ProOsFST:Os04g0569100SRDX) for Transformation and Oryza sativa Plant Transformation
(216) (11-1) Production of Construct K
(217) The cDNA of the gene Os04g0569100SRDX in Oryza sativa as a template was subjected to the PCR with a 5′ end upper primer having the base sequence of SEQ ID NO: 71 and a 3′ end lower primer having the base sequence of SEQ ID NO: 72 as in [Example 1] (1-1) (b) to amplify a partial sequence where the stop codon was removed from the gene Os01g0142500.
(218) TABLE-US-00018 (SEQ ID NO: 71) 5′-GATGCAGTTCCCGTTCTCCGGCGCTGGCCC-3′ (SEQ ID NO: 72) 5′-CACGTCGCAATGCAGCGCCGTCTTGATCTT-3′
(219) The resultant amplification product without the stop codon of the gene Os04g0569100 was cleaved with SmaI, was recovered by agarose gel electrophoresis, and was inserted into the plasmid pFSTp-SRDX-HSP_entry described above by a conventional process. The resulting plasmids were sequenced by a conventional method to screen a specific plasmid that coincided with the gene Os04g0569100 in a reading frame of SRDX from the plasmids containing the gene Os04g0569100 introduced in the forward direction. The resultant plasmid was subjected to the GATEWAY LR reaction with the pBCKH to yield a plasmid for transformation.
(220) The resultant plasmid for transformation carries the chimeric gene ProOsFST:Os04g0569100SRDX where the promoter ProOsFST, the gene Os04g0569100, and the transcriptional regulatory domain SRDX are operably linked. This plasmid is abbreviated as “Construct K” as appropriate, and the chimeric gene ProOsFST:Os04g0569100SRDX carried on Construct K is abbreviated as “Chimeric gene K” as appropriate. The schematic structure of Chimeric gene K is shown in
(221) (11-2) Development of Transformed Plant K by Transformation with Construct K
(222) The Oryza sativa plants were transformed with Construct K as in [Example 8] (8-2), and plants successfully transformed were screened with a hygromycin medium. The resultant plant transformed with Construct K is abbreviated as “Transformed plant K” as appropriate.
(223) [Evaluation 4] Confirmation of Traits of Transformed Plants
(224) The inflorescences of Transformed plants H, I, J, and K during blooming were soaked in warm water (42° C.) for seven minutes, and the stamens were then removed (emasculated) from the flowers that bloomed on the same day. The flowers that had already finished blooming and the buds before blooming were cut off, and the development of unfertilized ovules was observed in the emasculated flowers. Similarly, the inflorescence of a wild-type Oryza sativa plant was emasculated as a control, and the development of unfertilized ovules was observed in the same manner. The development of ovules was observed also in the inflorescences of Transformed plants H, I, J, and K and the wild-type plant that were not emasculated. The development of ovules was classified into Stages 0 to 4.
(225)
(226) The ingredients of the ovules that spontaneously swelled in Transformed plants H, I, J, and K were also stained with an iodine solution (0.1 g of potassium iodide and 0.5 g of iodine suspended in 10 ml of distilled water) to observe the stained ovules with a stereoscopic microscope.
INDUSTRIAL APPLICABILITY
(227) The present invention is based on a technique that can artificially induce a functional endosperm in a seed plant without fertilization, and thereby has a high applicability, especially in the field for an improvement in agricultural productivity.