Bispecific Caninized Antibodies for Treating Atopic Dermatitis
20230250177 · 2023-08-10
Assignee
Inventors
Cpc classification
C07K16/2866
CHEMISTRY; METALLURGY
C07K16/24
CHEMISTRY; METALLURGY
C07K2317/66
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/64
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides compositions for treating canine atopic dermatitis that comprise a caninized anti-proliferative antibody, a caninized anti-pruritic antibody, and a caninized anti-inflammatory antibody. The present invention further relates to compositions that comprise a bispecific antibody that comprises a caninized anti -pruritic antibody and a caninized anti-proliferative antibody or alternatively a bispecific antibody comprising a caninized anti-pruritic antibody and a caninized anti-inflammatory antibody.
Claims
1. A composition for treating atopic dermatitis in canines comprising a caninized anti-pruritic antibody, a caninized anti-proliferative antibody, and a caninized anti-inflammatory antibody; wherein the caninized anti-pruritic antibody is part of a bispecific antibody that further comprises the caninized anti-proliferative antibody or the caninized anti-inflammatory antibody.
2. The composition of claim 1, wherein the bispecific antibody comprises a monomer of the caninized anti-pruritic antibody comprising a heavy chain and a light chain and a monomer of the caninized anti-proliferative antibody comprising a heavy chain and a light chain.
3. The composition of claim 2, wherein the caninized anti-pruritic antibody is a caninized interleukin-31 (IL-31) antibody and the caninized anti-proliferative antibody is a caninized interleukin- 22 (IL-22) antibody.
4. The composition of claim 3, wherein the caninized IL-31 antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 12 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 16 or comprises a light chain comprising the amino acid sequence of SEQ ID NO: 11 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 15.
5. (canceled)
6. The composition of claim 4, wherein the light chain of the caninized IL-31 antibody has been modified to comprise a heavy chain constant region 1 (CH1) from the heavy chain of the caninized IL-31 antibody in place of a constant light domain (CL); and wherein the heavy chain of the caninized IL-31 antibody has been modified to comprise the constant light domain (CL) from the light chain of the caninized IL-31 antibody in place of the CH1.
7. The composition of claim 6, wherein the caninized IL-22 antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 24 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 17.
8. The composition of claim 7, wherein the caninized anti-inflammatory antibody is a caninized interleukin-4 receptor alpha (IL-4R alpha) antibody.
9. The composition of claim 8, wherein the caninized IL-4R alpha antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 4 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 5, or a light chain comprising the amino acid sequence of SEQ ID NO: 6 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 7.
10. The composition of claim 1, wherein the bispecific antibody comprises a monomer of the caninized anti-pruritic antibody comprising a heavy chain and a light chain and a monomer of the caninized anti-inflammatory antibody comprising a heavy chain and a light chain.
11. The composition of claim 10, wherein the caninized anti-pruritic antibody is a caninized interleukin-31 receptor alpha (IL-31RA) antibody and the caninized anti-inflammatory antibody is a caninized interleukin-4 receptor alpha (IL-4R alpha) antibody.
12. The composition of claim 11, wherein the caninized IL-4R alpha antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 4 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 18 or comprising the amino acid sequence of SEQ ID NO: 6 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 19.
13. (canceled)
14. The composition of claim 12, wherein the light chain of the caninized IL-4R alpha antibody has been modified to comprise a heavy chain constant region 1 (CH1) from the heavy chain of the caninized IL-4R alpha antibody in place of a constant light domain (CL); and wherein the heavy chain of the caninized IL-4R alpha antibody has been modified to comprise the constant light domain (CL) from the light chain of the caninized IL-4R alpha antibody in place of the CH1.
15. The composition of claim 14, wherein the caninized IL-31RA antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 43 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 44.
16. The composition of claim 15, wherein the caninized anti-proliferative antibody is a caninized IL-22 antibody.
17. The composition of claim 16, wherein the caninized anti-proliferative antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 20 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 21.
18. The composition of claim 16, wherein the caninized anti-proliferative antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 22 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 23.
19. The composition of claim 16, wherein the caninized anti-proliferative antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 24 and a heavy chain comprising the amino acid sequence of SEQ ID NO: 25.
20. The composition of claim 1, further comprising one or more additional components selected from the group consisting of a Janus kinase (JAK) inhibitor, a spleen tyrosine kinase (SYK) inhibitor, or an antagonist to a chemoattractant receptor-homologous molecule expressed on TH2 cells.
21. The composition of claim 20, wherein the JAK inhibitor is selected from the group consisting of: ##STR00004## where R.sup.1 is C.sub.1-4 alkyl optionally substituted with hydroxy, and pharmaceutically acceptable salts thereof; and ##STR00005## and pharmaceutically acceptable salts thereof.
22. A method of treating atopic dermatitis comprising administering the composition of claim 20, to a canine that has atopic dermatitis.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION OF THE INVENTION
[0024] In response to need for better therapies for atopic dermatitis, the present invention provides formulations and methodology that can achieve the simultaneous modulation of IL-4, IL-31, and IL-22, and produce a rapid onset of anti-pruritic action concomitant with a significant effect on the skin inflammation and an improvement in skin barrier function.
Abbreviations
[0025] Throughout the detailed description and examples of the invention the following abbreviations will be used:
TABLE-US-00001 ADCC Antibody-dependent cellular cytotoxicity CDC Complement-dependent cyotoxicity CDR Complementarity determining region in the immunoglobulin variable regions, defined using the Kabat numbering system CHO Chinese hamster ovary CL Constant Light Domain EC50 concentration resulting in 50% efficacy or binding ELISA Enzyme-linked immunosorbant assay FR Antibody framework region: the immunoglobulin variable regions excluding the CDR regions. HRP Horseradish peroxidase IFN interferon IC50 concentration resulting in 50% inhibition IgG Immunoglobulin G Kabat An immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat [Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)] mAb Monoclonal antibody (also Mab or MAb) MES 2-(N-morpholino)ethanesulfonic acid MOA Mechanism of action NHS Normal human serum PCR Polymerase chain reaction PK Pharmacokinetics SEB Staphylococcus Enterotoxin B TT Tetanus toxoid VH Immunoglobulin heavy chain variable region VL Immunoglobulin light chain variable region VK Immunoglobulin kappa light chain variable region
Definitions
[0026] So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.
[0027] As used herein, including the appended claims, the singular forms of words such as “a,” “an,” and “the,” include their corresponding plural references unless the context clearly dictates otherwise.
[0028] “Activation” as it applies to cells or to receptors refers to the activation or treatment of a cell or receptor with a ligand, unless indicated otherwise by the context or explicitly. “Ligand” encompasses natural and synthetic ligands, e.g., cytokines, cytokine variants, analogues, muteins, and binding compounds derived from antibodies. “Ligand” also encompasses small molecules, e.g., peptide mimetics of cytokines and peptide mimetics of antibodies. “Activation” can refer to cell activation as regulated by internal mechanisms as well as by external or environmental factors.
[0029] “Activity” of a molecule may describe or refer to the binding of the molecule to a ligand or to a receptor, to catalytic activity; to the ability to stimulate gene expression or cell signaling, differentiation, or maturation; to antigenic activity, to the modulation of activities of other molecules, and the like. “Activity” of a molecule may also refer to activity in modulating or maintaining cell-to-cell interactions, e.g., adhesion, or activity in maintaining a structure of a cell, e.g., cell membranes or cytoskeleton. “Activity” can also mean specific activity, e.g., [catalytic activity]/[mg protein], or [immunological activity]/[mg protein], concentration in a biological compartment, or the like. “Activity” may refer to modulation of components of the innate or the adaptive immune systems.
[0030] “Administration” and “treatment”, as it applies to an animal, e.g., a canine subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal e.g., a canine subject, cell, tissue, organ, or biological fluid. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
[0031] “Administration” and “treatment” also mean in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell. The term “subject” includes any organism, preferably an animal, more preferably a mammal (e.g., canine, feline, or human) and most preferably a canine.
[0032] “Treat” or “treating” means to administer a therapeutic agent, such as a composition containing any of the antibodies and/or the bispecific antibodies of the present invention, internally or externally to e.g., a canine subject or patient having one or more symptoms, or being suspected of having a condition, for which the agent has therapeutic activity.
[0033] Typically, the agent is administered in an amount effective to alleviate and/or ameliorate one or more disease/condition symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree. The amount of a therapeutic agent that is effective to alleviate any particular disease/condition symptom (also referred to as the “therapeutically effective amount”) may vary according to factors such as the disease state, age, and weight of the patient (e.g., canine), and the ability of the pharmaceutical composition to elicit a desired response in the subject. Whether a disease/condition symptom has been alleviated or ameliorated can be assessed by any clinical measurement typically used by veterinarians or other skilled healthcare providers to assess the severity or progression status of that symptom. While an embodiment of the present invention (e.g., a treatment method or article of manufacture) may not be effective in alleviating the target disease/condition symptom(s) in every subject, it should alleviate the target disease/condition symptom(s) in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student’s t-test, the chi.sup.2-test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
[0034] “Treatment,” as it applies to a human, veterinary (e.g., canine), or research subject, refers to therapeutic treatment, as well as research and diagnostic applications. “Treatment” as it applies to a human, veterinary (e.g., canine), or research subject, or cell, tissue, or organ, encompasses contact of the antibodies and/or the bispecific antibodies of the present invention to e.g., a canine or other animal subject, a cell, tissue, physiological compartment, or physiological fluid.
[0035] As used herein, the term “canine” includes all domestic dogs, Canis lupus familiaris or Canis familiaris, unless otherwise indicated.
[0036] As used herein, the term “feline” refers to any member of the Felidae family. Members of this family include wild, zoo, and domestic members, including domestic cats, pure-bred and/or mongrel companion cats, show cats, laboratory cats, cloned cats, and wild or feral cats.
[0037] As used herein the term “canine frame” refers to the amino acid sequence of the heavy chain and light chain of a canine antibody other than the hypervariable region residues defined herein as CDR residues. With regard to a caninized antibody, in the majority of embodiments the amino acid sequences of the native canine CDRs are replaced with the corresponding foreign CDRs (e.g., those from a mouse or rat antibody) in both chains. Optionally the heavy and/or light chains of the canine antibody may contain some foreign non-CDR residues, e.g., so as to preserve the conformation of the foreign CDRs within the canine antibody, and/or to modify the Fc function, as exemplified below and/or disclosed in U.S. 10,106,607 B2, hereby incorporated by reference herein in its entirety.
[0038] Canine antibodies (also referred to as immunoglobulin G or IgG) are large tetrameric proteins of about 150 Kd. Each IgG protein is composed of two identical light chains of about 25 Kd each, and two identical heavy chains of about 50 Kd each. There are four known IgG heavy chain subclasses of canine IgG and they are referred to as IgGA, IgGB, IgGC, and IgGD. There are two types of light chains; kappa or lambda chains. Each of the kappa or lambda light chains is composed of one variable domain (VL) and one constant domain (CL). Each of the two heavy chains consists of one variable domain (VH) and three constant domains referred to as heavy chain constant region 1 (CH1 or CH-1), heavy chain constant region 2 (CH2 or CH-2), and heavy chain constant region 3 (CH3 or CH-3). The CH1 domain is connected to the CH2 domain via an amino acid sequence referred to as the “hinge” or alternatively as the “hinge region”. In the present invention, the amino acid sequence for each of the four canine IgG Fc fragments is based on the identified boundary of the CH1 and the CH2 domains as determined by Tang et al. [Vet. Immunol. Immunopathol. 80: 259-270 (2001)]. In humans, IgG exists in one of four subclasses referred to as IgG1, IgG2, IgG3, and IgG4. The subclass of IgG is determined largely by the sequence of the hinge region, which differs among the four subclasses of IgG. The two heavy chains are linked to each other by disulfide bonds and each heavy chain also is linked to one of the light chains through a disulfide bond.
[0039] Digestion of IgG antibodies with the enzyme papain breaks an antibody molecule in the hinge region and results in the formation of three fragments. Two of these fragments are identical and each consists of the light chain held together with the VH and CH1 domains of the heavy chain. These fragments are called the “Fab” fragments and they contain the antigen binding sites of the antibody. A Fab fragment is a VL-CL chain appended to a VH-CH1 chain by a disulfide bridge. The third fragment that results from digestion with papain is called the “Fc” and it contains the remainder of the two heavy chains held together by disulfide bonds. The Fc thus contains a dimer consisting of the CH2 and CH3 domain of each of the two heavy chains. While the Fab enables the antibody to bind to its cognate epitope, the Fc enables the antibody to mediate immune effector functions such as antibody dependent cellular cytotoxicity (ADCC), antibody-dependent phagocytosis (ADCP) and complement dependent cytotoxicity (CDC). A “Fab fragment” is comprised of one light chain (VL domain and CL domain) and the CH1 and variable regions (VH) of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
[0040] The “Fragment crystallizable region” abbreviated as “Fc” corresponds to the CH3-CH2 portion of an antibody that interacts with cell surface receptors called Fc receptors. The canine fragment crystallizable region (cFc) of each of the four canine IgGs were first described by Tang et al. [Vet. Immunol. Immunopathol. 80: 259-270 (2001); see also, Bergeron et al., Vet. Immunol. Immunopathol. 157: 31-41 (2014) and U.S. 10,106,607 B2].
[0041] As used herein the canine Fc (cFc) “IgG-Bm” is canine IgG-B Fc comprising two (2) amino acid residue substitutions, D31A and N63A in the amino acid sequence of SEQ ID NO: 14 of IgG-B (see below). Both the aspartic acid residue (D) at position 31 of SEQ ID NO: 14 and the asparagine residue (N) at position 63 of SEQ ID NO: 14, are substituted by an alanine residue (A) in IgG-Bm. These two amino acid residue substitutions serve to significantly diminish the antibody-dependent cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) of the naturally occurring canine IgG-B [see, U.S. 10,106,607 B2, the contents of which are hereby incorporated by reference in their entirety]. Further amino acid substitutions to the IgG-Bm are also envisioned, which parallel those which can be made in IgG-B and may include amino acid substitutions to favor heterodimer formation in bispecific antibodies.
[0042] As used herein, a “substitution of an amino acid residue” with another amino acid residue in an amino acid sequence of an antibody for example, is equivalent to “replacing an amino acid residue” with another amino acid residue and denotes that a particular amino acid residue at a specific position in the amino acid sequence has been replaced by (or substituted for) by a different amino acid residue. Such substitutions can be particularly designed i.e., purposefully replacing an alanine with a serine at a specific position in the amino acid sequence by e.g., recombinant DNA technology. Alternatively, a particular amino acid residue or string of amino acid residues of an antibody can be replaced by one or more amino acid residues through more natural selection processes e.g., based on the ability of the antibody produced by a cell to bind to a given region on that antigen, e.g., one containing an epitope or a portion thereof, and/or for the antibody to comprise a particular CDR that retains the same canonical structure as the CDR it is replacing. Such substitutions/replacements can lead to “variant” CDRs and/or variant antibodies. As used herein, the term “antibody” refers to any form of antibody that exhibits the desired biological activity. An antibody can be a monomer, dimer, or larger multimer. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), caninized antibodies, fully canine antibodies, chimeric antibodies and camelized single domain antibodies. “Parental antibodies” are antibodies obtained by exposure of an immune system to an antigen prior to modification of the antibodies for an intended use, such as caninization of an antibody for use as a canine therapeutic antibody.
[0043] As used herein, antibodies and/or the bispecific antibodies of the present invention that “block” or is “blocking” or is “blocking the binding” of e.g., a canine receptor to its binding partner (ligand), is an antibody and/or the bispecific antibody that blocks (partially or fully) the binding of the canine receptor to its canine ligand and vice versa, as determined in standard binding assays (e.g., BIACore®, ELISA, or flow cytometry).
[0044] A “bivalent antibody” comprises two antigen binding sites. In some instances, the two binding sites have the same antigen specificities.
[0045] As used herein, a “bispecific antibody” is an artificial protein that can target two different antigens at the same time. One preferred type of bispecific antibody is an IgG-like antibody that consists of four different polypeptide chains. Accordingly, a bispecific antibody can be a heterodimer comprising two monomers that each comprise a heavy and light chain. The first monomer can be from an antibody to one particular antigen, while the second monomer can be from an antibody to a different antigen. For example, certain bispecific antibodies of the present invention can target IL-31 and IL-22 at the same time. Such antibodies are formed by association of one heavy chain and one light chain with specificity for the IL-31 with a heavy chain and light chain with specificity for the IL-22. Furthermore, each of the heavy and light chains can be modified with specific mutations of their amino acid sequence so as to favor the association of the heavy chain and the light chain of the IL-22 antibody with each other and the heavy chain and the light chain of IL-31 antibody with each other, but simultaneously favor the association of the heavy chain from IL-22 antibody with the heavy chain of the IL-31 antibody over the association of a IL-22 heavy chain with another IL-22 heavy chain or a IL-31 heavy chain with another IL-31 heavy chain.
[0046] Within the context of a bispecific antibody, a “monomer” of an antibody consists of one heavy chain and one light chain of that antibody.
[0047] As used herein, an “artificial protein” and an “artificial protein molecule” are used interchangeably and denote a protein (or multimer of proteins, such as dimers, heterodimers, tetramers, and heterotetramers, etc.) that does not naturally exist in nature, such as a man-made fusion protein or a heterodimer of monomers from two different antibodies.
[0048] Typically, an antibody or antigen binding fragment of the invention retains at least 10% of its canine antigen binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis. Preferably, an antibody or antigen binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the canine antigen binding affinity as the parental antibody. It is also intended that an antibody or antigen binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as “conservative variants” or “function conserved variants” of the antibody) that do not substantially alter its biologic activity.
[0049] “Isolated antibody” refers to the purification status and in such context means the molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term “isolated” is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.
[0050] As used herein, a “chimeric antibody” is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species. [U.S. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA 81: 6851-6855 (1984)]. Typically the variable domains are obtained from an antibody from an experimental animal (the “parental antibody”), such as a rodent, and the constant domain sequences are obtained from the animal subject antibodies, e.g., human or canine so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human or canine subject respectively, than the parental (e.g., rodent) antibody.
[0051] As used herein, the term “caninized antibody” refers to forms of antibodies that contain sequences from both canine and non-canine (e.g., murine or rat) antibodies. In general, the caninized antibody will comprise substantially all of at least one or more typically, two variable domains in which all or substantially all of the hypervariable loops correspond to those of a non-canine immunoglobulin (e.g., comprising 6 CDRs as exemplified below), and all or substantially all of the framework (FR) regions (and typically all or substantially all of the remaining frame) are those of a canine immunoglobulin sequence. As exemplified herein, a caninized antibody comprises both the three heavy chain CDRs and the three light chain CDRS from a murine or rat anti-canine antigen antibody together with a canine frame or a modified canine frame. A modified canine frame comprises one or more amino acids changes as exemplified herein that further optimize the effectiveness of the caninized antibody, e.g., to increase its binding to its canine antigen and/or its ability to block the binding of that canine antigen to the canine antigen’s natural binding partner.
[0052] The variable regions of each light/heavy chain pair form the antibody binding site. Thus, in general, an intact antibody has two binding sites. Except in bifunctional or bispecific antibodies, the two binding sites are, in general, the same.
[0053] Typically, the variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md. ; 5th ed.; NIH Publ. No. 91-3242 (1991); Kabat, Adv. Prot. Chem. 32:1-75 (1978); Kabat, et al., J. Biol. Chem. 252:6609-6616 (1977); Chothia, et al., J. Mol. Biol. 196:901-917 (1987) or Chothia, et al., Nature 342:878-883 (1989)].
[0054] As used herein, the term “hypervariable region” refers to the amino acid residues of an antibody that are responsible for antigen-binding. The hypervariable region comprises amino acid residues from a “complementarity determining region” or “CDR” [i.e. CDRL1 (or LCDR1), CDRL2 (or LCDR2), and CDRL3 (or LCDR3) in the light chain variable domain and CDRH1 (or HCDR1), CDRH2 (or HCDR2), and CDRH3 (or HCDR3) in the heavy chain variable domain]. [See Kabat et al. Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), defining the CDR regions of an antibody by sequence; see also Chothia and Lesk, J. Mol. Biol. 196: 901-917 (1987) defining the CDR regions of an antibody by structure]. As used herein, the term “framework” or “FR” residues refers to those variable domain residues other than the hypervariable region residues defined herein as CDR residues.
[0055] There are four known IgG heavy chain subtypes of dog IgG and they are referred to as IgG-A, IgG-B, IgG-C, and IgG-D. The two known light chain subtypes are referred to as lambda and kappa. In specific embodiments of the invention, besides binding and activating of canine immune cells, a canine or caninized antibody against its antigen of the present invention optimally has two attributes: [0056] 1. Lack of effector functions such as antibody-dependent cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), and [0057] 2. be readily purified on a large scale using industry standard technologies such as that based on protein A chromatography.
[0058] None of the naturally occurring canine IgG isotypes satisfy both criteria. For example, IgG-B can be purified using protein A, but has high level of ADCC activity. On the other hand, IgG-A binds weakly to protein A, but also displays ADCC activity. Moreover, neither IgG-C nor IgG-D can be purified on protein A columns, although IgG-D displays no ADCC activity. (IgG-C has considerable ADCC activity). One way the present invention addresses these issues is by providing modified canine IgG-B antibodies and/or bispecific antibodies of the present invention specific to an antigen of the present invention that lack the effector functions such as ADCC and can be easily purified using industry standard protein A chromatography.
[0059] In alternative embodiments of the present invention, the canine IgG-B or IgG-C antibodies and/or bispecific antibodies of the present invention specific to an antigen of the present invention are purposely not modified to remove/substantially diminish the effector functions such as ADCC, and therefore retain the effector functions such as ADCC.
[0060] As used herein an “anti-pruritic agent” or “antipruritic agent” is a compound, macromolecule, and/or formulation that tends to inhibit, relieve, and/or prevent itching. Anti-pruritic agents are colloquially referred to as anti-itch drugs.
[0061] As used herein an “anti-pruritic antibody” or “antipruritic antibody” is an antibody that can act as an anti-pruritic agent in an animal, including a mammal such as a human, a canine, and/or a feline, particularly with respect to atopic dermatitis. In particular embodiments, the anti-pruritic antibody binds to specific proteins in the IL-31 signaling pathway, such as IL-31 or its receptor IL-31RA. The binding of the anti-pruritic antibody to its corresponding antigen (e.g., IL-31 or IL-31RA) inhibits the binding of e.g., IL-31 with IL-31RA, and interferes with and/or prevents the successful signaling of this pathway, and thereby inhibits, relieves, and/or prevents the itching that is otherwise caused by the IL-31 signaling pathway.
[0062] As used herein an “anti-inflammatory agent” is a compound, macromolecule, and/or formulation that that reduces inflammation by blocking the interaction of certain substances in the body that cause inflammation.
[0063] As used herein an “anti-inflammatory antibody” is an antibody that can act as an anti-inflammatory agent in an animal, including a mammal such as a human, a canine, and/or a feline, particularly with respect to atopic dermatitis. In particular embodiments, the anti-inflammatory antibody binds to specific proteins in the IL-4/IL-13 signaling pathway, such as IL-4 or the receptor IL-4R.sub.α. The binding of the anti-inflammatory antibody to its corresponding antigen (e.g., IL-4 or IL-4R.sub.α) inhibits the binding of e.g., IL-4 with IL-4R.sub.α, and interferes with and/or prevents the signaling of this pathway, thereby interfering with or preventing the chronic inflammation associated with atopic dermatitis.
[0064] As used herein an “anti-proliferative agent” is a compound, macromolecule, and/or formulation that that counteracts the induction of epithelial cell proliferation, and in particular the induction of keratinocyte cell proliferation, particularly with respect to atopic dermatitis. The interleukin-22 binding protein (IL-22BP) is one example of a naturally occurring anti-proliferative agent.
[0065] As used herein an “anti-proliferative antibody” is an antibody that can act as an anti-proliferative agent in an animal, including a mammal such as a human, a canine, and/or a feline, particularly with respect to atopic dermatitis. In particular embodiments, the anti-proliferative antibody binds to specific proteins in the IL-22 signaling pathway, such as IL-22 or the receptor IL-22 receptor (IL-22R). The binding of the anti-proliferative antibody to its corresponding antigen (e.g., IL-22 or IL-22R) inhibits the binding of e.g., IL-22 with IL-22R, and interferes with and/or prevents the signaling of this pathway, thereby interfering with or preventing the keratinocyte cell proliferation associated with atopic dermatitis.
[0066] “Homology“ refers to sequence similarity between two polynucleotide sequences or between two polypeptide sequences when they are optimally aligned. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology is the number of homologous positions shared by the two sequences divided by the total number of positions compared × 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous when the sequences are optimally aligned then the two sequences are 60% homologous. Generally, the comparison is made when two sequences are aligned to give maximum percent homology.
[0067] “Isolated nucleic acid molecule” means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature. For purposes of this disclosure, it should be understood that “a nucleic acid molecule comprising” a particular nucleotide sequence does not encompass intact chromosomes. Isolated nucleic acid molecules “comprising” specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
[0068] The phrase “control sequences“ refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
[0069] A nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a pre-sequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a pre-protein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, “operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
[0070] As used herein, the expressions “cell,”“cell line,” and “cell culture” are used interchangeably and all such designations include progeny. Thus, the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
[0071] The present invention provides isolated caninized antibodies and/or bispecific antibodies of the present invention, methods of use of the antibodies and/or bispecific antibodies in the treatment of a condition e.g., the treatment of atopic dermatitis in canines. In canine, there are four IgG heavy chains referred to as A, B, C, and D. These heavy chains represent four different subclasses of dog IgG, which are referred to as IgG-A (or IgGA), IgG-B (or IgGB), IgG-C (or IgGC) and IgG-D (or IgGD). Each of the two heavy chains consists of one variable domain (VH) and three constant domains referred to as CH-1, CH-2, and CH-3. The CH-1 domain is connected to the CH-2 domain via an amino acid sequence referred to as the “hinge” or alternatively as the “hinge region”.
[0072] The DNA and amino acid sequences of these four heavy chains were first identified by Tang et al. [Vet. Immunol. Immunopathol. 80: 259-270 (2001)]. The amino acid and DNA sequences for these heavy chains are also available from the GenBank data bases. For example, the amino acid sequence of IgGA heavy chain has accession number AAL35301.1, IgGB has accession number AAL35302.1, IgGC has accession number AAL35303.1, and IgGD has accession number (AAL35304.1). Canine antibodies also contain two types of light chains, kappa and lambda. The DNA and amino acid sequence of these light chains can be obtained from GenBank Databases. For example the kappa light chain amino acid sequence has accession number ABY 57289.1 and the lambda light chain has accession number ABY 55569.1.
[0073] Caninized murine or rat anti-canine antibodies that bind canine IL-31, IL-31RA, IL-22, or IL-4R.sub.α include, but are not limited to: antibodies and/or bispecific antibodies of the present invention that comprise canine IgG-A, IgG-B, IgG-C, and IgG-D heavy chains and/or canine kappa or lambda light chains together with murine or rat anti-canine antigen CDRs. Accordingly, the present invention provides isolated caninized murine or rat anti-canine antibodies and/or bispecific antibodies of the present invention that bind to their corresponding canine antigens and block the binding of that canine antigen to their natural binding partner.
[0074] Accordingly, the present invention further provides caninized murine or rat antibodies and methods of use of the antibodies and/or bispecific antibodies of the present invention in the treatment of a condition e.g., the treatment of atopic dermatitis in canines.
[0075] The present invention further provides full length canine heavy chains that can be matched with corresponding light chains to make a caninized antibody. Accordingly, the present invention further provides caninized murine or rat anti-canine antigen antibodies (including isolated caninized murine or rat anti-canine antibodies) and/or bispecific antibodies comprising the caninized antibodies of the present invention and methods of use of the antibodies and/or bispecific antibodies of the present invention in the treatment of a condition e.g., the treatment of atopic dermatitis in canines.
[0076] The present invention also provides antibodies and/or bispecific antibodies of the present invention that comprise a canine fragment crystallizable region (cFc region) in which the cFc has been genetically modified to augment, decrease, or eliminate one or more effector functions. In one aspect of the present invention, the genetically modified cFc decreases or eliminates one or more effector functions. In another aspect of the invention the genetically modified cFc augments one or more effector function. In certain embodiments, the genetically modified cFc region is a genetically modified canine IgGB Fc region. In another such embodiment, the genetically modified cFc region is a genetically modified canine IgGC Fc region. In a particular embodiment the effector function is antibody-dependent cytotoxicity (ADCC) that is augmented, decreased, or eliminated. In another embodiment the effector function is complement-dependent cytotoxicity (CDC) that is augmented, decreased, or eliminated. In yet another embodiment, the cFc region has been genetically modified to augment, decrease, or eliminate both the ADCC and the CDC.
[0077] In order to generate variants of canine IgG that lack effector functions, a number of mutant canine IgGB heavy chains were generated. These variants may include one or more of the following single or combined substitutions in the Fc portion of the heavy chain amino acid sequence: P4A, D31A, N63A, G64P, T65A, A93G, and P95A. Variant heavy chains (i.e., containing such amino acid substitutions) were cloned into expression plasmids and transfected into HEK 293 cells along with a plasmid containing the gene encoding a light chain. Intact antibodies expressed and purified from HEK 293 cells were evaluated for binding to Fc.sub.γRI and Clq to assess their potential for mediation of immune effector functions. [See, U.S. 10,106,607 B2, the contents of which are hereby incorporated by reference in its entirety.]
[0078] The present invention also provides modified canine IgGDs which in place of its natural IgGD hinge region they comprise a hinge region from:
TABLE-US-00002 IgG-A: FNECRCTDTPPCPVPEP SEQ ID NO: 26 IgG-B: PKRENGRVPRPPDCPKCPAPEM SEQ ID NO: 27; or IgG-C: AKECECKCNCNNCPCPGCGL SEQ ID NO: 28.
[0079] Alternatively, the IgG-D hinge region can be genetically modified by replacing a serine residue with a proline residue, i.e., PKESTCKCIPPCPVPES, SEQ ID NO: 29 (with the proline residue (P) underlined and in bold substituting for the naturally occurring serine residue). Such modifications can lead to a canine IgGD lacking fab arm exchange. The modified canine IgGDs can be constructed using standard methods of recombinant DNA technology [e.g., Maniatis et al., Molecular Cloning, A Laboratory Manual (1982)]. In order to construct these variants, the nucleic acids encoding the amino acid sequence of canine IgGD can be modified so that it encodes the modified IgGDs. The modified nucleic acid sequences are then cloned into expression plasmids for protein expression.
[0080] Sequence identity refers to the degree to which the amino acids of two polypeptides are the same at equivalent positions when the two sequences are optimally aligned. As used herein one amino acid sequence is 100% “identical” to a second amino acid sequence when the amino acid residues of both sequences are identical. Accordingly, an amino acid sequence is 50% “identical” to a second amino acid sequence when 50% of the amino acid residues of the two amino acid sequences are identical. The sequence comparison is performed over a contiguous block of amino acid residues comprised by a given protein, e.g., a protein, or a portion of the polypeptide being compared. In particular embodiments, selected deletions or insertions that could otherwise alter the correspondence between the two amino acid sequences are taken into account.
[0081] Sequence similarity includes identical residues and nonidentical, biochemically related amino acids. Biochemically related amino acids that share similar properties and may be interchangeable are discussed
[0082] “Conservatively modified variants” or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity [see, e.g., Watson et al., Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.; 1987)]. In addition, substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in Table A directly below.
TABLE-US-00003 Exemplary Conservative Amino Acid Substitutions Original residue Conservative substitution Ala (A) Gly; Ser Arg (R) Lys; His Asn (N) Gln; His Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln Ile (I) Leu; Val Leu (L) Ile; Val Lys (K) Arg; His Met (M) Leu; Ile; Tyr Phe (F) Tyr; Met; Leu Pro (P) Ala; Gly Ser (S) Thr Thr (T) Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe Val (V) Ile; Leu
[0083] Function-conservative variants of the antibodies of the invention are also contemplated by the present invention. “Function-conservative variants,” as used herein, refers to antibodies or fragments in which one or more amino acid residues have been changed without altering a desired property, such an antigen affinity and/or specificity. Such variants include, but are not limited to, replacement of an amino acid with one having similar properties, such as the conservative amino acid substitutions of Table A above.
Nucleic Acids
[0084] The present invention further comprises the nucleic acids encoding the antibodies and/or the bispecific antibodies of the present invention (see e.g., Examples below).
[0085] Also included in the present invention are nucleic acids that encode immunoglobulin polypeptides comprising amino acid sequences that are at least about 70% identical, preferably at least about 80% identical, more preferably at least about 90% identical and most preferably at least about 95% identical (e.g., 95%, 96%, 97%, 98%, 99%, 100%) to the amino acid sequences of the caninized antibodies provided herein when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences. The present invention further provides nucleic acids that encode immunoglobulin polypeptides comprising amino acid sequences that are at least about 70% similar, preferably at least about 80% similar, more preferably at least about 90% similar and most preferably at least about 95% similar (e.g., 95%, 96%, 97%, 98%, 99%, 100%) to any of the reference amino acid sequences when the comparison is performed with a BLAST algorithm, wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences, are also included in the present invention.
[0086] As used herein, nucleotide and amino acid sequence percent identity can be determined using C, MacVector (MacVector, Inc. Cary, NC 27519), Vector NTI (Informax, Inc. MD), Oxford Molecular Group PLC (1996) and the Clustal W algorithm with the alignment default parameters, and default parameters for identity. These commercially available programs can also be used to determine sequence similarity using the same or analogous default parameters. Alternatively, an Advanced Blast search under the default filter conditions can be used, e.g., using the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program using the default parameters.
[0087] The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Altschul, S.F., et al., J. Mol. Biol. 215:403-410 (1990); Gish, W., et al., Nature Genet. 3:266-272 (1993); Madden, T.L., etal., Meth. Enzymol. 266:131-141(1996); Altschul, S.F., et al., Nucleic Acids Res. 25:3389-3402 (1997); Zhang, J., et al., Genome Res. 7:649-656 (1997); Wootton, J.C., et al., Comput. Chem. 17:149-163 (1993); Hancock, J.M. et al., Comput. Appl. Biosci. 10:67-70 (1994); ALIGNMENT SCORING SYSTEMS: Dayhoff, M.O., et al., “A model of evolutionary change in proteins.” in Atlas of Protein Sequence and Structure, vol. 5, suppl. 3. M.O. Dayhoff (ed.), pp. 345-352, (1978); Natl. Biomed. Res. Found., Washington, DC; Schwartz, R.M., et al., “Matrices for detecting distant relationships.” in Atlas of Protein Sequence and Structure, vol. 5, suppl. 3.“ (1978), M.O. Dayhoff (ed.), pp. 353-358 (1978), Natl. Biomed. Res. Found., Washington, DC; Altschul, S.F., J. Mol. Biol. 219:555-565 (1991); States, D.J., et al., Methods 3:66-70(1991); Henikoff, S., et al., Proc. Natl. Acad. Sci. USA 89:10915-10919 (1992); Altschul, S.F., et al., J. Mol. Evol. 36:290-300 (1993); ALIGNMENT STATISTICS: Karlin, S., et al., Proc. Natl. Acad. Sci. USA 87:2264-2268 (1990); Karlin, S., et al., Proc. Natl. Acad. Sci. USA 90:5873-5877 (1993); Dembo, A., et al., Ann. Prob. 22:2022-2039 (1994); and Altschul, S.F. “Evaluating the statistical significance of multiple distinct local alignments.” in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), pp. 1-14, Plenum, New York (1997).
[0088] Antibodies and/or the bispecific antibodies of the present invention can be produced recombinantly by methods that are known in the field. Mammalian cell lines available as hosts for expression of the antibodies or fragments disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines. Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells. Cell lines of particular preference are selected through determining which cell lines have high expression levels. Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells. When recombinant expression vectors encoding the heavy chain or antigen-binding portion or fragment thereof, the light chain and/or antigen-binding fragment thereof are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
[0089] Antibodies can be recovered from the culture medium using standard protein purification methods. Further, expression of antibodies of the invention (or other moieties therefrom) from production cell lines can be enhanced using a number of known techniques. For example, the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent Application No. 89303964.4.
[0090] In general, glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody. However, all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein, comprise the instant invention, independent of the glycosylation pattern that the antibodies may have. Similarly, in particular embodiments, antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo [See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775].
Antibody Engineering
[0091] Antibodies can also comprise a light chain constant region, e.g., a canine light chain constant region, such as a lambda or kappa canine light chain constant region or variant thereof. By way of example, and not limitation, the canine heavy chain constant region can be from IgG-B or a modified cFc, such as the IgG-Bm used herein [see, U.S. 10,106,607 B2, hereby incorporated by reference in its entirety] and the canine light chain constant region can be from a kappa light chain.
[0092] The antibodies and/or the bispecific antibodies of the present invention can be engineered to include modifications to the canine framework and/or the canine frame residues within the variable domains of a parental (i.e., mouse or rat) monoclonal antibody, e.g. to improve the properties of the antibody.
Pharmaceutical Compositions and Administration
[0093] To prepare pharmaceutical or sterile compositions comprising the antibodies and/or the bispecific antibodies of the present invention, these antibodies and/or the bispecific antibodies can be admixed with a pharmaceutically acceptable carrier or excipient. [See, e.g., Remington’s Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, PA (1984)].
[0094] Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions [see, e.g., Hardman, et al. (2001) Goodman and Gilman’s The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, NY; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, NY; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, NY]. In one embodiment, the antibodies and/or the bispecific antibodies of the present invention are diluted to an appropriate concentration in a sodium acetate solution pH 5-6, and NaCl or sucrose is added for tonicity. Additional agents, such as polysorbate 20 or polysorbate 80, may be added to enhance stability.
[0095] Toxicity and therapeutic efficacy of the antibody compositions, administered alone or in combination with another agent, can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index (LD.sub.50/ ED.sub.50). In particular aspects, antibodies exhibiting high therapeutic indices are desirable. The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in canines. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration.
[0096] The mode of administration can vary. Suitable routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial. In particular embodiments, the antibodies and/or the bispecific antibodies of the present invention can be administered by an invasive route such as by injection. In further embodiments of the invention, the antibodies and/or the bispecific antibodies of the present invention, or pharmaceutical composition thereof, is administered intravenously, subcutaneously, intramuscularly, intraarterially, or by inhalation, aerosol delivery. Administration by non-invasive routes (e.g., orally; for example, in a pill, capsule or tablet) is also within the scope of the present invention.
[0097] Compositions can be administered with medical devices known in the art. For example, a pharmaceutical composition of the invention can be administered by injection with a hypodermic needle, including, e.g., a prefilled syringe or autoinjector. The pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Pat. Nos.: 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
[0098] The pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules form administering pharmaceutical compositions include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments. Many other such implants, delivery systems, and modules are well known to those skilled in the art.
[0099] Alternatively, one may administer the antibodies and/or the bispecific antibodies of the present invention in a local rather than systemic manner, often in a depot or sustained release formulation.
[0100] The administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic the antibodies and/or the bispecific antibodies, the level of symptoms, the immunogenicity of the therapeutic antibodies and/or the bispecific antibodies and the accessibility of the target cells in the biological matrix. Preferably, the administration regimen delivers sufficient therapeutic antibodies and/or the bispecific antibodies to effect improvement in the target disease/condition state, while simultaneously minimizing undesired side effects. Accordingly, the amount of biologic delivered depends in part on the particular therapeutic antibodies and/or the bispecific antibodies and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies is available [see, e.g., Wawrzynczak Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK (1996); Kresina (ed.) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, NY (1991); Bach (ed.) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, NY (1993); Baert, et al. New Engl. J. Med. 348:601-608 (2003); Milgrom et al. New Engl. J. Med. 341:1966-1973 (1999); Slamon et al. New Engl. J. Med. 344:783-792 (2001); Beniaminovitz et al. New Engl. J. Med. 342:613-619 (2000); Ghosh et al. New Engl. J. Med. 348:24-32 (2003); Lipsky et al. New Engl. J. Med. 343:1594-1602 (2000)].
[0101] Determination of the appropriate dose is made by the veterinarian, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of the symptoms.
[0102] Antibodies and/or the bispecific antibodies provided herein may be provided by continuous infusion, or by doses administered, e.g., daily, 1-7 times per week, weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc. Doses may be provided, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation. A total weekly dose is generally at least 0.05 .Math.g/kg body weight, more generally at least 0.2 .Math.g/kg, 0.5 .Math.g/kg, 1 .Math.g/kg, 10 .Math.g/kg, 100 .Math.g/kg, 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 5.0 mg/ml, 10 mg/kg, 25 mg/kg, 50 mg/kg or more [see, e.g., Yang, et al. New Engl. J. Med. 349:427-434 (2003); Herold, et al. New Engl. J. Med. 346: 1692-1698 (2002); Liu, et al. J. Neurol. Neurosurg. Psych. 67:451-456 (1999); Portielji, et al. Cancer Immunol. Immunother. 52:133-144 (2003)]. Doses may also be provided to achieve a pre-determined target concentration of antibodies and/or the bispecific antibodies of the present invention in the canine’s serum, such as 0.1, 0.3, 1, 3, 10, 30, 100, 300 .Math.g/ml or more. In other embodiments, antibodies and/or the bispecific antibodies of the present invention is administered subcutaneously or intravenously, on a weekly, biweekly, “every 4 weeks,” monthly, bimonthly, or quarterly basis at 10, 20, 50, 80, 100, 200, 500, 1000 or 2500 mg/subject.
[0103] As used herein, “inhibit” or “treat” or “treatment” includes a postponement of development of the symptoms associated with a disorder and/or a reduction in the severity of the symptoms of such disorder. The terms further include ameliorating existing uncontrolled or unwanted symptoms, preventing additional symptoms, and ameliorating or preventing the underlying causes of such symptoms. Thus, the terms denote that a beneficial result has been conferred on a vertebrate subject (e.g., a canine) with a disorder, condition and/or symptom, or with the potential to develop such a disorder, disease or symptom.
[0104] As used herein, the terms “therapeutically effective amount”, “therapeutically effective dose” and “effective amount” refer to an amount of antibodies and/or the bispecific antibodies of the present invention that, when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject, e.g., canine, is effective to cause a measurable improvement in one or more symptoms of a disease or condition or the progression of such disease or condition. A therapeutically effective dose further refers to that amount of the antibodies and/or the bispecific antibodies sufficient to result in at least partial amelioration of symptoms, e.g., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions. When applied to a combination, a therapeutically effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially, or simultaneously. An effective amount of a therapeutic will result in an improvement of a diagnostic measure or parameter by at least 10%; usually by at least 20%; preferably at least about 30%; more preferably at least 40%, and most preferably by at least 50%. An effective amount can also result in an improvement in a subjective measure in cases where subjective measures are used to assess severity of the condition.
Other Combination Therapies
[0105] The compositions comprising the antibodies and/or the bispecific antibodies of the present invention, can comprise one or more additional therapeutic components. One such family of therapeutic components are Janus kinase (JAK) inhibitors. In a particular embodiment of this type the JAK inhibitor comprises the chemical formula of
##STR00001##
where R.sup.1 is C.sub.1-4 alkyl optionally substituted with hydroxy, and pharmaceutically acceptable salts thereof [U.S. 8,133,899; U.S. 8,987,283]. More particularly the JAK inhibitor is oclacitinib and even more particularly, oclacitinib maleate. An alternative JAK inhibitor, which preferentially inhibits JAK1 relative to JAK3 is: 1-[(3R,4S)-4-cyanotetrahydropyran-3-yl]-3-[(2-fluoro-6-methoxy-4-pyridyl)amino]pyrazole-4-carboxamide, which comprises the chemical formula of:
##STR00002##
and pharmaceutically acceptable salts thereof [see, WO 2018/108969].
[0106] Another therapeutic component that can be added to a composition of the present invention can be a spleen tyrosine kinase (SYK) inhibitor. One such SYK inhibitor is (1S,4R)-4-hydroxy-2,2-dimethyl-4-{5-[3-methyl-5-(4-methyl-pyrimidin-2-ylamino)-phenyl]-1,3-thiazol-2-yl}-cyclohexanecarboxylic acid or pharmaceutically acceptable salts thereof [see e.g., U.S. 8,759,366].
[0107] In addition, yet another therapeutic component that can be added to a composition of the present invention can an antagonist to a chemoattractant receptor-homologous molecule expressed on TH2 cells comprising the chemical formula of:
##STR00003##
and pharmaceutically acceptable salts thereof [see also, U.S. 7,696,222, U.S. 8,546,422, U.S. 8,637,541, WO 2010/099039; WO 2010/031183; and U.S. 8,546,422].
[0108] These additional therapeutic components can be administered to the canine subject prior to, in conjunction with, or following the administration of the composition comprising the antibodies and/or the bispecific antibodies of the present invention.
EXAMPLES
[0109] General Material and Methods: In all of the examples below, the recombinant proteins were obtained by providing the amino acid sequence for a selected protein to a commercial manufacturer (ATUM, Newark, California), who in turn chose an appropriate nucleotide sequence that encoded this amino acid sequence. The nucleotide sequences can also be obtained from publicly available DNA databases, such as GenBank®. The commercial manufacturer then chemically synthesized the nucleic acid, which next was cloned by ATUM into an expression plasmid (pD2610-v10; available from AUTM) for producing the corresponding recombinant protein. The plasmid was placed into either HEK-293 cells or CHO cells to express the recombinant protein, which was then isolated by conventional methods.
Example 1 Canine IL-22 and Anti-Canine IL-22 Antibodies
[0110] A nucleic acid encoding canine IL-22 with a C-terminal HIS tag was chemically synthesized and cloned into an expression plasmid that is suitable for production of the canine IL-22-HIS protein in eukaryotic cells, either HEK-293 or CHO cells. The resulting canine protein comprises the amino acid sequence of SEQ ID NO: 1
[0111] cILHIS: [SEQ ID NO: 1]
TABLE-US-00004 LPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGV NMGERCYLMKEVLNFTLEEVLLPQSDRFQPYMQEVVPFLARLSNKLSQCH IENDDQHIQRNVQKLKDTVQKLGENGEIKAIGELDLLFMALRNACVHHHH HH
[0112] In addition, a nucleic acid encoding the heavy chain and the light chain of a human monoclonal antibody [Fezakinumab; disclosed in WHO Drug Information, Vol. 24, No. 1, 2010)] that binds canine IL-22 were chemically synthesized and cloned separately into an expression plasmid that is produced the anti-canine IL-22 antibody in eukaryotic cells, (in either HEK-293 or CHO cells). The heavy chain comprising the amino acid sequence of SEQ ID NO: 2 and the light chain comprising the amino acid sequence of SEQ ID NO: 3 of Fezakinumab are reproduced below:
[0113] Human Fezakinumab Heavy chain: [SEQ ID NO: 2] PRIOR ART
TABLE-US-00005 QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWVGW INPYTGSAFYAQKFRGRVTMTRDTSISTAYMELSRLRSDDTAVYYCAREP EKFDSDDSDVWGRGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
[0114] Human Fezakinumab Light chain: [SEQ ID NO: 3] PRIOR ART
TABLE-US-00006 QAVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLI YGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGY VFGGGTQLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT VAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQV THEGSTVEKTVAPTECS
[0115] Complementarity determining regions (CDRs) useful for the construction of caninized antibodies that bind to canine IL-22 are exemplified by LC CDRs and HC CDRs of the antibody Fezakinumab in Table 1A and 1B.
TABLE-US-00007 AMINO ACID SEQUENCES OF PRIOR ART FEZAKINUMAB CDRs CDRs AMINO ACID SEQUENCE OF IL-22 ANTIBODY FEZAKINUMAB LC AND HC CDRS SEQ ID NO: HCDR-1 AsnTyrTyrMetHis 30 HCDR-2 TrpIleAsnProTyrThrGlySerAlaPheTyrAlaGlnLysPheArgGly 34 HCDR-3 GluProGluLysPheAspSerAspAspSerAspVal 38 LCDR-1 ThrGlySerSerSerAsnlleGlyAlaGlyTyrGlyValHis 32 LCDR-2 GlyAspSerAsnArgProSer 36 LCDR-3 GlnSerTyrAspAsnSerLeuSerGlyTyrVal 40
TABLE-US-00008 NUCLEOTIDE SEQUENCES OF PRIOR ART FEZAKINUMAB CDRs CDRs NUCLEI ACID SEQUENCE OF IL-22 ANTIBODY FEZAKINUMAB LC AND HC CDRs SEQ ID NO: HCDR-1 aactattatatgcat 31 HCDR-2 tggattaacccgtataccggcagcgcgttttatgcgcagaaatttcgcggc 35 HCDR-3 gaaccggaaaaatttgatagcgatgatagcgatgtg 39 LCDR-1 accggcagcagcagcaacattggcgcgggctatggcgtgcat 33 LCDR-2 ggcgatagcaaccgcccgagc 37 LCDR-3 cagagctatgataacagcctgagcggctatgtg 41
[0116] Anti-canine IL-22 antibodies useful for the present inventions are also exemplified by the caninized antibodies that are produced from combination of the pairs of heavy chains and light chains listed below. The amino acid sequences of each of the paired light and heavy chain of the caninized antibodies, i.e., SEQ ID NOs: 20 with 21, 22 with 23, and 24 with 25, provided below contain the respective CDRs of the antibody Fezakinumab. The heavy chains comprise a modified Fc, IgG-Bm, which is defined above.
[0117] cFezaVL1-cLC: [SEQ ID NO: 20]
TABLE-US-00009 QAVLTQPPSVSAVLGQRVTISCTGSSSNIGAGYGVHWYQQLPGKSPKTII YGDSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSYDNSLSGY VFGSGTQLTVLGQPKASPSVTLFPPSSEELGANKATLVCLISDFYPSGVT VAWKADGSPVTQGVETTKPSKQSNNKYAASSYLSLTPDKWKSHSSFSCLV THEGSTVEKKVAPAECS
[0118] cFezaVH1-cIgG-Bm: [SEQ ID NO: 21]
TABLE-US-00010 EVQLVQSGAEVKKPGASVKVSCKTSGYTFTNYYMHWVRQAPGAGLDWMGW INPYTGSAFYAQKFRGRVTLTADTSTSTAYMELSSLRAGDIAVYYCAREP EKFDSDDSDVWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLV SGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSE TFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIF PPKPKDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPRE EQFAGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKY RTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESL SHSPG
[0119] cFezaVL2-cLC: [SEQ ID NO: 22]
TABLE-US-00011 QAVLTQPPSVSAVLGQRVTISCTGSSSNIGAGYGVHWYQQLPGKSPKLLI YGDSNRPSGVPDRFSGSKSGSTASLTITGLQAEDEADYYCQSYDNSLSGY VFGGGTHLTVLGQPKASPSVTLFPPSSEELGANKATLVCLISDFYPSGVT VAWKADGSPVTQGVETTKPSKQSNNKYAASSYLSLTPDKWKSHSSFSCLV THEGSTVEKKVAPAECS
[0120] cFezaVH2-cIgG-Bm: [SEQ ID NO: 23]
TABLE-US-00012 EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGAGLDWVGW INPYTGSAFYAQKFRGRVTLTRDTSTSTAYMELSSLRAGDIAVYYCAREP EKFDSDDSDVWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLV SGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSE TFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIF PPKPKDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPRE EQFAGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKY RTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESL SHSPG
[0121] cFezaVL3-cLC: [SEQ ID NO: 24]
TABLE-US-00013 QSVLTQPPSVSGFLGQRVTISCTGSSSNIGAGYGVHWYQQLPGTGPRLLI YGDSNRPSGVPDRFSGSRSGSTATLTISGLQAEDEADYYCQSYDNSLSGY VFGGGTHLTVLGQPKASPSVTLFPPSSEELGANKATLVCLISDFYPSGVT VAWKADGSPVTQGVETTKPSKQSNNKYAASSYLSLTPDKWKSHSSFSCLV THEGSTVEKKVAPAECS
[0122] cFezaVH3-cIgG-Bm: [SEQ ID NO: 25]
TABLE-US-00014 EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGAGLDWVGW INPYTGSAFYAQKFRGRVTMTRDTSTSTAYMELSSLRAGDIAVYYCAREP EKFDSDDSDVWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLV SGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSE TFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIF PPKPKDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPRE EQFAGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKY RTTPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESL SHSPG
[0123] The binding of canine IL-22 HIS to the anti-IL-22 antibody Fezakinumab was determined by ELISA as follows:
[0124] Materials: [0125] 1. Coating Antigen: cIL-22-His, [0126] 2. Fezakinumab-mAb, [0127] 3. Mouse Anti-human IgG, Fc Peroxidase Conjugate, Calbiochem 411550, Lot D00167423, [0128] 4. 1-Step™ Ultra TMB-ELISA, Thermo Scientific 34028, Lot UF2782982, [0129] 5. NVSL PBST Lot: 5011318-0206 [0130] 6. 1.5 M Phosphoric Acid, MAH Lot 5011318-0219,
[0131] Method: [0132] 1. Dilute cIL-22-His to 1 .Math.g/mL in PBS and add 100 .Math.L/well to ELISA plate. Incubate at 2-7° C. overnight. [0133] 2. Wash coated plate(s) 3 times, 200 .Math.L/well/wash with NVSL-PBST using automatic plate washer. [0134] 3. Block ELISA plate with 200 .Math.L of 5% NFDM in NVSL-PBST, seal and incubate at 37° C. for at least 60 minutes. [0135] 4. Wash blocked ELISA plate 3 times, 200 .Math.L/well/wash with NVSL-PBST using automatic plate washer. [0136] 5. Pre-dilute Feza-mAb to 5 .Math.g/mL and 3-fold serially dilute across a dilution plate. Transfer 50 .Math.L of the diluted Feza-mAb to the ELISA plate, seal and incubate at 37° C. with rotation for 30-60 minutes. [0137] 6. Wash plate 3 times, 200 .Math.L/well/wash with NVSL-PBST using automatic plate washer. [0138] 7. Add 100 .Math.l/well 1:2500 diluted anti-human IgG, Fc peroxidase conjugate, seal and incubate at 37° C. for 60 minutes. [0139] 8. Add 100 .Math.l/well of 1-Step™ Ultra TMB-ELISA. Incubate at 25° C. for 10 minutes. [0140] 9. Stop with 100 .Math.l/well 1.5 M Phosphoric acid. [0141] 10. Measure A450 - A540 on spectrophotometer.
[0142] The plot of the binding study is shown in
Example 2 Antibodies to IL-4 Receptor Alpha
[0143] Particularly preferred anti-IL-4 receptor alpha antibodies useful in compositions of the present invention are exemplified by the antibody c152H11VL3-cCLk-s/c152H11VH3-cIgG-Bm and antibody c146E2VL3-cCLk-s/c146E2VH3-cIgG-Bm. The individual light chains (LC) and heavy chains (HC) sequences for these antibodies are provided below.
[0144] c152H11VL3-cCLk-s (light chain): [SEQ ID NO: 4]
TABLE-US-00015 EIVMTQSPASLSLSQEEKVTITCKASQNVGTNVAWYQQKPGQAPKLLIYS ASYRYSGLPDRFSGSGSGTDFSFTISSLEPEDVAEFFCQQYNSYPYTFGQ GTKLEIKRNDAQPAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINVKWKV DGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYLSHELYSCEITHKSL PSTLIKSFQRSECQRVD
[0145] c152H11VH3-cIgG-Bm (heavy chain): [SEQ ID NO: 5]
TABLE-US-00016 EVQLVESGGDLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPDKRLQWVAT ISRGGDYTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCARGT LNNRGFASWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSG YFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPP KPKDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPREEQ FAGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQ PSVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRT TPPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSH SPG
[0146] c146E2VL3-cCLk-s (light chain): [SEQ ID NO: 6]
TABLE-US-00017 DIVLTQTPLSLSVSPGETASIYCRASESVDSYGNSFLNWYQQKPGQPPKL LIYRASNLASEIPDRFSGSGSRTEFTLKISRVEADDAGVYYCQQNYENPR TFGQGTKLEIKRNDAQPAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINV KWKVDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYLSHELYSCEIT HKSLPSTLIKSFQRSECQRVD
[0147] c146E2VH3-cIgG-Bm (heavy chain): [SEQ ID NO: 7]
TABLE-US-00018 EVQLVQSGAEVKKPGASVKVSCKASGYTFARYWMHWMKQAPGAGLDWIGM IHPDSGNINYNERFKTKATLTVDKSTSTAYMELSSLRAGDIAVYYCARQL RNAMDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYF PEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTC NVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKP KDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPREEQFA GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPS VYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTP PQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSP G
[0148] Antibodies against canine IL-4 receptor alpha were tested for their ability to inhibit STAT-6 phosphorylation in DH82 Cell as follows: [0149] Materials [0150] 1. Actively growing DH82 cells [0151] 2. DH82 Cell Growth Media (ATCC® 302003™, Eagle’s Minimum Essential Medium supplied with heat-inactivated fetal bovine serum to a final concentration of 15% w/v) [0152] 3. AlphaLISA p-STAT6 (Tyr641) Assay Kit: Perkin Elmer Catalog: ALSU-PST6-A-HV [0153] 4. Recombinant canine IL-4: R&D Systems, Catalog: 752-CL/CF [0154] 5. Recombinant canine IL-13: R&D Systems, Catalog: 5894-CL/CF [0155] 6. Perkin Elmer Envision [0156] a. Caninized anti-canine IL-4R.sub.α monoclonal antibodies [0157] b. c146E2-H3L3 [0158] c. c152H11-H3L3 [0159] d. c4H3 [0160] Methods [0161] 1. Two tissue culture plates were seeded with 8 × 10.sup.4 DH82 cells per well (200 .Math.L with the density of 4 × 10.sup.5 cells/mL) and incubated at 37° C. overnight. [0162] 2. The test antibodies were pre-diluted to 500 .Math.g/mL and then 3-fold serially diluted in DH82 Cell Growth Media. The media was removed from the cell culture plates and 50 .Math.L/well of the serially diluted test sample were transferred to each plate. [0163] 3. Canine IL-4 was diluted to 5 ng/mL in DH82 Cell Growth Media and 50 .Math.L was added to each well of one plate. Canine IL-13 was diluted to 10 ng/mL in DH82 Cell Growth Media and 50 .Math.L was added to each well of the second plate. The plates were incubated for 15 min at 37° C. [0164] 4. The media was removed from the plates and 100 .Math.L per well of freshly prepared 1× lysis buffer from the AlphaLISA p-STAT-6 Assay Kit was added to the plate. The plate was agitated on a plate shaker with 350 rpm for 10 minutes at room temperature. [0165] 5. The Acceptor Mix was prepared from the AlphaLISA p-STAT6 Assay Kit and 15 .Math.L per well was added to 30 .Math.L of the cell lysate in 96-well ½ Area Plates. The plates were sealed, agitated for 2 minutes at 350 rpm, and then incubated for 2 hours at room temperature. [0166] 6. The Donor Mix was prepared from the AlphaLISA p-STAT6 Assay kit under subdued laboratory lighting and 15 .Math.L per well was added to each plate. The plates were sealed, covered with foil, agitated for 2 minutes at 350 rpm, and then incubated for 2 hours at room temperature. [0167] 7. The plates were read using the AlphaScreen settings on the Perkin Elmer EnVison.
[0168] Three different caninized monoclonal anti-canine IL-4R.sub.α antibodies designated c4H3 [WO2016/156588], c146E2-H3L3, and c152H11-H3L3 were evaluated for their ability to inhibit αSTAT-6 phosphorylation by blocking the binding of either canine IL-4 or canine IL-13 to canine IL-4R.sub.α. The data shown in
Example 3 Canine IL-31 Receptor Alpha and Antibodies to IL-31 Receptor Alpha
Nucleotide Sequence
[0169] The nucleotide sequence of SEQ ID NO: 8 encodes the extracellular domain of the canine IL-31 receptor alpha (IL-31RA) fused to a HIS tag comprises. Canine IL-31RA ECD HIS-tagged-protein comprises the amino acid sequence of SEQ ID NO: 9. The nucleotide sequence was prepared by chemical synthesis and then cloned into expression plasmids that are suitable for production of the corresponding proteins in eukaryotic cells, either HEK-293 or CHO cells.
[0170] Canine IL-31RA ECD-10His: [SEQ ID NO: 8]
TABLE-US-00019 gtgctgcccgccaagcccgagaacatcagctgcatcttctactacgagga gaacttcacctgcacctggagccccgagaaggaggccagctacacctggt acaaggtgaagagaacctacagctacggctacaagagcgacatctgcagc accgacaacagcaccagaggcaaccacgccagctgcagcttcctgccccc caccatcaccaaccccgacaactacaccatccaggtggaggcccagaacg ccgacggcatcatgaagagcgacatcacctactggaacctggacgccatc atgaagatcgagccccccgagatcttcagcgtgaagagcgtgctgggcat caagagaatgctgcagatcaagtggatcagacccgtgctggccccccaca gcagcaccctgaagtacaccctgagattcagaaccatcaacagcgcctac tggatggaggtgaacttcaccaaggaggacatcgacagagacgagaccta caacctgaccgagctgcaggccttcaccgagtacgtgatgaccctgagat gcgcccccgccgagagcatgttctggagcggctggagccaggagaaggtg ggcaccaccgaggaggaggccccctacggcctggacctgtggagagtgct gaagcccgccatggtggacggcagaagacccgtgcagctgatgtggaaga aggccaccggcgcccccgtgctggagaaggccctgggctacaacatctgg tacttccccgagaacaacaccaacctgaccgagaccgtgaacaccaccaa ccagacccacgagctgtacctgggcggcaagacctactgggtgtacgtgg tgagctacaacagcctgggcgagagccccgtggccaccctgagaatcccc gccctgaacgagaagaccttccagtgcatcgaggccatgcaggcctgcct gacccaggaccagctggtggtggagtggcagagcagcgcccccgaggtgg acacctggatggtggagtggttccccgacgtggacagcgagcccagcagc ttcagctgggagagcgtgagccaggccagaaactggaccatccagaagga cgagctgaagcccctgtggtgctacaacatcagcgtgtaccccgtgctga gagacagagtgggccagccctacagcacccaggcctacgtgcaggagggc atccccagcgccggccccgtgacccaggccgacagcatcggcgtgaagac cgtgaccatcacctggaaggagatccccaagagcaagagaaacggcttca tcaagaactacaccatcttctaccaggccgaggacggcaaggagttcagc aagaccgtgaacagcaacatcctgcagtacagactggagagcctgaccag aagaaccagctacagcctgcaggtgatggccagcaccaacgccggcggca ccaacggcaccaagatcaacttcaagaccctgagcatcagccaccaccac caccaccaccaccaccaccac
Expression and Purification of IL-31 Receptor Alpha ECD
[0171] Plasmids comprising the nucleotide sequence of SEQ ID NO: 8 were transfected into HEK-293 or CHO cells using electroporation via the MaxCyte instrument as per the manufacturer’s recommendation. Several days following transfection, the supernatants of transfected cells and un-transfected controls were harvested and spun down to remove cellular debris. IL-31RA with the histidine tag were purified from cell culture fluids by passing the clarified harvested fluid from transfected cells over nickel columns as per the manufacturer’s recommendation. Purified proteins were quantified by measuring their absorbance of ultraviolet light at 280 nm.
[0172] canine IL-31RA ECD-10His: [SEQ ID NO: 9]
TABLE-US-00020 VLPAKPENISCIFYYEENFTCTWSPEKEASYTWYKVKRTYSYGYKSDICS TDNSTRGNHASCSFLPPTITNPDNYTIQVEAQNADGIMKSDITYWNLDAI MKIEPPEIFSVKSVLGIKRMLQIKWIRPVLAPHSSTLKYTLRFRTINSAY WMEVNFTKEDIDRDETYNLTELQAFTEYVMTLRCAPAESMFWSGWSQEKV GTTEEEAPYGLDLWRVLKPAMVDGRRPVQLMWKKATGAPVLEKALGYNIW YFPENNTNLTETVNTTNQTHELYLGGKTYWVYVVSYNSLGESPVATLRIP ALNEKTFQCIEAMQACLTQDQLVVEWQSSAPEVDTWMVEWFPDVDSEPSS FSWESVSQARNWTIQKDELKPLWCYNISVYPVLRDRVGQPYSTQAYVQEG IPSAGPVTQADSIGVKTVTITWKEIPKSKRNGFIKNYTIFYQAEDGKEFS KTVNSNILQYRLESLTRRTSYSLQVMASTNAGGTNGTKINFKTLSISHHH HHHHHHH
Binding of Canine IL-31RA to Biotinylated Canine IL-31
[0173] 1. Coat immunoplate(s) with IL-31RA proteins by diluting to 10 .Math.g/mL in PBS. Add 100 .Math.L/well. Incubate the plate(s) at 2-7° C. overnight.
[0174] 2. Wash the plates 3 times with 275 .Math.L/well of PBST.
[0175] 3. Block the plates with 200 .Math.L/well of blocking buffer (1% Dry Milk in PBST) for 30-45 minutes at 36 ± 2° C. with gentle shaking (120 ± 20 RPM).
[0176] 4. Wash the plates 3 times with 275 .Math.L/well of PBST.
[0177] 5. Dilute biotinylated IL-31 to 10 ug/mL in 1% NFDM in PBST.
[0178] 6. 3-fold dilute biotinylated IL-31 (at 10 .Math.g/mL) in 1% NFDM in PBST and transfer 100 .Math.L/well to the immunoplate(s). Incubate for 30-45 minutes at 36 ± 2° C. with gentle shaking (120 ± 20 RPM).
[0179] 7. Wash the plates 3 times with 275 .Math.L/well of PBST.
[0180] 8. Dilute HRP-Streptavidin to a final dilution of 1:1000 in 1% NFDM in PBST.
[0181] 9. Add 100 .Math.L/well of HRP-Streptavidin to the immunoplate(s) and incubate for 30-45 minutes at 36 ± 2° C. with gentle shaking (120 ± 20 RPM).
[0182] 10. Wash the plates 3 times with 275 .Math.L/well of PBST.
[0183] 11. Combine equal volumes of pre-warmed TMB 2-Component substrate immediately before use.
[0184] 12. Add 100 .Math.L/well of prepared TMB substrate to the immunoplate(s) and incubate in the dark for 10 to 15 minutes at 36 ± 2° C. with gentle shaking (120 ± 20 RPM).
[0185] 13. Stop the reaction by addition of 100 .Math.L/well of 1 M H.sub.3PO.sub.4.
[0186] 14. Read the plates using a microplate reader at a wavelength of 450 nm with a reference wavelength of 540 nm.
Monoclonal Antibodies Against Canine IL-31 Receptor Alpha
[0187] Monoclonal antibodies against canine IL-31RA were produced by the immunization of 2 Lewis rats multiple times with canine IL-31RA ECD (using 10 .Math.g or 25 .Math.g of antigen/rat each time) over a 3 to 4 weeks period. Following immunization, sera was collected from each rat and tested against canine IL-31RA by ELISA. The lymph node cells of the rat with the highest IL-31RA ECD reactivity were fused with the myeloma SP2/0 cell line to produce hybridomas. Approximately 10 days after the fusion, supernatants from growing hybridomas were screened on IL-31RA ECD protein coated plates by ELISA using the protocol described below. There were approximately 263 clones selected that showed potential binding to IL-31RA in this ELISA, with the majority of clones having an OD> 1.
The Procedure for the ELISA
[0188] 1. Coat 96-well half area plates with IL-31RA (1 .Math.g/mL in PBS buffer), 25 .Math.L/well. Incubate the plates at 4° C. overnight.
[0189] 2. Wash the plates 3 times with PBST (PBS +0.05% Tween 20)
[0190] 3. Block the plates with blocking buffer (PBS with 5% FBS), 25 ul/well for 30 minutes at room temperature.
[0191] 4. Transfer 25 ul/well hybridoma supernatant to the 96-well plates, incubate 60 minutes at room temperature.
[0192] 5. Wash the plates 3 times by PBST.
[0193] 6. Add 25 ul/well anti-rat HRP, 1:4000 dilution in blocking buffer, to the plates and incubate 60 minutes at room temperature.
[0194] 7. Wash the plates 5 times by PBST.
[0195] 8. Add TMB based reagent to the plates for colorimetric reaction for 2-3 minutes.
[0196] 9. Stop the reactions with 0.16 M sulfuric acid.
[0197] 10. Read the plates by plate reader.
Blocking Activity of Anti-IL-31 Receptor Alpha Antibodies
[0198] The ability of anti-canine IL-31RA hybridoma supernatants to block binding of IL-31 to IL-31RA were evaluated in the blocking ELISA described below. Out of 263 clones that showed binding to IL-31RA, approximately 24 clones showed potential blocking of IL-31 binding to IL-31RA. [0199] 1. Coat 96-well half area plates with IL-31RA (1 .Math.g/mL in PBS buffer), 25 .Math.L/well. Incubate the plates at 4° C. overnight. [0200] 2. Wash the plates 3 times by PBST (PBS +0.05% Tween 20) [0201] 3. Block the plates with blocking buffer (PBS with 5% FBS), 25 ul/well, for 30 minutes at room temperature. [0202] 4. Transfer 25 ul/well hybridoma supernatant to the 96-well plates, incubate 60 minutes at room temperature. [0203] 5. Wash the plates 3 times with PBST. [0204] 6. Transfer 25 .Math.L/well of biotinylated IL31 (0.5 .Math.g/mL in blocking buffer,) incubate 60 minutes at room temperature. [0205] 7. Wash the plates 3 times with PBST. [0206] 8. Add 25 .Math.l/well Streptavidin-HRP, 1:5000 dilution in blocking buffer, to the plates and incubate 60 minutes at room temperature. [0207] Wash the plates five (5) times with PBST. [0208] Add TMB based reagent to the plates for colorimetric reaction for 2-3 minutes. [0209] Stop the reactions with 0.16 M sulfuric acid. [0210] Read the plates by plate reader.
Biological Activity of Anti-IL-31RA Antibodies
[0211] The ability of the anti-IL-3 1RA antibodies to inhibit the activation of STAT-3 is assessed using Baf3 cell lines that are transfected with the nucleotide sequences of the full-length canine IL-31RA chain and the full-length canine oncostatin M receptor (OSMR) chain. This cell line is also transfected with a luciferase reporter gene. The nucleotide sequences of these receptors were prepared by chemical synthesis and then cloned into expression plasmids that are suitable for expression of the corresponding proteins in Baf3 cells.
[0212] The ability of the anti-IL-31 receptor alpha antibodies to inhibit the activation of STAT-3 in Baf3 cells is assessed as follows: [0213] 1. Prepare a cell suspension with a viable cell density of 5 ×10.sup.5 cells/mL and add 200 .Math.L to each well of a 96-well tissue culture plate (1 × 10.sup.5 cells/well). Incubate plates in a humidified 37° C. incubator for 22-24 hours. [0214] 2. Remove media from the plates and add 200 .Math.L Eagle’s Minimum Essential Media (EMEM) to each well of the cell plate. Return the plate to the 37° C. incubator for 2 hours. [0215] 3. Remove media from the cell plate and add 50 .Math.L/well supernatant from an anti-IL-31RA hybridoma grown in PBS. Incubate the plates at 37° C. for 1 hour. Add 50 .Math.L/well of 80 ng/mL cIL-31 diluted in PBS and incubate the plate for 5 min at 37° C. [0216] 4. Remove media from the plate and add 100 .Math.L/well of freshly prepared 1× lysis buffer to all wells. Agitate plate on a plate shaker at 350 rpm for 10 min at room temperature.
[0217] At this point, the cell lysates may be stored frozen at -20° C.
[0218] 5. pSTAT-3 AlphaLISA: [0219] Prepare reagents from AlphaLISA® SureFire® Ultra™ p-STAT3 Assay Kit as per kit instructions. [0220] Transfer 30 .Math.L of the cell lysate to a 96-well half area plate and add 15 .Math.L /well Acceptor Mix to the cell lysate. Seal plate and incubate for 1 hour at room temperature. [0221] Add 15 .Math.L/well of Donor Mix to the cell plate. Seal the plate, cover with foil and incubate for one hour or overnight at room temperature. Note - donor mix is light sensitive. [0222] Read plate on Perkin Elmer EnVison using Alpha Screen Assay settings.
Caninized Antibodies to Canine IL-31 Receptor Alpha (IL-31RA)
[0223] IL-31 receptor alpha C10A12VH1-.sub.CI.sub.GGB.sub.M [SEQ ID NO: 42]
TABLE-US-00021 EVQLVESGGDLVKPGGSLRLSCVASGFTFSNYYMAWVRQAPGKGLQWVAS ISTGGGNTYYRDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAKHG TLYFDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYF PEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTC NVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKP KDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPREEQFA GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPS VYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTP PQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSP GK
[0224] IL-31 receptor alpha C10A12VL5-cCL [SEQ ID NO: 43]
TABLE-US-00022 QPVLTQPPSLSASLGTTARLTCERSSGDIGDSYVSWYQQKPGSPPRDLLY VDDQRPSGVSKSFSGSKDTSANAGLLLISGLQPEDEADYYCQSYDSNIDG PVFGGGTHLTVLGQPKASPSVTLFPPSSEELGANKATLVCLISDFYPSGV TVAWKADGSPVTQGVETTKPSKQSNNKYAASSYLSLTPDKWKSHSSFSCL VTHEGSTVEKKVAPAECS
[0225]
Example 4 Antibodies to Canine IL-31
[0226] Antibodies that may be useful in the current invention are those described in U.S. 9,206,253B2 and U.S. 10,150,810B2. Preferably these antibodies have the following Light chain and Heavy chain sequences:
[0227] Caninized heavy chain sequence from mouse antibody clone M14 and canine IgG-B:
[0228] [SEQ ID NO: 10]
TABLE-US-00023 EVQLVESGPSLVKPGGSLRLTCSVTGDSITSGYWNWIRKFPGNKLEYMGY ISYSGITDYNPSLKSRITISRDTSKNQYYLQLNSVTTEDTATYYCARYGN YGYAMDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGY FPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFT CNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPK PKDTLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFA GTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSV YVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPP QLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSPG K
[0229] Caninized light chain sequence from mouse antibody clone M14 and canine light chain constant region: [SEQ ID NO: 11]
TABLE-US-00024 DIVMTQSPASLSVSLGQRATISCRASESVDTYGNSFMHWYQQKPGQSPKL LIYRASNLESGIPARFGGSGSGTDFTLTIDPVQADDVATYYCQQSYEDPW TFGGGTKLEIKRNDAQPAVYLFQPSPDQLHTGSASWCLLNSFYPKDINVK WKVDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYLSHELYSCEITH KSLPSTLIKSFQRSECQRVD
[0230] Zoe-LC: Caninized light chain sequence: [SEQ ID NO: 12]
TABLE-US-00025 EIVMTQSPASLSLSQEEKVTITCKASQSVSFAGTGLMHWYQQKPGQAPKL LIYRASNLEAGVPSRFSGSGSGTDFSFTISSLEPEDVAVYYCQQSREYPW TFGQGTKLEIKRNDAQPAVYLFQPSPDQLHTGSASVVCLLNSFYPKDINV KWKVDGVIQDTGIQESVTEQDKDSTYSLSSTLTMSSTEYLSHELYSCEIT HKSLPSTLIKSFQRSEC
[0231] Zoe-HC: Caninized heavy chain sequence: [SEQ ID NO: 13]
TABLE-US-00026 EVQLVESGGDLVKPGGSLRLSCVASGFTFSNYGMSWVRQAPGKGLQWVAT ISYGGSYTYYPDNIKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCVRGY GYDTMDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGY FPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFT CNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPK PKDTLLIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAKTQPREEQF NGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQP SVYVLPPSREELSKNTVSLTCLIKDFFPPDIDVEWQSNGQQEPESKYRTT PPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHS PG
Example 5 Bispecific Antibodies
[0232] Bispecific antibodies are artificial molecules that can target two different antigens at the same time. One preferred type of bispecific antibody is an IgG-like antibody that consists of four different polypeptide chains. Examples of bispecific antibodies of the present invention include antibody molecules that target both IL-31RA and IL-4R.sub.α at the same time. Such antibodies are formed by association of one HC and one LC chain with specificity for the IL-4R.sub.α and one HC and one LC with specificity for the IL-31RA. Each of the heavy and light chains are modified with specific substitutions/mutations of their amino acid sequence so as to favor the association of the HC and LC of IL-4R.sub.α antibody with each other and the HC and LC of IL-31RA antibody with each other, and simultaneously favor the association of the HC from IL-4R.sub.α antibody with the HC of the IL-31RA antibody over the association of each HC with itself.
[0233] Canine IgG-B Fc was first defined by Tang et al. [Vet Immunology & Immunopathology, 80: 259-270 (2001)], as comprising the amino acid sequence of SEQ ID NO: 14, provided below.
[0234] Canine IgG-Bm differs from the naturally occurring canine IgG-B by comprising two (2) amino acid residue substitutions, D31A and N63A in the amino acid sequence of SEQ ID NO: 14 of IgG-B, i.e., the aspartic acid residue (D) at position 31 and the asparagine residue (N) at position 63 of SEQ ID NO: 14, are substituted by an alanine residue (A). The location of these residues in the amino acid sequence are indicated in bold and are underlined. These two amino acid residue substitutions serve to significantly diminish the antibody-dependent cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) of the naturally occurring canine IgG-B [see, U.S. 10,106,607 B2, the contents of which are hereby incorporated by reference in their entirety]. A list of amino acid substitutions in antibody HC for favoring HC heterodimer formation are listed in the Table 2A. These substitutions either favor a knobs-into-holes approach to heterodimerization of the heavy chains or favor an electrostatic attraction between different heavy chains also to allow for heterodimerization [for a comprehensive discussion of these amino acid substitutions see, Moore et al., Methods, 154:38-50 (2019) and Brinkmann & Kontermann, MABS, 9:182-212 (2017)]. Within the context of the amino acid substitutions listed in Table 2A below, in some embodiments, chain 1 refers to the anti-IL-31RA heavy chain (HC) and chain 2 refers to the anti-IL-4R.sub.α HC. In other embodiments, chain 1 refers to the anti-IL-4R.sub.α HC and chain 2 refers to the anti-IL-3 1RA HC. In still other embodiments, chain 1 refers to the IL-22 HC and chain 2 refers to the anti-IL-31 HC. In yet other embodiments, chain 1 refers to the anti-IL-31 HC and chain 2 refers to the IL-22 HC.
TABLE-US-00027 AMINO ACID REPLACEMENTS OF CANINE IgG-B Fc SEQ ID NO: 14 Number Chain 1 Chain 2 1 T132W T132S/L134A/Y175V 2 T132W/S120C T132S/L134A/Y175V/Y115C 3 K177D/R160D D167K/E122K 4 S130H/F173A Y115T/T162F 5 F173L K177R 6 T132L/R160L/T162W L117Y/F173A/Y175V 7 K126E/K177W S113R/D167V/F173T 8 K126E/K177W/Y115C S113R/D167V/F173T/S120C 9 K136E/K177W E123N/D167V/F173T 10 K126D/D167M/Y175A Q111R/S113R/T132V/K177V 11 Y115S/K136Y/T132M/K177V E122G/E123D/S 130Q/Y175A 12 L117D/L134E L117K/T132K 13 L134D/K136S E122Q/S130K
TABLE-US-00028 KAPPA AND LAMBDA CROSSOVER SEQUENCES DOMAIN SWAB of CL and CH1 CHAIN JUNCTION SEQUENCE SEQ ID NO. VL.sub.kappa-CH1 (Modified Light Chain) FGQGTKVEIKSSASTTAPSV 45 VH-CL (Modified Heavy Chain) WGQGTTLTVSSASDAQPAV 46 VL.sub.kappa -CH1 (Modified Light Chain) FGQGTKVESKSSASTTAPSV 47 VH-CL (Modified Heavy Chain) WGQGTTLTVSSRNDAQPAV 48 VL.sub.lamda-CH1 (Modified Light Chain) FGGGTHLTVLSSASTTAPSV 49 VH-CL (Modified Heavy Chain) WGQGTTLTVSSGQPKASP 50 FW4 (FR4) of the variable region of VH or VL in slightly enlarged font; a piece of “elbow” sequence that may contain a couple of added amino acids (in Bold); the entire “elbow” sequence is underlined; the N-terminal of the CH1 or CL region are in Italics [see, Klein et al., MABS 8:1010-1020 (2016) and Schaefer, et al., Proc.Nat’l.Acad.Sci.,108: 11187-11192 (2011)].
[0235] The light chains (such as the ones listed above) which are candidates for inclusion into bispecific antibodies can be made suitable for this purpose by incorporating them for example, into antibody domain arrangement that swab the position of the CL domain with the position of the CH1 domain in one of the antibody pairs while leaving the light chain in the other antibody pair of the bispecific un-altered. Other options are also possible such as a swab of the CL-VL domains with CH1-VH domains or a swab of the VL and VH domains in one of the antibody pairs.
[0236] Thus, a Variable Light (VL) domain may be exchanged for the Variable Heavy (VH) domain in a domain swab, i.e., an exchange of one of the various domains for another within the fab fragment of the antibody. In other examples, the CH1 domain may be exchanged for the (Constant Light) CL domain, resulting in a VL-CH1 and a VH-CL1. Table 2B provides examples of: (i) amino acid sequences at the juncture of the VH-CL domains and (ii) amino acid sequences at the juncture of the VL-CH1 domains following such a domain swab. In another instance the entire fab fragment could be exchanged such that VH-CH1 domains are exchanged for VL-CL domains.
[0237] Accordingly, to optimally provide IgG-like bispecific antibodies, two types of modification can be made: a) modify the Fc of the antibodies to favor heterodimerization over homodimerization of the heavy chains, and b) modify the light chains so as to favor the association of each of the two the light chains with its cognate heavy chain. The amino acid substitutions described in Table 2A can be used in the context of chain 1 and chain 2 to modify the Fc. To make the light chains suitable for inclusion in bispecific antibodies, a method that is referred to as cross-mab can be employed [Klein etal.,Methods: 154: 21-23 (2019); Klein et al., MABS, 8:1010-1020 (2016); Schaefer et al., Proc. Nat’l Acad. Sci. 108:11187-11192 (2011)]. Using the cross-mab technology, the light chains (such as the ones of the present invention) which are candidates for inclusion into bispecific antibodies can be made suitable for this purpose by incorporating them for example, into antibody domain arrangement that swab the position of the CL domain with the position of the CH1 domain in one of the antibody pairs while leaving the light chain in the other antibody pair of the bispecific un-altered. Other options are also possible such as a swab of the CL-VL domains with CH1-VH domains or a swab of the VL and VH domains in one of the antibody pairs.
[0238] Examples of modified HC of antibodies of the present invention are:
[0239] Modified HC amino acid of caninized M14: [SEQ ID NO: 15]
TABLE-US-00029 EVQLVESGPSLVKPGGSLRLTCSVTGDSITSGYWNWIRKFPGNKLEYMGY ISYSGITDYNPSLKSRITISRDTSKNQYYLQLNSVTTEDTATYYCARYGN YGYAMDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGY FPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFT CNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPK PKDTLLIARTPEVTCVWDLDPEDPEVQISWFVDGKQMQTAKTQPREEQFA GTYRWSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPSV YVLPPCREELSKNTVSLWCLIKDFFPPDIDVEWQSNGQQEPESKYRTTPP QLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSPG K
[0240] Modified HC of Zoe-HC caninized antibody: [SEQ ID NO: 16]
TABLE-US-00030 EVQLVESGGDLVKPGGSLRLSCVASGFTFSNYGMSWVRQAPGKGLQWVAT ISYGGSYTYYPDNIKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCVRGY GYDTMDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGY FPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFT CNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPK PKDTLLIARTPEVTCVVVDLDPEDPEVQISWFVDGKQMQTAKTQPREEQF NGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQP SVYVLPPCREELSKNTVSLWCLIKDFFPPDIDVEWQSNGQQEPESKYRTT PPQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHS PG
[0241] Modified cFezaVH3-cIgG-Bm [SEQ ID NO: 17]
TABLE-US-00031 EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGAGLDWVGW INPYTGSAFYAQKFRGRVTMTRDTSTSTAYMELSSLRAGDIAVYYCAREP EKFDSDDSDVWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLV SGYFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSE TFTCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIF PPKPKDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPRE EQFAGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQA HQPSVCVLPPSREELSKNTVSLSCAIKDFFPPDIDVEWQSNGQQEPESKY RTTPPQLDEDGSYFLVSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESL SHSPG
[0242] Modified IL-4 receptor alpha c152H11VH3-cIgG-Bm (heavy chain): [SEQ ID NO: 18]
TABLE-US-00032 EVQLVESGGDLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPDKRLQWVAT ISRGGDYTYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCARGT LNNRGFASWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSG YFPEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETF TCNVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPP KPKDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPREEQ FAGTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQ PSVCVLPPSREELSKNTVSLSCAIKDFFPPDIDVEWQSNGQQEPESKYRT TPPQLDEDGSYFLVSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSH SPG
[0243] Modified IL-4 receptor alpha c146E2VH3-cIgG-Bm: (heavy chain): [SEQ ID NO: 19]
TABLE-US-00033 EVQLVQSGAEVKKPGASVKVSCKASGYTFARYWMHWMKQAPGAGLDWIGM IHPDSGNINYNERFKTKATLTVDKSTSTAYMELSSLRAGDIAVYYCARQL RNAMDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYF PEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTC NVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKP KDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPREEQFA GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPS VCVLPPSREELSKNTVSLSCAIKDFFPPDIDVEWQSNGQQEPESKYRTTP PQLDEDGSYFLVSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSP G
[0244] Modified IL-31 receptor alpha caninized heavy chain 10A12VH1-CIGGBM [SEQ ID NO: 44]
TABLE-US-00034 EVQLVESGGDLVKPGGSLRLSCVASGFTFSNYYMAWVRQAPGKGLQWVAS ISTGGGNTYYRDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAMYYCAKHG TLYFDYWGQGTLVTVSSASTTAPSVFPLAPSCGSTSGSTVALACLVSGYF PEPVTVSWNSGSLTSGVHTFPSVLQSSGLYSLSSMVTVPSSRWPSETFTC NVAHPASKTKVDKPVPKRENGRVPRPPDCPKCPAPEMLGGPSVFIFPPKP KDTLLIARTPEVTCVVVALDPEDPEVQISWFVDGKQMQTAKTQPREEQFA GTYRVVSVLPIGHQDWLKGKQFTCKVNNKALPSPIERTISKARGQAHQPS VYVLPPCREELSKNTVSLWCLIKDFFPPDIDVEWQSNGQQEPESKYRTTP PQLDEDGSYFLYSKLSVDKSRWQRGDTFICAVMHEALHNHYTQESLSHSP GK
TABLE-US-00035 SEQUENCE LISTING TABLE SEQ ID NO SEQUENCE A.A. N.A. 1 cIL-22: cIL-22-HIS √ 2 Human IL-22: Fezakinumab Heavy chain √ 3 Human IL-22:Fezakinumab Light chain √ 4 cIL-4R.sub.α: c152H11VL3-cCLk-s (LC) √ 5 cIL-4R.sub.α: c152H11VH3-cIgG-Bm (HC) √ 6 cIL-4R.sub.α: c146E2VL3-cCLk-s (LC) √ 7 cIL-4R.sub.α: c146E2VH3-cIgG-Bm (HC) √ 8 cIL-31RA: cIL-31RAECD-10His √ 9 cIL-31RA: cIL-31RAECD-10His √ 10 cIL-31: caninized HC from M14 with cIgG-B √ 11 cIL-31: caninized LC from M14 with cLC constant region √ 12 cIL-31: Zoe-LC: Caninized LC √ 13 cIL-31:Zoe-HC: Caninized HC √ 14 Canine IgG-B √ 15 cIL-31:caninized M14 HC +A.A. substit. to facilitate hetero √ 16 cIL-31:Zoe-HC: cHC + a.a. substit. to facilitate hetero √ 17 cIL-22: Modified cFezaVH3-cIgG-Bm √ 18 cIL-4R.sub.α: Modified c152H11VH3-cIgG-Bm (HC) √ 19 cIL-4R.sub.α: Modified c146E2VH3-cIgG-Bm √ 20 cIL-22: cFezaVL1--cLC √ 21 cIL-22: cFezaVH1-cIgG-Bm √ 22 cIL-22: cFezaVL2--cLC √ 23 cIL-22: cFezaVH2-cIgG-Bm √ 24 cIL-22: cFezaVL3--cLC √ 25 cIL-22: cFezaVH3-cIgG-Bm √ 26 IgG-A Hinge √ 27 IgG-B Hinge √ 28 IgG-C Hinge √ 29 IgG-D modified Hinge √ 30 IL-22 HCDR-1 √ 31 IL-22 HCDR-1 √ 32 IL-22 LCDR-1 √ 33 IL-22 LCDR-1 √ 34 IL-22 HCDR-2 √ 35 IL-22 HCDR-2 √ 36 IL-22 LCDR-2 √ 37 IL-22 LCDR-2 √ 38 IL-22 HCDR-3 √ 39 IL-22 HCDR-3 √ 40 IL-22 LCDR-3 √ 41 IL-22 LCDR-3 √ 42 cIL-31RA: caninized heavy chain 10A12VH1-CIGGBM √ 43 cIL-31RA: caninized light chain c10A12VL5-cCL √ 44 cIL-31RA: modified caninized heavy chain 10A12VH1-CIGGBM √ 45-50 Junction Sequences for light chain swabs of CH1 with CL √
[0245] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.