SUBSTITUTED PHENYL-1H-PYRROLO[2,3-c] PYRIDINE DERIVATIVES
20230250096 · 2023-08-10
Inventors
- Wei Cai (Shanghai, CN)
- Johannes Wilhelmus J. THURING (Antwerpen, BE)
- Fabian Hulpia (Sint-Niklaas, BE)
- Xuedong Dai (Shanghai, CN)
- Ming Li (Shanghai, CN)
- Xiangjun DENG (Shanghai, CN)
- Chao Liang (Shanghai, CN)
- Alicia Tee Fuay Ng (Franklin Park, NJ, US)
- Zhen Sun (Shanghai, CN)
- Zhigao ZHANG (Shanghai, CN)
- Samuel Dominique Demin (Mechelen, BE)
- Natalia Nikolaevna Dyubankova (Heverlee, BE)
- Matthiew Dominique Jouffroy (Berchem, BE)
- Susan Lepri (Antwerpen, BE)
- Nicolas Freddy J. Darville (Linkhout, BE)
- Vineet Pande (Vosselaar, BE)
- Wim Bert Griet Schepens (Sint-katelijne-Waver, BE)
- James Patrick Edwards (Ambler, PA, US)
- Olivier Alexis Georges Querolle (Saint Vigor, FR)
Cpc classification
C07B2200/05
CHEMISTRY; METALLURGY
C07D519/00
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to pharmaceutical agents useful for therapy and/or prophylaxis in a mammal, pharmaceutical composition comprising such compounds, and their use as menin/MLL protein/protein interaction inhibitors, useful for treating diseases such as cancer, including but not limited to leukemia, myelodysplastic syndrome (MDS), and myeloproliferative neoplasms (MPN); and diabetes.
Claims
1. A compound of Formula (I) ##STR00980## or a tautomer or a stereoisomeric form thereof, wherein Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR.sup.q—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═; R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18; —C(═O)—O—C.sub.1-4alkyl-NR.sup.22aR.sup.22b; —C(═O)—O—C.sub.1-4alkyl; ##STR00981## R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl; R.sup.19 represents hydrogen or C.sub.1-6alkyl; or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—, —(CH.sub.2).sub.4— or —(CH.sub.2).sub.5—; Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three O-, S- or N-atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano; R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, —C.sub.1-4alkyl-OH, halo, CF.sub.3, C.sub.3-6cycloalkyl, Het.sup.3, and NR.sup.11cR.sup.11d; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, cyano, and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo and OR.sup.23; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, cyano, and C.sub.1-4alkyl substituted with one, two or three substituents each independently selected from the group consisting of halo and OR.sup.23; R.sup.23 represents hydrogen or C.sub.1-4alkyl optionally substituted with one, two or three halo; R.sup.1b represents hydrogen, F, Cl, or —O—C.sub.1-4alkyl; R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents; R.sup.2 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring; Y and Y.sup.a each independently represent a covalent bond or ##STR00982## n1 is selected from 1 and 2; n2 is selected from 1, 2, 3 and 4; R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-0H, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl; R.sup.q represents hydrogen or C.sub.1-4alkyl; R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl; R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —C(═O)—Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2; R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4; or —C.sub.1-6alkyl-phenyl; R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl-S(═O).sub.2—C.sub.1-4alkyl, and cyano; R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl; Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl, halo, —O—C.sub.1-4alkyl, —CF.sub.3, —OH, —S(═O).sub.2—C.sub.1-4alkyl, and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH—; Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a; R.sup.6 and R.sup.6a are each independently selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10c; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Hetb, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—N(C.sub.1-4alkyl).sub.2, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b and —NH—S(═O).sub.2—C.sub.1-4alkyl; and C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—N(C.sub.1-4alkyl).sub.2, —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl; R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.3a, and Het.sup.6a; Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—C.sub.1-4alkyl; Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.7-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.1, and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-O-1, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b; Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 1l-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O); wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b and C.sub.1-4alkyl; Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl; Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, ##STR00983## and C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b, Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, R.sup.20b, R.sup.22a, and R.sup.22b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl; R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl; R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl; R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl, —O—C.sub.1-4alkyl and C.sub.3-6cycloalkyl; R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1; R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.1, or Het.sup.8; or a pharmaceutically acceptable salt or a solvate thereof.
2. The compound according to claim 1, wherein Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR.sup.q—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═; R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18; ##STR00984## R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl; R.sup.19 represents hydrogen or C.sub.1-6alkyl; Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano; R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and NR.sup.11cR.sup.11d; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano; R.sup.1b represents hydrogen, F or Cl; R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents; R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring; Y and Y.sup.a each independently represent a covalent bond or ##STR00985## n1 and n2 are each independently selected from 1 and 2; R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl; R.sup.q represents hydrogen or C.sub.1-4alkyl; R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl; R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, and Cy.sup.2; R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4; or —C.sub.1-6alkyl-phenyl; R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl-S(═O).sub.2—C.sub.1-4alkyl, and cyano; R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH; Het.sup.2 represents C-linked pyrazolyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a; R.sup.6 and R.sup.6a are each independently selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.B; —S(═O).sub.2—C.sub.1-4alkyl; C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl; R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, Het.sup.3a, and Het.sup.6a; Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b; Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b, and C.sub.1-4alkyl; Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl; Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl, ##STR00986## and C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b; Cy.sup.3 represents C.sub.3-7Cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, and R.sup.20b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl; R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl; R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl; R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1; R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het, Het.sup.1, or Het.sup.8; or a pharmaceutically acceptable salt or a solvate thereof.
3. The compound according to claim 1, wherein Q represents —CHR.sup.y— or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═; R.sup.1a represents hydrogen; halo; —C(═O)—NR.sup.aR.sup.xb; —S(═O).sub.2—R.sup.18, —C(═O)—O—C.sub.1-4alkyl; or ##STR00987## R.sup.18 represents C.sub.1-6alkyl; R.sup.19 represents hydrogen or C.sub.1-6alkyl; or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—, —(CH.sub.2).sub.4— or —(CH.sub.2).sub.5—; R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and —C.sub.1-4alkyl-OH; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, —O—C.sub.1-4alkyl, and C.sub.1-4alkyl substituted with one, two or three OR.sup.3; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —OH substituents; R.sup.23 represents hydrogen or C.sub.1-4alkyl; R.sup.1b represents F or —O—C.sub.1-4alkyl; R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents; R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring; Y and Y.sup.a each independently represent a covalent bond or ##STR00988## R.sup.5 represents hydrogen; n1 is selected from 1 and 2; n2 is selected from 1, 2 and 3; R.sup.y represents hydrogen; R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; C.sup.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —NRR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2; R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl, and —S(═O).sub.2—C.sub.1-4alkyl; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three —O—C.sub.1-4alkyl; Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, C.sub.1-4alkyl, oxo and —OH; Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl; R.sup.6 is selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.6a, Het.sup.6b, and —OH; R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, cyano, —S(═O).sub.2—C.sub.1-4alkyl, and Het.sup.3a; Het.sup.3 and Het.sup.3a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen atom with —(C═O)—C.sub.1-4alkyl; Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo and —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.6b represents a bicyclic N-linked 6- to 1l-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a —C(═O)—C.sub.1-4alkyl; Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three —OH; Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, and C.sub.1-4alkyl; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; and —C(═O)—R.sup.14; R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl; R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl and —O—C.sub.1-4alkyl; R.sup.14 represents —O—C.sub.1-4alkyl.
4. The compound according to claim 1, wherein Q represents —CHR.sup.y—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═; R.sup.1a represents hydrogen; halo; —C(═O)—NR.sup.xaR.sup.xb; or ##STR00989## R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; and C.sub.1-6alkyl; wherein optionally said C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, and —OC.sub.1-4alkyl; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, and —O—C.sub.1-4alkyl; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, and —O—C.sub.1-4alkyl; R.sup.1b represents F; R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents; R.sup.21 represents hydrogen; R.sup.y represents hydrogen; R.sup.5 represents hydrogen; R.sup.3 and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, —OH, Het.sup.1, and Cy.sup.2; R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; R.sup.8a and R.sup.8b are each independently selected from the group consisting of C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one —O—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of oxo and —NR.sup.9aR.sup.9b; R.sup.6 represents Het.sup.4; —C(═O)—NH—R.sup.B; —S(═O).sub.2—C.sub.1-4alkyl; or C.sub.1-6alkyl; R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano; Het.sup.3 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, ##STR00990## R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; and —S(═O).sub.2—C.sub.1-4alkyl.
5. The compound according to claim 4, wherein Q represents —CHR.sup.y—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═; R.sup.1a represents hydrogen; halo; or —C(═O)—NR.sup.xaR.sup.xb; R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen and C.sub.1-6alkyl; R.sup.1b represents F; R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents; R.sup.21 represents hydrogen; R.sup.y represents hydrogen; R.sup.5 represents hydrogen; R.sup.3 and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, Het.sup.1, and Cy.sup.2; R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; R.sup.8a and R.sup.8b are each independently selected from the group consisting of C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one —O—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; R.sup.6 represents Het.sup.4; —C(═O)—NH—R.sup.8; or —S(═O).sub.2—C.sub.1-4alkyl; R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano; Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; and —S(═O).sub.2—C.sub.1-4alkyl; R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl.
6. The compound according to claim 5, wherein Q represents —CHR.sup.y—; R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb; R.sup.xa and Rx represent C.sub.1-6alkyl; R.sup.1b represents F; R.sup.2 represents halo or C.sub.1-4alkyl; R.sup.21 represents hydrogen; R.sup.y represents hydrogen; R.sup.5 represents hydrogen; R.sup.3 is selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2; R.sup.4 represents C.sub.1-6alkyl; in particular isopropyl; R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; R.sup.6 represents Het.sup.4 or —C(═O)—NH—R.sup.B; R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano; Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl; Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; and —S(═O).sub.2—C.sub.1-4alkyl; R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl.
7. The compound according to claim 6, wherein Q represents —CHR.sup.y—; R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb; R.sup.xa and R.sup.xb represent C.sub.1-6alkyl; R.sup.1b represents F; R.sup.2 represents C.sub.1-4alkyl; R.sup.21 represents hydrogen; R.sup.y represents hydrogen; R.sup.5 represents hydrogen; R.sup.3 is selected from the group consisting of Cy.sup.2; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2; R.sup.4 represents C.sub.1-6alkyl; in particular isopropyl; R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8; R.sup.6 represents —C(═O)—NH—R.sup.B; R.sup.8 represents C.sub.1-6alkyl; Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2 wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6 and Het.sup.6a.
8. The compound according to claim 1, wherein Q represents —CHR.sup.y—; R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb; R.sup.xa and R.sup.xb are C.sub.1-6alkyl optionally substituted with 1, 2 or 3 —OH; R.sup.1b represents F; R.sup.2 represents methyl; R.sup.21 represents hydrogen or methyl; Y represents a covalent bond; n1 is 1; n2 is selected from 1 and 2; R.sup.y represents hydrogen; R.sup.3 is selected from C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1 and Cy.sup.2; R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one carbon atom with oxo; R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano; Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one Het.sup.6a.
9. The compound according to claim 1, wherein R.sup.21 represents hydrogen.
10. The compound according to claim 1 wherein R.sup.2 represents methyl.
11. The compound according to claim 1, wherein R.sup.1b represents F.
12. The compound according to claim 1, wherein —Y—R.sup.3 is attached to the nitrogen atom of the ring.
13. The compound according to claim 1, wherein Formula (I) is limited to Formula (I-x): ##STR00991##
14. A compound of Formula (A) ##STR00992## or a tautomer or a stereoisomeric form thereof, wherein L is absent or represents —CH.sub.2— or —CH.sub.2—CH.sub.2—; Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═; R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.1; —C(═O)—O—C.sub.1-4alkyl-NR.sup.22aR.sup.22b; —C(═O)—O—C.sub.1-4alkyl; ##STR00993## R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl; R.sup.19 represents hydrogen or C.sub.1-6alkyl; or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—, —(CH.sub.2).sub.4— or —(CH.sub.2).sub.5—; Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three O-, S- or N-atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, halo or cyano; R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, —C.sub.1-4alkyl-OH, halo, CF.sub.3, C.sub.3-6cycloalkyl, Het.sup.3, and NR.sup.11cR.sup.11d; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, cyano, and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo and OR.sup.23; or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, cyano, and C.sub.1-4alkyl substituted with one, two or three substituents each independently selected from the group consisting of halo and OR.sup.23; R.sup.23 represents hydrogen or C.sub.1-4alkyl optionally substituted with one, two or three halo; R.sup.1b represents hydrogen, F, Cl, or —O—C.sub.1-4alkyl; R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents; R.sup.2a represents hydrogen or C.sub.1-4alkyl; R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.2′ represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring; Y and Y.sup.a each independently represent a covalent bond or ##STR00994## n3 is selected from 0 and 1; n4 is selected from 0, 1, 2 and 3; R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl; R.sup.q represents hydrogen or C.sub.1-4alkyl; R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl; R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —C(═O)—Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2; R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4; or —C.sub.1-6alkyl-phenyl; R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano; or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl —S(═O).sub.2—C.sub.1-4alkyl, and cyano; R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl; Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl, halo, —O—C.sub.1-4alkyl, —CF.sub.3, —OH, —S(═O).sub.2—C.sub.1-4alkyl, and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH; Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a; R.sup.6 and R.sup.6a are each independently selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—N(C.sub.1-4alkyl).sub.2, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—N(C.sub.1-4alkyl).sub.2, —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl; R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.3a, and Het.sup.6a; Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—C.sub.1-4alkyl; Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O)—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10band —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b; Het.sup.6b and Het.sup.6b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b and C.sub.1-4alkyl; Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl; Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl; Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, ##STR00995## and C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b; Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, R.sup.20b, R.sup.22a, and R.sup.22b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl; R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl; R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl; R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl, —O—C.sub.1-4alkyl and C.sub.3-6cycloalkyl; R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1; R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.7, or Het.sup.8; R.sup.24 represents hydrogen or C.sub.1-4alkyl; or a pharmaceutically acceptable salt or a solvate thereof.
15. A pharmaceutical composition comprising a compound as claimed in claim 1, or a pharmaceutically acceptable salt or a solvate thereof and a pharmaceutically acceptable carrier or excipient.
16. (canceled)
17. (canceled)
18. (canceled)
19. (canceled)
20. (canceled)
21. (canceled)
22. A method of treating or preventing cancer in a subject, comprising administering to a subject in need thereof, a therapeutically effective amount of a compound as claimed in claim 1 or a pharmaceutically acceptable salt or a solvate thereof.
23. The method of claim 22 wherein the cancer is selected from leukemias, lymphomas, myelomas or solid tumor cancers such as prostate cancer, lung cancer, breast cancer, pancreatic cancer, colon cancer, liver cancer, melanoma and glioblastoma.
24. A method of treating or preventing leukemia, myelodysplastic syndrome (MDS), and myeloproliferative neoplasms (MPN) in a subject, comprising administering to a subject in need thereof, a therapeutically effective amount of a compound of claim 1 or a pharmaceutically acceptable salt or a solvate thereof.
25. The method of claim 24 wherein the leukemia is selected from acute leukemias, chronic leukemias, myeloid leukemias, myelogeneous leukemias, lymphoblastic leukemias, lymphocytic leukemias, Acute myelogeneous leukemias (AML), Chronic myelogenous leukemias (CML), Acute lymphoblastic leukemias (ALL), Chronic lymphocytic leukemias (CLL), T cell prolymphocytic leukemias (T-PLL), Large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemias, MLL-PTD leukemias, MLL amplified leukemias, MLL-positive leukemias, and leukemias exhibiting HOX/MEIS1 gene expression signatures.
26. The method of claim 24 wherein the leukemia is (NPM1)-mutated leukemia.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0142] The summary, as well as the following detailed description, is further understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, there are shown in the drawings exemplary embodiments of the invention; however, the invention is not limited to the specific disclosure of the drawings. In the drawings:
[0143]
[0144]
[0145]
[0146]
DETAILED DESCRIPTION OF THE INVENTION
[0147] The term ‘halo’ or ‘halogen’ as used herein represents fluoro, chloro, bromo and iodo.
[0148] The prefix ‘C.sub.x-y’ (where x and y are integers) as used herein refers to the number of carbon atoms in a given group. Thus, a C.sub.1-6alkyl group contains from 1 to 6 carbon atoms, and so on.
[0149] The term ‘C.sub.1-4alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 4 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, 1-butyl and the like.
[0150] Similar, the term ‘C.sub.1-6alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 6 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, t-butyl, n-pentyl, n-hexyl and the like.
[0151] Similar, the term ‘C.sub.1-8alkyl’ as used herein as a group or part of a group represents a straight or branched chain saturated hydrocarbon radical having from 1 to 8 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, s-butyl, t-butyl, n-pentyl, n-hexyl,
##STR00009##
and the like.
[0152] The term ‘C.sub.3-6cycloalkyl’ as used herein as a group or part of a group defines a saturated, cyclic hydrocarbon radical having from 3 to 6 carbon atoms, such as cyclopropyl, cyclobutyl, cyclopentyl and cyclohexyl.
[0153] The term ‘C.sub.3-7cycloalkyl’ as used herein as a group or part of a group defines a saturated, cyclic hydrocarbon radical having from 3 to 7 carbon atoms, such as cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl and cycloheptyl.
[0154] It will be clear for the skilled person that S(═O).sub.2 or SO.sub.2 represents a sulfonyl moiety.
[0155] It will be clear for the skilled person that CO or C(═O) represents a carbonyl moiety.
[0156] It will be clear for the skilled person that a group such as —NR— represents
##STR00010##
An example of such a group is —NR.sup.q—.
[0157] Non-limiting examples of ‘monocyclic 5- or 6-membered aromatic rings containing one, two or three nitrogen atoms and optionally a carbonyl moiety’, include, but are not limited to pyrazolyl, imidazolyl, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, triazinyl or 1,2-dihydro-2-oxo-4-pyridinyl.
[0158] The skilled person will understand that a monocyclic 5- or 6-membered aromatic ring containing one, two or three nitrogen atoms and a carbonyl moiety includes, but is not limited to
##STR00011##
[0159] The term ‘monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N’, defines a fully or partially saturated, cyclic hydrocarbon radical having from 4 to 7 ring members and containing at least 1 nitrogen atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, which is attached to the remainder of the molecule of formula (I) via a nitrogen atom. Examples are N-linked azetidinyl, N-linked pyrrolidinyl, N-linked morpholinyl, N-linked thiomorpholinyl, N-linked piperazinyl, N-linked 1,4-diazepanyl, N-linked piperidinyl, and N-linked 1,2,3,6-tetrahydro-pyridinyl. Two R groups taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, are defined similar.
[0160] The term ‘monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N’, defines a fully or partially saturated, cyclic hydrocarbon radical having from 4 to 7 ring members and containing one, two or three heteroatoms each independently selected from O, S, and N, such as for example C-linked azetidinyl, C-linked pyrrolidinyl, C-linked morpholinyl, C-linked tetrahydrofuranyl, C-linked thiolanyl, C-linked oxetanyl, C-linked thietanyl, C-linked tetrahydropyranyl, C-linked tetrahydrothiopyranyl, C-linked piperidinyl, C-linked azepanyl, C-linked 1,3-dioxolanyl, and C-linked 1,2,3,6-tetrahydro-pyridinyl.
[0161] For clarity, the 4- to 7-membered fully or partially saturated heterocyclyls have from 4 to 7 ring members including the heteroatoms.
[0162] Non-limiting examples of ‘monocyclic C-linked 5- or 6-membered aromatic rings containing one, two or three heteroatoms each independently selected from O, S, and N’, include, but are not limited to C-linked pyrazolyl, C-linked imidazolyl, C-linked pyridinyl, C-linked triazolyl, C-linked pyridazinyl, C-linked pyrimidinyl, C-linked oxazolyl, C-linked furanyl, C-linked isothiazolyl, C-linked thiazolyl, C-linked thiadiazolyl, C-linked oxadiazolyl, or C-linked pyrazinyl.
[0163] Within the context of this invention, bicyclic 6- to 11-membered fully or partially saturated heterocyclyl groups, include fused, spiro and bridged bicycles.
[0164] Fused bicyclic groups are two cycles that share two atoms and the bond between these atoms. Spiro bicyclic groups are two cycles that are joined at a single atom.
[0165] Bridged bicyclic groups are two cycles that share more than two atoms.
[0166] Examples of bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, include, but are not limited to
##STR00012## ##STR00013## ##STR00014##
and the like.
[0167] Examples of bicy clic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, include, but are not limited to
##STR00015## ##STR00016## ##STR00017##
and the like.
[0168] Two R groups taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, are defined similar.
[0169] Examples of fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N, include but are not limited to
##STR00018## ##STR00019##
and the like.
[0170] As used herein ‘5- to 12-membered saturated carbobicyclic’ systems define saturated fused, spiro and bridged bicyclic hydrocarbon systems having from 5 to 12 carbon atoms. Examples of 5- to 12-membered saturated carbobicyclic’ systems include, but are not limited to
##STR00020##
and the like.
[0171] Whenever substituents are represented by chemical structure, such as for example
##STR00021##
[0172] ‘----’ represents the bond of attachment to the remainder of the molecule of Formula (I).
[0173] When any variable occurs more than one time in any constituent, each definition is independent.
[0174] When any variable occurs more than one time in any formula (e.g. Formula (I)), each definition is independent.
[0175] It will be clear for a skilled person that when a moiety (for example a heterocyclyl or monocyclic 5- or 6-membered aromatic ring) is substituted with two or more substituents (for example one, two or three substituents) selected from a group, each substituent can be selected independently from said group, even if not explicitly mentioned.
[0176] In general, whenever the term ‘substituted’ is used in the present invention, it is meant, unless otherwise indicated or clear from the context, to indicate that one or more hydrogens, in particular from 1 to 4 hydrogens, more in particular from 1 to 3 hydrogens, preferably 1 or 2 hydrogens, more preferably 1 hydrogen, on the atom or radical indicated in the expression using ‘substituted’ are replaced with a selection from the indicated group, provided that the normal valency is not exceeded, and that the substitution results in a chemically stable compound, i.e. a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture (isolation after a reaction e.g. purification by silica gel chromatography). In a particular embodiment, when the number of substituents is not explicitly specified, the number of substituents is one.
[0177] Combinations of substituents and/or variables are permissible only if such combinations result in chemically stable compounds. ‘Stable compound’ is in this context meant to indicate a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture (isolation after a reaction e.g. purification by silica gel chromatography).
[0178] The skilled person will understand that the term ‘optionally substituted’ means that the atom or radical indicated in the expression using ‘optionally substituted’ may or may not be substituted (this means substituted or unsubstituted respectively).
[0179] When two or more substituents are present on a moiety they may, where possible and unless otherwise indicated or clear from the context, replace hydrogens on the same atom or they may replace hydrogen atoms on different atoms in the moiety.
[0180] Within the context of this invention ‘saturated’ means ‘fully saturated’, if not otherwise specified.
[0181] Unless otherwise specified or clear from the context, aromatic rings and heterocyclyl groups, can be attached to the remainder of the molecule of Formula (I) through any available ring carbon atom (C-linked) or nitrogen atom (N-linked).
[0182] Unless otherwise specified or clear from the context, aromatic rings and heterocyclyl groups, may optionally be substituted, where possible, on carbon and/or nitrogen atoms according to the embodiments. A skilled person will understand that in such a case hydrogens on the carbon and/or nitrogen atoms are replaced by such substituents.
[0183] Unless otherwise specified or clear from the context, variable R.sup.21 and —Y—R.sup.3 can be attached to any carbon or nitrogen atom of the ring to which they are attached, provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring.
[0184] For example in case R.sup.21 represents hydrogen, and —Y—R.sup.3 is attached to the nitrogen atom of the ring in Formula (I), a compound of subformula (I-x) is obtained:
##STR00022##
[0185] In case Y represents a covalent bond in Formula (I), a compound of subformula (I-y) is obtained:
##STR00023##
[0186] In case Y represents
##STR00024##
in Formula (I), a compound of subformula (I-z) is obtained:
##STR00025##
[0187] The term “subject” as used herein, refers to an animal, preferably a mammal (e.g. cat, dog, primate or human), more preferably a human, who is or has been the object of treatment, observation or experiment.
[0188] The term “therapeutically effective amount” as used herein, means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medicinal doctor or other clinician, which includes alleviation or reversal of the symptoms of the disease or disorder being treated.
[0189] The term “composition” is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
[0190] The term “treatment”, as used herein, is intended to refer to all processes wherein there may be a slowing, interrupting, arresting or stopping of the progression of a disease, but does not necessarily indicate a total elimination of all symptoms.
[0191] The term “compound(s) of the (present) invention” or “compound(s) according to the (present) invention” as used herein, is meant to include the compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof.
[0192] As used herein, any chemical formula with bonds shown only as solid lines and not as solid wedged or hashed wedged bonds, or otherwise indicated as having a particular configuration (e.g. R, S) around one or more atoms, contemplates each possible stereoisomer, or mixture of two or more stereoisomers.
[0193] Hereinbefore and hereinafter, the term “compound(s) of Formula (I)” is meant to include the tautomers thereof and the stereoisomeric forms thereof.
[0194] The terms “stereoisomers”, “stereoisomeric forms” or “stereochemically isomeric forms” hereinbefore or hereinafter are used interchangeably.
[0195] The invention includes all stereoisomers of the compounds of the invention either as a pure stereoisomer or as a mixture of two or more stereoisomers.
[0196] Enantiomers are stereoisomers that are non-superimposable mirror images of each other. A 1:1 mixture of a pair of enantiomers is a racemate or racemic mixture.
[0197] Atropisomers (or atropoisomers) are stereoisomers which have a particular spatial configuration, resulting from a restricted rotation about a single bond, due to large steric hindrance. All atropisomeric forms of the compounds of Formula (I) are intended to be included within the scope of the present invention.
[0198] Diastereomers (or diastereoisomers) are stereoisomers that are not enantiomers, i.e. they are not related as mirror images. If a compound contains a double bond, the substituents may be in the E or the Z configuration.
[0199] Substituents on bivalent cyclic saturated or partially saturated radicals may have either the cis- or trans-configuration; for example if a compound contains a disubstituted cycloalkyl group, the substituents may be in the cis or trans configuration.
[0200] Therefore, the invention includes enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof, whenever chemically possible.
[0201] The meaning of all those terms, i.e. enantiomers, atropisomers, diastereomers, racemates, E isomers, Z isomers, cis isomers, trans isomers and mixtures thereof are known to the skilled person.
[0202] The absolute configuration is specified according to the Cahn-Ingold-Prelog system. The configuration at an asymmetric atom is specified by either R or S. Resolved stereoisomers whose absolute configuration is not knon can be designated by (+) or (−) depending on the direction in which they rotate plane polarized light. For instance, resolved enantiomers whose absolute configuration is not known can be designated by (+) or (−) depending on the direction in which they rotate plane polarized light.
[0203] When a specific stereoisomer is identified, this means that said stereoisomer is substantially free, i.e. associated with less than 50%, preferably less than 20%, more preferably less than 10%, even more preferably less than 5%, in particular less than 2% and most preferably less than 1%, of the other stereoisomers. Thus, when a compound of Formula (I) is for instance specified as (R), this means that the compound is substantially free of the (S) isomer; when a compound of Formula (I) is for instance specified as E, this means that the compound is substantially free of the Z isomer; when a compound of Formula (I) is for instance specified as cis, this means that the compound is substantially free of the trans isomer.
[0204] Some of the compounds according to Formula (I) may also exist in their tautomeric form. Such forms in so far as they may exist, although not explicitly indicated in the above Formula (I) are intended to be included within the scope of the present invention. It follows that a single compound may exist in both stereoisomeric and tautomeric form.
[0205] Pharmaceutically acceptable salts include acid addition salts and base addition salts. Such salts may be formed by conventional means, for example by reaction of a free acid or a free base form with one or more equivalents of an appropriate base or acid, optionally in a solvent, or in a medium in which the salt is insoluble, followed by removal of said solvent, or said medium, using standard techniques (e.g. in vacuo, by freeze-drying or by filtration). Salts may also be prepared by exchanging a counter-ion of a compound of the invention in the form of a salt with another counter-ion, for example using a suitable ion exchange resin.
[0206] The pharmaceutically acceptable salts as mentioned hereinabove or hereinafter are meant to comprise the therapeutically active non-toxic acid and base salt forms which the compounds of Formula (I) and solvates thereof, are able to form.
[0207] Appropriate acids comprise, for example, inorganic acids such as hydrohalic acids, e.g. hydrochloric or hydrobromic acid, sulfuric, nitric, phosphoric and the like acids; or organic acids such as, for example, acetic, propanoic, hydroxyacetic, lactic, pyruvic, oxalic (i.e. ethanedioic), malonic, succinic (i.e. butanedioic acid), maleic, fumaric, malic, tartaric, citric, methanesulfonic, ethanesulfonic, benzenesulfonic, p-toluenesulfonic, cyclamic, salicylic, p-aminosalicylic, pamoic and the like acids. Conversely said salt forms can be converted by treatment with an appropriate base into the free base form.
[0208] The compounds of Formula (I) and solvates thereof containing an acidic proton may also be converted into their non-toxic metal or amine salt forms by treatment with appropriate organic and inorganic bases.
[0209] Appropriate base salt forms comprise, for example, the ammonium salts, the alkali and earth alkaline metal salts, e.g. the lithium, sodium, potassium, cesium, magnesium, calcium salts and the like, salts with organic bases, e.g. primary, secondary and tertiary aliphatic and aromatic amines such as methylamine, ethylamine, propylamine, isopropylanine, the four butylamine isomers, dimethylamine, diethylamine, diethanolamine, dipropylamine, diisopropylamine, di-n-butylamine, pyrrolidine, piperidine, morpholine, trimethylamine, triethylamine, tripropylamine, quinuclidine, pyridine, quinoline and isoquinoline; the benzathine, N-methyl-D-glucamine, hydrabamine salts, and salts with amino acids such as, for example, arginine, lysine and the like. Conversely the salt form can be converted by treatment with acid into the free acid form.
[0210] The term “prodrug” includes any compound that, following oral or parenteral administration, in particular oral administration, is metabolised in vivo to a (more) active form in an experimentally-detectable amount, and within a predetermined time (e.g. within a dosing interval of between 0.5 and 24 hours, or e.g. within a dosing interval of between 6 and 24 hours (i.e. once to four times daily)). For the avoidance of doubt, the term “parenteral” administration includes all forms of administration other than oral administration, in particular intravenous (IV), intramuscular (IM), and subcutaneous (SC) injection.
[0211] Prodrugs may be prepared by modifying functional groups present on a compound in such a way that the modifications are cleaved in vivo when such prodrug is administered to a mammalian subject. The modifications typically are achieved by synthesising the parent compound with a prodrug substituent. In general, prodrugs include compounds wherein a hydroxyl, amino, sulfhydryl, carboxy or carbonyl group is bonded to any group that may be cleaved in vivo to regenerate the free hydroxyl, amino, sulfhydryl, carboxy or carbonyl group, respectively.
[0212] Examples of prodrugs include, but are not limited to, esters and carbamates of hydroxy functional groups, esters groups of carboxyl functional groups, N-acyl derivatives and N-Mannich bases. General information on prodrugs may be found e.g. in Bundegaard, H. “Design of Prodrugs” p. 1-92, Elesevier, New York-Oxford (1985).
[0213] The term solvate comprises the solvent addition forms as well as the salts thereof, which the compounds of Formula (I) are able to form. Examples of such solvent addition forms are e.g. hydrates, alcoholates and the like.
[0214] The compounds of the invention as prepared in the processes described below may be synthesized in the form of mixtures of enantiomers, in particular racemic mixtures of enantiomers, that can be separated from one another following art-known resolution procedures. A manner of separating the enantiomeric forms of the compounds of Formula (I), and pharmaceutically acceptable salts, and solvates thereof, involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically. Preferably if a specific stereoisomer is desired, said compound would be synthesized by stereospecific methods of preparation. These methods will advantageously employ enantiomerically pure starting materials.
[0215] The term “enantiomerically pure” as used herein means that the product contains at least 80% by weight of one enantiomer and 20% by weight or less of the other enantiomer. Preferably the product contains at least 90% by weight of one enantiomer and 10% by weight or less of the other enantiomer. In the most preferred embodiment the term “enantiomerically pure” means that the composition contains at least 99% by weight of one enantiomer and 1% or less of the other enantiomer.
[0216] The present invention also embraces isotopically-labeled compounds of the present invention which are identical to those recited herein, but for the fact that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature (or the most abundant one found in nature).
[0217] All isotopes and isotopic mixtures of any particular atom or element as specified herein are contemplated within the scope of the compounds of the invention, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form. Exemplary isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, chlorine and iodine, such as .sup.2H, .sup.3H, .sup.11C, .sup.13C, .sup.14C, .sup.13N, .sup.15O, .sup.17O, .sup.18O, .sup.32P, .sup.33P, .sup.35S, .sup.18F, .sup.36C, .sup.122I, .sup.123I, .sup.125I, .sup.131I, .sup.75Br, .sup.76Br, .sup.77Br and .sup.82Br. Preferably, the isotope is selected from the group of .sup.2H, .sup.3H, .sup.11C, .sup.13C and .sup.18F. Preferably, the isotope is selected from the group of .sup.2H, .sup.3H, .sup.11C and .sup.18F. More preferably, the isotope is .sup.2H, .sup.3H or .sup.13C. More preferably, the isotope is .sup.2H or .sup.13C. More preferably, the isotope is .sup.2H. In particular, deuterated compounds and .sup.13C-enriched compounds are intended to be included within the scope of the present invention. In particular, deuterated compounds are intended to be included within the scope of the present invention.
[0218] Certain isotopically-labeled compounds of the present invention (e.g., those labeled with 3H and NC) may be useful for example in substrate tissue distribution assays. Tritiated (H) and carbon-14 (.sup.14C) isotopes are useful for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e., .sup.2H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances. Positron emitting isotopes such as .sup.15O, .sup.13N, .sup.11C and .sup.18F are useful for positron emission tomography (PET) studies. PET imaging in cancer finds utility in helping locate and identify tumours, stage the disease and determine suitable treatment. Human cancer cells overexpress many receptors or proteins that are potential disease-specific molecular targets. Radiolabelled tracers that bind with high affinity and specificity to such receptors or proteins on tumour cells have great potential for diagnostic imaging and targeted radionuclide therapy (Charron, Carlie L. et al. Tetrahedron Lett. 2016, 57(37), 4119-4127). Additionally, target-specific PET radiotracers may be used as biomarkers to examine and evaluate pathology, by for example, measuring target expression and treatment response (Austin R. et al. Cancer Letters (2016), doi: 10.1016/j.canlet.2016.05.008).
[0219] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0220] Q represents —CHR.sup.y— or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0221] R.sup.1a represents hydrogen; halo; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
[0222] —C(═O)—O—C.sub.1-4alkyl; or
##STR00026##
[0223] R.sup.18 represents C.sub.1-6alkyl;
[0224] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0225] or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—, —(CH.sub.2).sub.4— or —(CH.sub.2).sub.5—;
[0226] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen;
[0227] Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and —C.sub.1-4alkyl-OH;
[0228] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, —O—C.sub.1-4alkyl, and C.sub.1-4alkyl substituted with one, two or three OR.sup.23;
[0229] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —OH substituents;
[0230] R.sup.23 represents hydrogen or C.sub.1-4alkyl;
[0231] R.sup.1b represents F or —O—C.sub.1-4alkyl;
[0232] R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0233] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.1 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0234] Y and Y.sup.a each independently represent a covalent bond or
##STR00027##
[0235] R.sup.5 represents hydrogen;
[0236] n1 is selected from 1 and 2;
[0237] n2 is selected from 1, 2 and 3;
[0238] R.sup.y represents hydrogen;
[0239] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)-Het.sup.6a, —C(═O)-Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2;
[0240] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl, and —S(═O).sub.2—C.sub.1-4alkyl;
[0241] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0242] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three —O—C.sub.1-4alkyl;
[0243] Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b;
[0244] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, C.sub.1-4alkyl, oxo and —OH;
[0245] Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl;
[0246] R.sup.6 is selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl;
[0247] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.6a, Het.sup.6b, and —OH;
[0248] R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, cyano, —S(═O).sub.2—C.sub.1-4alkyl, and Het.sup.3a;
[0249] Het.sup.3 and Het.sup.3a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen atom with —(C═O)—C.sub.1-4alkyl;
[0250] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b:
[0251] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo and —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0252] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a —C(═O)—C.sub.1-4alkyl;
[0253] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three —OH;
[0254] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, and C.sub.1-4alkyl;
[0255] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; and —C(═O)—R.sup.14;
[0256] R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0257] R.sup.10d and R.sup.10c are each independently selected from the group consisting of C.sub.1-4alkyl and —O—C.sub.1-4alkyl;
[0258] R.sup.14 represents —O—C.sub.1-4alkyl;
[0259] and the pharmaceutically acceptable salts and the solvates thereof.
[0260] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0261] Q represents —CHR.sup.y—;
[0262] R.sup.1a represents —C(O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
[0263] —C(═O)—O—C.sub.1-4alkyl; or
##STR00028##
[0264] R.sup.18 represents C.sub.1-6alkyl;
[0265] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0266] or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—, —(CH.sub.2).sub.4— or —(CH.sub.2).sub.5—;
[0267] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen;
[0268] Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and —C.sub.1-4alkyl-OH; [0269] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, —O—C.sub.1-4alkyl, and C.sub.1-4alkyl substituted with one, two or three OR.sup.23;
[0270] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —OH substituents;
[0271] R.sup.23 represents hydrogen or C.sub.1-4alkyl;
[0272] R.sup.1b represents F or —O—C.sub.1-4alkyl;
[0273] R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0274] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sub.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0275] Y and Y.sup.a represent a covalent bond;
[0276] n1 is selected from 1 and 2;
[0277] n2 is selected from 1, 2 and 3;
[0278] R.sup.y represents hydrogen;
[0279] R.sup.3 and R.sup.3a are each independently selected from the group consisting of Het.sup.1; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2;
[0280] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl, and —S(═O).sub.2—C.sub.1-4alkyl;
[0281] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0282] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three —O—C.sub.1-4alkyl;
[0283] Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b;
[0284] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, C.sub.1-4alkyl, oxo and —OH;
[0285] Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl; R.sup.6 is selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl;
[0286] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.6a, Het.sup.6b, and —OH;
[0287] R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, cyano, —S(═O).sub.2—C.sub.1-4alkyl, and Het.sup.3a;
[0288] Het.sup.3 and Het.sup.3a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen atom with —(C═O)—C.sub.1-4alkyl;
[0289] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b;
[0290] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo and —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0291] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a —C(═O)—C.sub.1-4alkyl;
[0292] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three —OH;
[0293] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, and C.sub.1-4alkyl;
[0294] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; and —C(═O)—R.sup.14;
[0295] R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0296] R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl and —O—C.sub.1-4alkyl;
[0297] R.sup.14 represents —O—C.sub.1-4alkyl;
[0298] and the pharmaceutically acceptable salts and the solvates thereof.
[0299] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0300] Q represents —CHR.sup.y—;
[0301] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
[0302] —C(═O)—O—C.sub.1-4alkyl; or
##STR00029##
[0303] R.sup.18 represents C.sub.1-6alkyl;
[0304] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0305] or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—;
[0306] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and —C.sub.1-4alkyl-OH;
[0307] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, —O—C.sub.1-4alkyl, and C.sub.1-4alkyl substituted with one, two or three OR.sup.2;
[0308] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —OH substituents;
[0309] R.sup.23 represents hydrogen or C.sub.1-4alkyl;
[0310] R.sup.1b represents F or —O—C.sub.1-4alkyl;
[0311] R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0312] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0313] Y and Y.sup.a each independently represent a covalent bond;
[0314] n1 is selected from 1 and 2:
[0315] n2 is selected from 1, 2 and 3:
[0316] R.sup.y represents hydrogen;
[0317] R.sup.3 and R.sup.3a are each independently selected from the group consisting of Het.sup.1; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)-Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2;
[0318] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl, and —S(═O).sub.2—C.sub.1-4alkyl;
[0319] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0320] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three —O—C.sub.1-4alkyl;
[0321] Ar.sup.1 represents phenyl optionally substituted with one, two or three —C(═O)—NR.sup.10aR.sup.10b.
[0322] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, C.sub.1-4alkyl, oxo and —OH;
[0323] Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, or pyridazinyl;
[0324] R.sup.6 is selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl;
[0325] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.6a, Het.sup.6b, and —OH;
[0326] R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, cyano and Het.sup.3a;
[0327] Het.sup.3 and Het.sup.3a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen atom with —(C═O)—C.sub.1-4alkyl;
[0328] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b.
[0329] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four halo; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0330] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a —C(═O)—C.sub.1-4alkyl;
[0331] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three —OH;
[0332] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, and C.sub.1-4alkyl; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═)—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; and —C(═O)—R.sup.14;
[0333] R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0334] R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl and —O—C.sub.1-4alkyl;
[0335] R.sup.14 represents —O—C.sub.1-4alkyl;
[0336] and the pharmaceutically acceptable salts and the solvates thereof.
[0337] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0338] Q represents —CHR.sup.y— or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0339] R.sup.1a represents hydrogen; halo; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18.
[0340] —C(═O)—O—C.sub.1-4alkyl;
##STR00030##
[0341] R.sup.18 represents C.sub.1-6alkyl;
[0342] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0343] or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—;
[0344] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and —C.sub.1-4alkyl-OH;
[0345] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of OR.sup.23;
[0346] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —OH substituents;
[0347] R.sup.23 represents hydrogen or C.sub.1-4alkyl;
[0348] R.sup.1b represents F;
[0349] R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0350] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0351] Y and Y.sup.a each independently represent a covalent bond or
##STR00031##
[0352] n1 is selected from 1 and 2;
[0353] n2 is selected from 1, 2 and 3;
[0354] R.sup.y represents hydrogen;
[0355] R.sup.5 represents hydrogen;
[0356] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl,
[0357] —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2;
[0358] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0359] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0360] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one —O—C.sub.1-4alkyl;
[0361] Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b;
[0362] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, C.sub.1-4alkyl, oxo, and —OH;
[0363] Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl;
[0364] R.sup.6 is selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a; —C(═O)—NR.sup.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl;
[0365] C.sub.1-6alkyl optionally substituted with one or two —OH substituents; and
[0366] C.sub.3-6cycloalkyl;
[0367] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, cyano, —S(═O).sub.2—C.sub.1-4alkyl, and Het.sup.3a;
[0368] Het.sup.3 and Het.sup.3a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with
[0369] —(C═O)—C.sub.1-4alkyl;
[0370] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl and —C(═O)—NR.sup.10aR.sup.10b;
[0371] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo and —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0372] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a —C(═O)—C.sub.1-4alkyl;
[0373] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three —OH;
[0374] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, and C.sub.1-4alkyl;
[0375] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl; and —C(═O)—R.sup.14;
[0376] R.sup.10a, R.sup.10b and R.sup.10c are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0377] R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl and —O—C.sub.1-4alkyl;
[0378] R.sup.14 represents —O—C.sub.1-4alkyl;
[0379] and the pharmaceutically acceptable salts and the solvates thereof.
[0380] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0381] Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR.sup.q—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0382] R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
##STR00032##
[0383] R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl;
[0384] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0385] Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano;
[0386] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and NR.sup.11cR.sup.11d;
[0387] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0388] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0389] R.sup.1b represents hydrogen, F or Cl;
[0390] R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0391] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0392] Y and Y.sup.a each independently represent a covalent bond or
##STR00033##
[0393] n1 and n2 are each independently selected from 1 and 2;
[0394] R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl;
[0395] R.sup.q represents hydrogen or C.sub.1-4alkyl;
[0396] R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl;
[0397] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, and Cy.sup.2;
[0398] R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4; or —C.sub.1-6alkyl-phenyl;
[0399] R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano;
[0400] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0401] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl-S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0402] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl;
[0403] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH;
[0404] Het.sup.2 represents C-linked pyrazolyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a;
[0405] R.sup.6 and R.sup.6a are each independently selected from the group consisting of
[0406] Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.B; —S(═O).sub.2—C.sub.1-4alkyl;
[0407] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl,
[0408] —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and
[0409] C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl,
[0410] —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl;
[0411] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, Het.sup.3a, and Het.sup.6a;
[0412] Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl;
[0413] Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b; Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo,
[0414] —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b;
[0415] Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b, and C.sub.1-4alkyl;
[0416] Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl;
[0417] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl;
[0418] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl,
##STR00034##
and
[0419] C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b;
[0420] Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents;
[0421] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14;
[0422] C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and
[0423] C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano;
[0424] R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, and R.sup.20b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0425] R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl;
[0426] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl;
[0427] R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1;
[0428] R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.7, or Het.sup.8;
[0429] and the pharmaceutically acceptable salts and the solvates thereof.
[0430] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0431] Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR.sup.q—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0432] R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
##STR00035##
[0433] R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl;
[0434] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0435] Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano;
[0436] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and NR.sup.11cR.sup.11d;
[0437] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0438] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0439] R.sup.1b represents hydrogen, F or Cl;
[0440] R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0441] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0442] Y and Y.sup.a each independently represent a covalent bond or
##STR00036##
[0443] n1 and n2 are each independently selected from 1 and 2;
[0444] R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl;
[0445] R.sup.q represents hydrogen or C.sub.1-4alkyl;
[0446] R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl;
[0447] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, and Cy.sup.2;
[0448] R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4;
[0449] or —C.sub.1-6alkyl-phenyl;
[0450] R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano;
[0451] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0452] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl-S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0453] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, and —C(═O)—NR.sup.10aR.sup.10b;
[0454] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH;
[0455] Het.sup.2 represents C-linked pyrazolyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a;
[0456] R.sup.6 and R.sup.6a are each independently selected from the group consisting of
[0457] Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —S(═O).sub.2—C.sub.1-4alkyl;
[0458] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and
[0459] C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl,
[0460] —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl;
[0461] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, Het.sup.3a, and Het.sup.6a;
[0462] Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2;
[0463] wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl;
[0464] Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b;
[0465] Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b;
[0466] Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b, and C.sub.1-4alkyl;
[0467] Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl;
[0468] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl;
[0469] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl,
##STR00037##
and
[0470] C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b;
[0471] Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents;
[0472] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen;
[0473] C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14;
[0474] C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and
[0475] C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano;
[0476] R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a and R.sup.20b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0477] R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl;
[0478] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl;
[0479] R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1;
[0480] R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.7, or Het.sup.8;
[0481] and the pharmaceutically acceptable salts and the solvates thereof.
[0482] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0483] Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR.sup.q—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0484] R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
##STR00038##
[0485] R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl;
[0486] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0487] Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano;
[0488] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and NR.sup.11cR.sup.11d;
[0489] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0490] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0491] R.sup.1b represents hydrogen, F or Cl;
[0492] R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0493] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0494] Y and Y.sup.a each independently represent a covalent bond or
##STR00039##
[0495] n1 and n2 are each independently selected from 1 and 2;
[0496] R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl;
[0497] R.sup.q represents hydrogen or C.sub.1-4alkyl;
[0498] R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl;
[0499] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, and Cy.sup.2;
[0500] R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4;
[0501] or —C.sub.1-6alkyl-phenyl;
[0502] R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano;
[0503] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0504] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl-S(═O).sub.2—C.sub.1-4alkyl, and cyano; R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl;
[0505] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH;
[0506] Het.sup.2 represents C-linked pyrazolyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a;
[0507] R.sup.6 and R.sup.6a are each independently selected from the group consisting of
[0508] Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.B; —S(═O).sub.2—C.sub.1-4alkyl;
[0509] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl,
[0510] —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and
[0511] C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl,
[0512] —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl;
[0513] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, Het.sup.3a, and Het.sup.6a;
[0514] Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2;
[0515] wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl;
[0516] Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b;
[0517] Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b;
[0518] Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b, and C.sub.1-4alkyl;
[0519] Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl;
[0520] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl;
[0521] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7Cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl, C.sub.1-4alkyl C.sub.1-4alkyl
##STR00040##
and
[0522] C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b;
[0523] Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents;
[0524] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14;
[0525] C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano;
[0526] R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, and R.sup.20b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0527] R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl;
[0528] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl;
[0529] R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1;
[0530] R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.7, or Het.sup.8;
[0531] and the pharmaceutically acceptable salts and the solvates thereof.
[0532] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0533] Q represents —CHR.sup.y—, —O—, —C(═O)—, —NR.sup.q—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0534] R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
##STR00041##
[0535] R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl;
[0536] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0537] Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three nitrogen atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano;
[0538] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, and NR.sup.11cR.sup.11d;
[0539] or R.sup.ax and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0540] or R.sup.ax and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, —C.sub.1-4alkyl-O—C.sub.1-4alkyl, and cyano;
[0541] R.sup.1b represents hydrogen, F or Cl;
[0542] R.sup.2 represents C.sub.1-4alkyl; in particular R.sup.2 represents methyl;
[0543] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a; provided that when R.sup.21 represents —Y.sup.a—R.sup.3a, one of —Y.sup.a—R.sup.3a and —Y—R.sup.3 is attached to the nitrogen atom of the ring;
[0544] Y and Y.sup.a each independently represent a covalent bond or
##STR00042##
[0545] n1 and n2 are each independently selected from 1 and 2;
[0546] R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl;
[0547] R.sup.q represents hydrogen or C.sub.1-4alkyl;
[0548] R.sup.5 represents hydrogen, C.sub.1-4alkyl, or C.sub.3-6cycloalkyl;
[0549] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b,
[0550] —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, and Cy.sup.2;
[0551] R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4; or —C.sub.1-6alkyl-phenyl;
[0552] R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano;
[0553] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0554] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl —S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0555] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl;
[0556] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH;
[0557] Het.sup.2 represents C-linked pyrazolyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a;
[0558] R.sup.6 and R.sup.6a are each independently selected from the group consisting of
[0559] Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.B; —S(═O).sub.2—C.sub.1-4alkyl;
[0560] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b, Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and
[0561] C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl,
[0562] —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl;
[0563] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, Het.sup.3a, and Het.sup.6a;
[0564] Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl;
[0565] Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b, —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b;
[0566] Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo,
[0567] —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sub.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b;
[0568] Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b, and C.sub.1-4alkyl;
[0569] Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, and C.sub.1-4alkyl;
[0570] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl;
[0571] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl,
##STR00043##
and
[0572] C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b;
[0573] Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents;
[0574] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14;
[0575] C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano;
[0576] R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, and R.sup.20b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0577] R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl;
[0578] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl;
[0579] R.sup.14 represents Het.sup.8a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1;
[0580] R.sup.16 represents —C(═O)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.7, or Het.sup.8; and the pharmaceutically acceptable salts and the solvates thereof.
[0581] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0582] Q represents —CHR.sup.y—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0583] R.sup.1a represents hydrogen; halo; —C(═O)—NR.sup.xaR.sup.xb; or
##STR00044##
[0584] R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl;
[0585] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0586] R.sup.ax and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; and C.sub.1-6alkyl; wherein optionally said C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, and —OC.sub.1-4alkyl; or R.sup.ax and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, and —O—C.sub.1-4alkyl;
[0587] or R.sup.ax and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, and —O—C.sub.1-4alkyl;
[0588] R.sup.1b represents F;
[0589] R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0590] R.sup.21 represents hydrogen;
[0591] Y represents a covalent bond or
##STR00045##
[0592] n1 and n2 are each independently selected from 1 and 2;
[0593] R.sup.y represents hydrogen;
[0594] R.sup.5 represents hydrogen;
[0595] R.sup.3 and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Cy.sup.2;
[0596] C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, —OH, Het.sup.1, and Cy.sup.2;
[0597] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0598] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0599] R.sup.8a and R.sup.8b are each independently selected from the group consisting of C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one —O—C.sub.1-4alkyl;
[0600] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of oxo and —NR.sup.9aR.sup.9b;
[0601] R.sup.6 represents Het.sup.4; —C(═O)—NH—R.sup.8; —S(═O).sub.2—C.sub.1-4alkyl; or C.sub.1-6alkyl;
[0602] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano;
[0603] Het.sup.3 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N;
[0604] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b;
[0605] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0606] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0607] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b,
##STR00046##
[0608] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen;
[0609] C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; and —S(═O).sub.2—C.sub.1-4alkyl;
[0610] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl;
[0611] and the pharmaceutically acceptable salts and the solvates thereof.
[0612] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0613] Q represents —CHR.sup.y—, or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═;
[0614] R.sup.1a represents hydrogen; halo; or —C(═O)—NR.sup.xaR.sup.xb;
[0615] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen and C.sub.1-6alkyl;
[0616] R.sup.1b represents F;
[0617] R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0618] R.sup.21 represents hydrogen;
[0619] Y represents a covalent bond or
##STR00047##
[0620] n1 and n2 are each independently selected from 1 and 2;
[0621] R.sup.y represents hydrogen;
[0622] R.sup.5 represents hydrogen;
[0623] R.sup.3 and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, Het.sup.1, and Cy.sup.2;
[0624] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0625] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0626] R.sup.8a and R.sup.8b are each independently selected from the group consisting of C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one —O—C.sub.1-4alkyl;
[0627] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8;
[0628] R.sup.6 represents Het.sup.4; —C(═O)—NH—R.sup.8; or —S(═O).sub.2—C.sub.1-4alkyl;
[0629] R.sup.8 represents —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano;
[0630] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b;
[0631] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two —S(═O).sub.2—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl;
[0632] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0633] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b;
[0634] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; —C(═O)—C.sub.1-4alkyl; and —S(═O).sub.2—C.sub.1-4alkyl;
[0635] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0636] and the pharmaceutically acceptable salts and the solvates thereof.
[0637] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof wherein
[0638] Q represents —CHR.sup.y—;
[0639] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0640] R.sup.a and R.sup.b represent C.sub.1-6alkyl;
[0641] R.sup.1b represents F;
[0642] R.sup.2 represents halo or C.sub.1-4alkyl;
[0643] R.sup.21 represents hydrogen;
[0644] Y represents a covalent bond or
##STR00048##
[0645] n1 and n2 are each independently selected from 1 and 2;
[0646] R.sup.y represents hydrogen;
[0647] R.sup.5 represents hydrogen;
[0648] R.sup.3 is selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2;
[0649] R.sup.4 represents C.sub.1-6alkyl; in particular isopropyl;
[0650] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0651] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8;
[0652] R.sup.6 represents Het.sup.4 or —C(═O)—NH—R.sup.B;
[0653] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano;
[0654] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b;
[0655] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0656] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0657] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b; R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; and —S(═O).sub.2—C.sub.1-4alkyl;
[0658] R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0659] and the pharmaceutically acceptable salts and the solvates thereof.
[0660] The present invention relates in particular to compounds of Formula (I) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0661] Q represents —CHR.sup.y—;
[0662] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0663] R.sup.xa and R.sup.xb represent C.sub.1-6alkyl;
[0664] R.sup.1b represents F;
[0665] R.sup.2 represents C.sub.1-4alkyl;
[0666] R.sup.21 represents hydrogen;
[0667] Y represents a covalent bond or
##STR00049##
[0668] n1 and n2 are each independently selected from 1 and 2;
[0669] R.sup.y represents hydrogen;
[0670] R.sup.5 represents hydrogen;
[0671] R.sup.3 is selected from the group consisting of Cy.sup.2; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2;
[0672] R.sup.4 represents C.sub.1-6alkyl; in particular isopropyl;
[0673] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl; Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8;
[0674] R.sup.6 represents —C(═O)—NH—R.sup.8;
[0675] R.sup.8 represents C.sub.1-6alkyl;
[0676] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0677] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6 and Het.sup.6a; and the pharmaceutically acceptable salts and the solvates thereof.
[0678] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0679] Q represents —CHR.sup.y—;
[0680] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb,
[0681] R.sup.xa and R.sup.xb are C.sub.1-6alkyl optionally substituted with 1, 2 or 3 —OH; [0682] R.sup.1b represents F; [0683] R.sup.2 represents methyl;
[0684] R.sup.21 represents hydrogen or methyl;
[0685] Y represents a covalent bond;
[0686] n1 is 1;
[0687] n2 is selected from 1 and 2;
[0688] R.sup.y represents hydrogen;
[0689] R.sup.3 is selected from C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xc, Het.sup.1 and Cy.sup.2;
[0690] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0691] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R; and wherein said heterocyclyl is optionally substituted on one carbon atom with oxo;
[0692] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano;
[0693] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom night be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0694] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one Het.sup.6a;
[0695] and the pharmaceutically acceptable salts and the solvates thereof.
[0696] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Q represents —CHR.sup.y— or —CR.sup.y═; the dotted line is an optional additional bond to form a double bond in case Q represents —CR.sup.y═.
[0697] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Q represents —CHR.sup.y—.
[0698] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0699] R.sup.1a represents hydrogen; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
##STR00050##
[0700] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0701] R.sup.1a represents Het; —C(—O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18;
##STR00051##
[0702] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0703] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18; or
##STR00052##
[0704] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb; or
##STR00053##
[0705] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0706] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb.
[0707] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.18 represents C.sub.1-6alkyl.
[0708] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xa and R.sup.xb represent hydrogen or C.sub.1-6alkyl.
[0709] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; and C.sub.1-6alkyl; wherein optionally said C.sub.1-8alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, and —OC.sub.1-4alkyl;
[0710] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, and —O—C.sub.1-4alkyl;
[0711] or R.sup.ax and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, —OH, and —O—C.sub.1-4alkyl.
[0712] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; and C.sub.1-6alkyl; wherein optionally said C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, and —OC.sub.1-4alkyl.
[0713] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xa and R.sup.xb represent C.sub.1-6alkyl.
[0714] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xa and R.sup.xb are taken together.
[0715] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xa and R.sup.xb are not taken together.
[0716] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.1b represents F or Cl.
[0717] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.1b represents F.
[0718] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.2 represents halo, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents.
[0719] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.2 represents halo or C.sub.1-4alkyl.
[0720] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.2 represents C.sub.1-4alkyl.
[0721] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.2 represents methyl.
[0722] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.2 represents methyl; and R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb.
[0723] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Y and Y.sup.a represent a covalent bond.
[0724] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.21 represents hydrogen.
[0725] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.21 represents hydrogen or methyl.
[0726] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0727] R.sup.21 represents hydrogen; and
[0728] Y represents a covalent bond.
[0729] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0730] R.sup.21 represents hydrogen or methyl; and
[0731] Y represents a covalent bond.
[0732] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.21 represents —Y.sup.a—R.sup.3a.
[0733] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.21 represents hydrogen, C.sub.1-6alkyl, C.sub.3-6cycloalkyl, or C.sub.1-6alkyl substituted with 1 substituent selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, and —S(═O).sub.2—C.sub.1-4alkyl.
[0734] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.21 represents C.sub.1-6alkyl, C.sub.3-6cycloalkyl, or C.sub.1-6alkyl substituted with 1 substituent selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —C(═O)—NR.sup.10aR.sup.10b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, and —S(═O).sub.2—C.sub.1-4alkyl.
[0735] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.10c is selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl.
[0736] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0737] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, and Cy.sup.2;
[0738] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl, and —C(═O)—NR.sup.10aR.sup.10b.
[0739] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0740] R.sup.3, R.sup.3a, and R.sup.4 are not C.sub.1-6alkyl substituted with —NR.sup.10b—C(═O)—C.sub.1-4alkyl;
[0741] R.sup.8a and R.sup.8b are not C.sub.1-6alkyl substituted with —NR.sup.10c—C(═O)—C.sub.1-4alkyl.
[0742] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Y represents a covalent bond.
[0743] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Y.sup.a represents a covalent bond.
[0744] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Y represents
##STR00054##
[0745] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Y.sup.a represents
##STR00055##
[0746] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein n1 represents 1, and n2 represents 2.
[0747] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0748] R.sup.4 represents C.sub.1-6alkyl; oxetanyl; tetrahydropyranyl;
##STR00056##
[0749] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.y represents hydrogen.
[0750] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0751] R.sup.4 represents C.sub.1-6alkyl; oxetanyl; tetrahydropyranyl;
##STR00057##
[0752] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.4 represents C.sub.1-6alkyl.
[0753] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.4 represents isopropyl.
[0754] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.4 represents C.sub.1-8alkyl.
[0755] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.4 represents C.sub.1-4alkyl.
[0756] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.5 represents hydrogen.
[0757] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0758] R.sup.3 and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, Het.sup.1, and Cy.sup.2.
[0759] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0760] R.sup.3 is selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2; and
[0761] R.sup.4 represents C.sub.1-6alkyl; in particular isopropyl.
[0762] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0763] R.sup.3 is selected from the group consisting of Cy.sup.2; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2; and
[0764] R.sup.4 represents C.sub.1-6alkyl; in particular isopropyl.
[0765] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0766] R.sup.3 is selected from the group consisting of Het.sup.1; Cy.sup.2; C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2.
[0767] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0768] R.sup.3 is selected from the group consisting of Cy.sup.2; and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1, and Cy.sup.2.
[0769] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —NR.sup.9aR.sup.9b, and —OH.
[0770] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0771] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl; [0772] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl.
[0773] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0774] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of —(C═O)—C.sub.1-4alkyl and —S(═O).sub.2—C.sub.1-4alkyl.
[0775] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xc and R.sup.xd are taken together.
[0776] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.xc and R.sup.xd are not taken together.
[0777] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein fully or partially saturated heterocyclyl groups are limited to fully saturated heterocyclycl groups.
[0778] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0779] Q represents —CHR.sup.y—;
[0780] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb.
[0781] R.sup.1b represents F;
[0782] R.sup.2 represents methyl.
[0783] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0784] R.sup.8a and R.sup.8b are each independently selected from the group consisting of C.sub.1-6alkyl; and C.sub.1-6alkyl substituted with one —O—C.sub.1-4alkyl.
[0785] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0786] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of oxo and —NR.sup.9aR.sup.9b.
[0787] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.6 represents Het.sup.4 or —C(═O)—NH—R.
[0788] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —O—C.sub.1-4alkyl, and cyano.
[0789] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.8 represents C.sub.1-6alkyl.
[0790] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.8 represents methyl.
[0791] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0792] Het.sup.4 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two —C(═O)—NR.sup.10aR.sup.10b.
[0793] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0794] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl.
[0795] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0796] Het.sup.6b represents a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl.
[0797] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0798] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b,
##STR00058##
[0799] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0800] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b,
##STR00059##
[0801] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0802] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one, two, three or four substituents each independently selected from the group consisting of R.sup.6, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b.
[0803] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; and —S(═O).sub.2—C.sub.1-4alkyl.
[0804] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein R.sup.10a and R.sup.10b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl.
[0805] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein when R.sup.xa and R.sup.xb are taken together to form a monocyclic heterocyclyl they represent 1-pyrrolidinyl or 1-piperidinyl, each optionally substituted as defined in any of the other embodiments.
[0806] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein when R.sup.xa and R.sup.xb are taken together to form a bicyclic heterocyclyl they represent
##STR00060##
each optionally substituted as defined in any of the other embodiments.
[0807] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein when R.sup.xc and R.sup.xd are taken together to form a monocyclic heterocyclyl they represent 1-pyrrolidinyl, 1-piperidinyl, or 1-piperazinyl, each optionally substituted as defined in any of the other embodiments.
[0808] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein when R.sup.xc and R.sup.xd are taken together to form a bicyclic heterocyclyl they represent
##STR00061##
optionally substituted as defined in any of the other embodiments.
[0809] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.1 represents
##STR00062##
optionally substituted as defined in any of the other embodiments.
[0810] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.1 represents
##STR00063##
optionally substituted on a nitrogen atom with —C(═O)—C.sub.1-4alkyl.
[0811] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.1 represents
##STR00064##
substituted on a nitrogen atom with —C(═O)—C.sub.1-4alkyl.
[0812] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0813] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a fused or spiro bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH.
[0814] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0815] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a fused or spiro bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of oxo and —NR.sup.9aR.sup.9b.
[0816] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0817] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH.
[0818] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0819] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6 and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of oxo and —NR.sup.9aR.sup.9b.
[0820] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.3 represents
##STR00065##
optionally substituted as defined in any of the other embodiments.
[0821] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.4 represents C-linked pyrazinyl optionally substituted as defined in any of the other embodiments.
[0822] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.6a represents
##STR00066##
optionally substituted as defined in any of the other embodiments.
[0823] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.6a represents
##STR00067##
optionally substituted as defined in any of the other embodiments.
[0824] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.6a represents
##STR00068##
substituted on a nitrogen atom with —C(═O)—C.sub.1-4alkyl.
[0825] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.6b represents
##STR00069##
optionally substituted as defined in any of the other embodiments.
[0826] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Het.sup.6b represents
##STR00070##
substituted on a nitrogen atom with —C(═O)—C.sub.1-4alkyl.
[0827] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein Cy.sup.2 represents C.sub.3-7cycloalkyl,
##STR00071##
optionally substituted as defined in any of the other embodiments.
[0828] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein C.sub.1-8alkyl is limited to C.sub.1-6alkyl, in particular wherein C.sub.1-8alkyl is limited to C.sub.1-4alkyl.
[0829] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein —Y—R.sup.3 is attached to the nitrogen atom of the ring.
[0830] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein
[0831] R.sup.21 is hydrogen, and wherein —Y—R.sup.3 is attached to the nitrogen atom of the ring.
[0832] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-x):
##STR00072##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0833] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-x1):
##STR00073##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0834] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-x2):
##STR00074##
wherein Q represents —CHR.sup.y—, —O—, —C(═O)— or —NR.sup.q—; and wherein the other variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0835] The present invention relates in particular to compounds of Formula (T-x2) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0836] Q represents —CHR.sup.y—, —O—, —C(═O)— or —NR.sup.q—;
[0837] R.sup.1a represents hydrogen; cyano; halo; Het; —C(═O)—NR.sup.xaR.sup.xb; —S(═O).sub.2—R.sup.18; —C(═O)—O—C.sub.1-4alkyl-NR.sup.22aR.sup.22b; —C(═O)—O—C.sub.1-4alkyl;
##STR00075##
[0838] R.sup.18 represents C.sub.1-6alkyl or C.sub.3-6cycloalkyl;
[0839] R.sup.19 represents hydrogen or C.sub.1-6alkyl;
[0840] or R.sup.18 and R.sup.19 are taken together to form —(CH.sub.2).sub.3—, —(CH.sub.2).sub.4— or —(CH.sub.2)—;
[0841] Het represents a monocyclic 5- or 6-membered aromatic ring containing one, two or three O-, S- or N-atoms and optionally a carbonyl moiety; wherein said monocyclic 5- or 6-membered aromatic ring is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, C.sub.3-6cycloalkyl, or cyano;
[0842] R.sup.xa and R.sup.xb are each independently selected from the group consisting of hydrogen; Het.sup.3; C.sub.3-6cycloalkyl; and C.sub.1-6alkyl; wherein optionally said C.sub.3-6cycloalkyl and C.sub.1-6alkyl are substituted with 1, 2 or 3 substituents each independently selected from the group consisting of —OH, —OC.sub.1-4alkyl, —C.sub.1-4alkyl-OH, halo, CF.sub.3, C.sub.3-6cycloalkyl, Het.sup.3, and NR.sup.11cR.sup.11d;
[0843] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, cyano, and C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo and OR.sup.23;
[0844] or R.sup.xa and R.sup.xb are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of C.sub.1-4alkyl, halo, —OH, —O—C.sub.1-4alkyl, cyano, and C.sub.1-4alkyl substituted with one, two or three substituents each independently selected from the group consisting of halo and OR.sup.23;
[0845] R.sup.23 represents hydrogen or C.sub.1-4alkyl optionally substituted with one, two or three halo;
[0846] R.sup.1b represents hydrogen, F, Cl, or —O—C.sub.1-4alkyl;
[0847] R.sup.2 represents halo, C.sub.3-6cycloalkyl, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano, or C.sub.1-4alkyl substituted with one, two or three halo substituents;
[0848] R.sup.21 represents hydrogen or —Y.sup.a—R.sup.3a;
[0849] Y and Y.sup.a each independently represent a covalent bond or
##STR00076##
[0850] n1 is selected from 1 and 2;
[0851] n2 is selected from 1, 2, 3 and 4;
[0852] R.sup.y represents hydrogen, —OH, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, or —C.sub.1-4alkyl-O—C.sub.1-4alkyl;
[0853] R.sup.q represents hydrogen or C.sub.1-4alkyl;
[0854] R.sup.5 represents hydrogen. C.sub.1-4alkyl, or C.sub.3-6cycloalkyl;
[0855] R.sup.3, R.sup.3a, and R.sup.4 are each independently selected from the group consisting of Het.sup.1; Het.sup.2; Cy.sup.2; C.sub.1-8alkyl; and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —C(═O)—NR.sup.10aR.sup.10b. —C(═O)—Het.sup.6a, —C(═O)—Het.sup.6b, —NR.sup.10c—C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, —NR.sup.xcR.sup.xd, —NR.sup.8aR.sup.8b, —CF.sub.3, cyano, halo, —OH, —O—C.sub.1-4alkyl, Het.sup.1, Het.sup.2, Ar.sup.1, and Cy.sup.2;
[0856] R.sup.xc represents Cy.sup.1; Het.sup.5; —C.sub.1-6alkyl-Cy.sup.1; —C.sub.1-6alkyl-Het.sup.3; —C.sub.1-6alkyl-Het.sup.4; or —C.sub.1-6alkyl-phenyl;
[0857] R.sup.xd represents hydrogen; C.sub.1-4alkyl; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, and cyano;
[0858] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0859] or R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 6- to 11-membered bicyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —(C═O)—C.sub.1-4alkyl-S(═O).sub.2—C.sub.1-4alkyl, and cyano;
[0860] R.sup.8a and R.sup.8b are each independently selected from the group consisting of hydrogen; C.sub.1-6alkyl; —(C═O)—C.sub.1-4alkyl; and C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from the group consisting of —OH, cyano, halo, —S(═O).sub.2—C.sub.1-4alkyl, —O—C.sub.1-4alkyl,
[0861] —C(═O)—NR.sup.10aR.sup.10b, and —NR.sup.10c—C(═O)—C.sub.1-4alkyl;
[0862] Ar.sup.1 represents phenyl optionally substituted with one, two or three substituents each independently selected from the group consisting of C.sub.1-4alkyl, halo, —O—C.sub.1-4alkyl, —CF.sub.3, —OH, —S(═O).sub.2—C.sub.1-4alkyl, and —C(═O)—NR.sup.10aR.sup.10b;
[0863] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of R.sup.6, —C(═O)—Cy.sup.1, and —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, Het.sup.6a, Het.sup.6b, C.sub.1-4alkyl, oxo, —NR.sup.9aR.sup.9b and —OH;
[0864] Het.sup.2 represents C-linked pyrazolyl, 1,2,4-oxadiazolyl, pyridazinyl or triazolyl; which may be optionally substituted on one nitrogen atom with R.sup.6a,
[0865] R.sup.6 and R.sup.6a are each independently selected from the group consisting of Het.sup.3; Het.sup.4; —C(═O)—NH—Cy.sup.1; —C(═O)—NH—R.sup.8; —C(═O)—Het.sup.6a, —C(═O)—NR.sub.10dR.sup.10e; —C(═O)—O—C.sub.1-4alkyl; —S(═O).sub.2—C.sub.1-4alkyl;
[0866] C.sub.1-6alkyl optionally substituted with one or two substituents each independently selected from the group consisting of Het.sup.3, Het.sup.4, Het.sup.6a, Het.sup.6b. Cy.sup.1, —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—N(C.sub.1-4alkyl).sub.2, —C(O)—NH—C.sub.1-4alkyl-C.sub.3-6cycloalkyl, —C(═O)—OH, —NR.sup.11aR.sup.11b, and —NH—S(═O).sub.2—C.sub.1-4alkyl; and
[0867] C.sub.3-6cycloalkyl optionally substituted by one or two substituents each independently selected from the group consisting of —CN, —OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl, —C(═O)—N(C.sub.1-4alkyl).sub.2, —NH—S(═O).sub.2—C.sub.1-4alkyl, and C.sub.1-4alkyl optionally substituted with one substituent selected from the group consisting of OH, —O—C.sub.1-4alkyl, —C(═O)—NH—C.sub.1-4alkyl and —NH—S(═O).sub.2—C.sub.1-4alkyl;
[0868] R.sup.8 represents hydrogen, —O—C.sub.1-6alkyl, C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl, halo, cyano, —NR.sup.11aR.sup.11b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.3a, and Het.sup.6a;
[0869] Het.sup.3, Het.sup.3a, Het.sup.5 and Het.sup.5a each independently represent a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one carbon atom with C.sub.1-4alkyl, halo, —OH, —NR.sup.11aR.sup.11b, or oxo; and wherein said heterocyclyl is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—C.sub.1-4alkyl;
[0870] Het.sup.4 and Het.sup.7 each independently represent a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two, three or four heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl or —(C═O)—O—C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —OH, halo, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, C.sub.1-4alkyl-NR.sup.11aR.sup.11b; —NH—C(═O)—C.sub.1-4alkyl, cyano, —COOH, —NH—C(═O)—O—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —NH—C(═O)—NR.sup.10aR.sup.10b, —(C═O)—O—C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, Het.sup.8a, —C.sub.1-4alkyl-Het.sup.8a, Het.sup.8b, Het.sup.9, and —C(═O)—NR.sup.10aR.sup.10b:
[0871] Het.sup.6a, Het.sup.8 and Het.sup.8a each independently represent a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one, two, three or four substituents each independently selected from the group consisting of halo, —OH, oxo,
[0872] —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, —(C═O)—NR.sup.10aR.sup.10b, —O—C.sub.3-6cycloalkyl, —S(═O).sub.2—C.sub.1-4alkyl, cyano, C.sub.1-4alkyl, —C.sub.1-4alkyl-OH, —O—C.sub.1-4alkyl, —O—(C═O)—NR.sup.10aR.sup.10b, and —O—(C═O)—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —(C═O)—NR.sup.10aR.sup.10b.
[0873] Het.sup.6b and Het.sup.8b each independently represent a bicyclic N-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of C.sub.1-4alkyl, —OH, oxo, —(C═O)—NR.sup.10aR.sup.10b, —NH—C(═O)—C.sub.1-4alkyl, —NH—C(═O)—Cy.sup.3, and —O—C.sub.1-4alkyl; and wherein said heterocyclyl is optionally substituted on one nitrogen with a substituent selected from the group consisting of —C(═O)—C.sub.1-4alkyl, —C(═O)—Cy.sup.3, —(C═O)—C.sub.1-4alkyl-OH, —C(═O)—C.sub.1-4alkyl-O—C.sub.1-4alkyl, —C(═O)—C.sub.1-4alkyl-NR.sup.11aR.sup.11b, and C.sub.1-4alkyl;
[0874] Het.sup.9 represents a monocyclic C-linked 5- or 6-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N, or a fused bicyclic C-linked 9- or 10-membered aromatic ring containing one, two or three heteroatoms each independently selected from O, S, and N; wherein said aromatic ring is optionally substituted on one nitrogen atom with C.sub.1-4alkyl; and wherein said aromatic ring is optionally substituted on one or two carbon atoms with in total one or two substituents each independently selected from the group consisting of —Oil, halo, and C.sub.1-4alkyl;
[0875] Cy.sup.1 represents C.sub.3-6cycloalkyl optionally substituted with one, two or three substituents selected from the group consisting of —OH, —NH—C(═O)—C.sub.1-4alkyl, C.sub.1-4alkyl, —NH—S(═O).sub.2—C.sub.1-4alkyl, —S(═O).sub.2—C.sub.1-4alkyl, and —O—C.sub.1-4alkyl;
[0876] Cy.sup.2 represents C.sub.3-7cycloalkyl or a 5- to 12-membered saturated carbobicyclic system; wherein said C.sub.3-7cycloalkyl or said carbobicyclic system is optionally substituted with one, two, three or four substituents each independently selected from the group consisting of halo, R.sup.6, —C(═O)—Het.sup.6a, Het.sup.6a, Het.sup.6b, —NR.sup.9aR.sup.9b, —OH, C.sub.1-4alkyl, —O—C.sub.1-4alkyl, cyano,
##STR00077##
and
[0877] C.sub.1-4alkyl substituted with one or two substituents each independently selected from the group consisting of Het.sup.3a, Het.sup.6a, Het.sup.6b, and —NR.sup.9aR.sup.9b;
[0878] Cy.sup.3 represents C.sub.3-7cycloalkyl; wherein said C.sub.3-7cycloalkyl is optionally substituted with one, two or three halo substituents;
[0879] R.sup.9a and R.sup.9b are each independently selected from the group consisting of hydrogen; C.sub.1-4alkyl; C.sub.3-6cycloalkyl; —C(═O)—C.sub.1-4alkyl; —C(═O)—C.sub.3-6cycloalkyl; —S(═O).sub.2—C.sub.1-4alkyl; Het.sup.5; Het.sup.7; —C.sub.1-4alkyl-R.sup.16; —C(═O)—C.sub.1-4alkyl-Het.sup.3a; —C(═O)—R.sup.14;
[0880] C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano; and
[0881] C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of halo, —OH, —O—C.sub.1-4alkyl, —NR.sup.11aR.sup.11b, and cyano;
[0882] R.sup.11a, R.sup.11b, R.sup.13a, R.sup.13b, R.sup.15a, R.sup.15b, R.sup.17a, R.sup.17b, R.sup.20a, R.sup.20b, R.sup.22a, and R.sup.22b are each independently selected from the group consisting of hydrogen and C.sub.1-4alkyl;
[0883] R.sup.11c and R.sup.11d are each independently selected from the group consisting of hydrogen, C.sub.1-6alkyl, and —C(═O)—C.sub.1-4alkyl;
[0884] R.sup.10a, R.sup.10b and R.sup.10C are each independently selected from the group consisting of hydrogen, C.sub.1-4alkyl, and C.sub.3-6cycloalkyl;
[0885] R.sup.10d and R.sup.10e are each independently selected from the group consisting of C.sub.1-4alkyl, —O—C.sub.1-4alkyl and C.sub.3-6cycloalkyl;
[0886] R.sup.14 represents Het.sup.5a; Het.sup.7; Het.sup.8a; —O—C.sub.1-4alkyl; —C(═O)NR.sup.15aR.sup.15b; C.sub.3-6cycloalkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl and halo; or C.sub.1-4alkyl substituted with one, two or three substituents selected from the group consisting of —O—C.sub.1-4alkyl, —NR.sup.13aR.sup.13b, halo, cyano, —OH, Het.sup.8a, and Cy.sup.1;
[0887] R.sup.16 represents —C(═)—NR.sup.17aR.sup.17b, —S(═O).sub.2—C.sub.1-4alkyl, Het.sup.5, Het.sup.7, or Het.sup.8;
and the pharmaceutically acceptable salts and the solvates thereof.
[0888] The present invention relates in particular to compounds of Formula (I-x2) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0889] Q represents —CHR.sup.y—;
[0890] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0891] R.sup.xa and R.sup.xb are C.sub.1-6alkyl optionally substituted with 1, 2 or 3 —OH;
[0892] R.sup.1b represents F;
[0893] R.sup.2 represents methyl;
[0894] R.sup.21 represents hydrogen or methyl;
[0895] Y represents a covalent bond or
##STR00078##
[0896] R.sup.5 represents hydrogen;
[0897] n1 is 1;
[0898] n2 is selected from 1 and 2;
[0899] R.sup.y represents hydrogen;
[0900] R.sup.3 and R.sup.4 are each independently selected from Het.sup.1, Cy.sup.2, and C.sub.1-8alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1 and Cy;
[0901] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0902] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one carbon atom with oxo; [0903] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano;
[0904] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0905] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one Het.sup.6a;
[0906] and the pharmaceutically acceptable salts and the solvates thereof.
[0907] The present invention relates in particular to compounds of Formula (I-x2) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0908] Q represents —CHR.sup.y—;
[0909] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0910] R.sup.xa and R.sup.xb are C.sub.1-6alkyl optionally substituted with 1, 2 or 3 —OH;
[0911] R.sup.1b represents F;
[0912] R.sup.2 represents methyl;
[0913] R.sup.21 represents hydrogen or methyl;
[0914] Y represents a covalent bond or
##STR00079##
[0915] R.sup.5 represents hydrogen;
[0916] n1 is 1;
[0917] n2 is selected from 1 and 2;
[0918] R.sup.y represents hydrogen;
[0919] R.sup.3 and R.sup.4 are each independently selected from Het.sup.1, Cy.sup.2, and C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1 and Cy.sup.2;
[0920] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0921] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one carbon atom with oxo;
[0922] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano;
[0923] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0924] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one Het.sup.6a; and the pharmaceutically acceptable salts and the solvates thereof.
[0925] The present invention relates in particular to compounds of Formula (I-x2) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0926] Q represents —CHR.sup.y—;
[0927] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0928] R.sup.xa and R.sup.xb are C.sub.1-6alkyl optionally substituted with 1, 2 or 3 —OH;
[0929] R.sup.1b represents F; [0930] R.sup.2 represents methyl;
[0931] R.sup.21 represents hydrogen or methyl;
[0932] Y represents a covalent bond;
[0933] n1 is 1;
[0934] n2 is selected from 1 and 2:
[0935] R.sup.y represents hydrogen;
[0936] R.sup.3 is selected from C.sub.1-6alkyl substituted with one, two, three or four substituents each independently selected from the group consisting of —NR.sup.xcR.sup.xd, Het.sup.1 and Cy;
[0937] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0938] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O)O; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8; and wherein said heterocyclyl is optionally substituted on one carbon atom with oxo;
[0939] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano;
[0940] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to forn S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0941] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one Het.sup.6a; and the pharmaceutically acceptable salts and the solvates thereof.
[0942] The present invention relates in particular to compounds of Formula (I-x2) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0943] Q represents —CHR.sup.y—;
[0944] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0945] R.sup.xa and R.sup.xb are C.sub.1-6alkyl;
[0946] R.sup.1b represents F;
[0947] R.sup.2 represents methyl;
[0948] R.sup.21 represents hydrogen;
[0949] Y represents a covalent bond;
[0950] n1 is 1;
[0951] n2 is selected from 1 and 2;
[0952] R.sup.y represents hydrogen;
[0953] R.sup.3 is selected from C.sub.1-8alkyl substituted with one substituent selected from the group consisting of —NR.sup.xccR.sup.xd, Het.sup.1 and Cy.sup.2;
[0954] R.sup.xc and R.sup.xd are taken together to form together with the N-atom to which they are attached a 4- to 7-membered monocyclic fully or partially saturated heterocyclyl containing one N-atom and optionally one additional heteroatom selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted with one, two or three —(C═O)—C.sub.1-4alkyl;
[0955] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; or a bicyclic C-linked 6- to 11-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8;
[0956] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano;
[0957] Het.sup.6a represents a monocyclic N-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one N-atom and optionally one or two additional heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—C.sub.1-4alkyl;
[0958] Cy.sup.2 represents C.sub.3-7cycloalkyl optionally substituted with one Het.sup.6a; and the pharmaceutically acceptable salts and the solvates thereof.
[0959] The present invention relates in particular to compounds of Formula (I-x2) as defined herein, and the tautomers and the stereoisomeric forms thereof, wherein
[0960] Q represents —CHR.sup.y—;
[0961] R.sup.1a represents —C(═O)—NR.sup.xaR.sup.xb;
[0962] R.sup.xa and R.sup.xb are C.sub.1-8alkyl;
[0963] R.sup.1b represents F;
[0964] R.sup.2 represents methyl;
[0965] R.sup.21 represents hydrogen;
[0966] Y represents a covalent bond;
[0967] n1 is 1;
[0968] n2 is selected from 1 and 2;
[0969] R.sup.7 represents hydrogen;
[0970] R.sup.3 is selected from C.sub.1-4alkyl substituted with one Het.sup.1;
[0971] Het.sup.1 represents a monocyclic C-linked 4- to 7-membered fully or partially saturated heterocyclyl containing one, two or three heteroatoms each independently selected from O, S, and N, wherein said S-atom might be substituted to form S(═O) or S(═O).sub.2; wherein said heterocyclyl is optionally substituted on one nitrogen with —C(═O)—R.sup.8;
[0972] R.sup.8 represents C.sub.1-6alkyl; or C.sub.1-6alkyl substituted with one, two or three substituents each independently selected from —OH, —O—C.sub.1-4alkyl and cyano;
[0973] and the pharmaceutically acceptable salts and the solvates thereof.
[0974] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-y):
##STR00080##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0975] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-y1):
##STR00081##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0976] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-z):
##STR00082##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0977] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-z1):
##STR00083##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0978] In an embodiment, the present invention relates to those compounds of Formula (I) and the pharmaceutically acceptable salts, and the solvates thereof, or any subgroup thereof as mentioned in any of the other embodiments, wherein the compounds of Formula (I) are restricted to compounds of Formula (I-q):
##STR00084##
wherein the variables are as defined for the compounds of Formula (I) or any subgroup thereof as mentioned in any of the other embodiments.
[0979] In an embodiment, the present invention relates to a subgroup of Formula (I) as defined in the general reaction schemes.
[0980] In an embodiment the compound of Formula (I) is selected from the group consisting of any of the exemplified compounds, tautomers and stereoisomeric forms thereof, and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
[0981] In an embodiment the compound of Formula (I) is selected from the group consisting of compounds 4, 8, 8a, 9a, 10, 12, 18a, 18b, 20, 27a, 27d, 32a, 34a, 38b, 43, 51, 51a, 59, 60, 115, 117a, 125, 140, 157, 159, 169a, 207, 228, 258, 262 and 365b.
[0982] In an embodiment the compound of Formula (I) is selected from the group consisting of compounds 4, 8, 8a, 9a, 10, 12, 18a, 18b, 20, 27a, 27d, 32a, 34a, 38b, 43, 51, 51a, 59, 60, 115, 117a, 125, 140, 157, 159, 169a, 207, 228, 258, 262 and 365b;
[0983] tautomers and stereoisomeric forms thereof,
[0984] and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
[0985] The present invention also relates to a pharmaceutical composition comprising a therapeutically effective amount of a compound of Formula (I) and a pharmaceutically acceptable carrier or excipient, wherein the compound of Formula (I) is selected from the group consisting of any of the exemplified compounds.
[0986] The present invention also relates to a pharmaceutical composition comprising a therapeutically effective amount of a compound of Formula (I) and a pharmaceutically acceptable carrier or excipient, wherein the compound of Formula (I) is selected from the group consisting of any of the exemplified compounds, tautomers and stereoisomeric forms thereof, and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
[0987] The present invention also relates to a pharmaceutical composition comprising a therapeutically effective amount of a compound of Formula (I) and a pharmaceutically acceptable carrier or excipient, wherein the compound of Formula (I) is selected from the group consisting of compounds 4, 8, 8a, 9a, 10, 12, 18a, 18b, 20, 27a, 27d, 32a, 34a, 38b, 43, 51, 51a, 59, 60, 115, 117a, 125, 140, 157, 159, 169a, 207, 228, 258, 262 and 365b.
[0988] The present invention also relates to a pharmaceutical composition comprising a therapeutically effective amount of a compound of Formula (I) and a pharmaceutically acceptable carrier or excipient, wherein the compound of Formula (I) is selected from the group consisting of compounds 4, 8, 8a, 9a, 10, 12, 18a, 18b, 20, 27a, 27d, 32a, 34a, 38b, 43, 51, 51a, 59, 60, 115, 117a, 125, 140, 157, 159, 169a, 207, 228, 258, 262 and 365b; tautomers and stereoisomeric forms thereof, and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
[0989] In a particular embodiment, the solvate is a hydrate. In a particular embodiment, the pharmaceutically acceptable salt is a HCl salt. In a particular embodiment, the compound is a HCl salt hydrate.
[0990] In an embodiment the compound of Formula (I) is
##STR00085##
or a pharmaceutically acceptable salt or solvate thereof; in particular a HCl salt, solvate; more in particular a HCl salt, hydrate; more in particular a mono HCl salt, hydrate; even more in particular mono HCl salt, trihydrate.
[0991] All possible combinations of the above indicated embodiments are considered to be embraced within the scope of the invention.
[0992] Any aspects of the invention and embodiments described herein for the compounds of formula (I) as listed herein, also hold for the compounds of formula (A).
[0993] In an embodiment the invention relates to any of the intermediates described herein, tautomers and stereoisomeric forms thereof, and the free bases, any pharmaceutically acceptable salts, and the solvates thereof.
Methods for the Preparation of Compounds of Formula (I)
[0994] In this section, as in all other sections unless the context indicates otherwise, references to Formula (I) also include all other sub-groups and examples thereof as defined herein.
[0995] The general preparation of some typical examples of the compounds of Formula (I) is described hereunder and in the specific examples, and are generally prepared from starting materials which are either commercially available or prepared by standard synthetic processes commonly used by those skilled in the art of organic chemistry. The following schemes are only meant to represent examples of the invention and are in no way meant to be a limit of the invention.
[0996] Alternatively, compounds of the present invention may also be prepared by analogous reaction protocols as described in the general schemes below, combined with standard synthetic processes commonly used by those skilled in the art.
[0997] The skilled person will realize that in the reactions described in the Schemes, although this is not always explicitly shown, it may be necessary to protect reactive functional groups (for example hydroxy, amino, or carboxy groups) where these are desired in the final product, to avoid their unwanted participation in the reactions. In general, conventional protecting groups (PG) can be used in accordance with standard practice. The protecting groups may be removed at a convenient subsequent stage using methods known from the art.
[0998] The skilled person will realize that in the reactions described in the Schemes, it may be advisable or necessary to perform the reaction under an inert atmosphere, such as for example under N.sub.2-gas atmosphere.
[0999] It will be apparent for the skilled person that it may be necessary to cool the reaction mixture before reaction work-up (refers to the series of manipulations required to isolate and purify the product(s) of a chemical reaction such as for example quenching, column chromatography, extraction).
[1000] The skilled person will realize that heating the reaction mixture under stirring may enhance the reaction outcome. In some reactions microwave heating may be used instead of conventional heating to shorten the overall reaction time.
[1001] The skilled person will realize that another sequence of the chemical reactions shown in the Schemes below, may also result in the desired compound of Formula (I).
[1002] The skilled person will realize that intermediates and final compounds shown in the Schemes below may be further functionalized according to methods well-known by the person skilled in the art. The intermediates and compounds described herein can be isolated in free form or as a salt, or a solvate thereof. The intermediates and compounds described herein may be synthesized in the form of mixtures of tautomers and stereoisomeric forms that can be separated from one another following art-known resolution procedures.
General Synthetic Schemes
[1003] All abbreviations used in the general schemes are as defined below or as in the Table in the part Examples. Variables are as defined in the scope or as specifically defined in the general Schemes. Where compounds/intermediates in the schemes below contain a double bond, the substituents may be in the E or the Z configuration or be mixtures thereof.
[1004] In general, compounds of Formula (I-aa), can be prepared according to the following reaction Scheme 1. In Scheme 1, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl, 9-fluorenylmethoxycarbonyl, or benzyl, and LG is a leaving group such as for example chloro, bromo, iodo or tosylate or mesylate or triflate; all other variables are defined according to the scope of the present invention.
##STR00086##
[1005] In Scheme 1, the following reaction conditions apply:
[1006] Step 1: when PG=Boc, at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable acid, for example a protic acid such as trifluoroacetic acid (TFA) or hydrochloric acid, in a suitable solvent such as dichloromethane (DCM) or 1,4-dioxane;
[1007] Alternatively, when PG=9-fluorenylmethoxycarbonyl, at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable base such as piperidine, in a suitable solvent such as dichloromethane (DCM);
[1008] Alternatively, when PG=benzyl, at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, TIF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
Step 2:
[1009] In the case of a reductive amination reaction employing an aldehyde or a ketone: at a suitable temperature in a range between room temperature and 70° C., in the presence of a suitable reducing agent such as for example sodium triacetoxyborohydride or sodium cyanoborohydride, in a suitable solvent such as for example methanol, dichloromethane or 1,2-dichloroethane, optionally in the presence of zinc chloride or sodium acetate or acetic acid;
[1010] In the case of an alkylation reaction employing LG-Y—R.sup.3: at a suitable temperature such as for example room temperature, in the presence of a suitable deprotonating agent such as for example sodium hydride or potassium carbonate, or an amine base such as triethylamine in a suitable aprotic solvent such as for example dimethylformamide or dimethylsulfoxide or acetonitrile.
[1011] In general, compounds of Formula (I) wherein Q is limited to —O—, —NR.sup.q—, can be prepared via intermediates of Formula (VIc). Intermediates of Formula (VIc) can be prepared according to the following reaction Scheme 2. In Scheme 2, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl; all other variables are defined according to the scope of the present invention.
##STR00087##
[1012] In Scheme 2, the following reaction conditions apply:
[1013] Step 1: at a suitable temperature in a range between 100° C. and 140° C., in the presence of a suitable base such as for example potassium tert-butoxide or potassium phosphate, in the presence of a suitable catalyst such as palladium acetate (Pd(OAc).sub.2) or tris(dibenzylideneacetone)dipalladium(0) (Pd.sub.2dba.sub.3) or [1,1′-bis(diphenylphosphino)ferrocene]dichloropalladium(II) (Pd(dppf)Cl.sub.2), in the presence of a suitable ligand such as 9,9-dimethyl-4,5-bis(diphenylphosphino)xanthene (Xantphos), in a suitable solvent such as for example dioxane or dimethylformamide.
[1014] In general, intermediates of Formula (V) can be prepared according to the following reaction Scheme 2B. In Scheme 2B, W.sup.1 represents fluoro, chloro, bromo or iodo, BPin represents 4,4,5,5-tetramethyl-1,3,2-dioxaborolane, and all other variables are defined according to the scope of the present invention.
##STR00088##
[1015] In Scheme 2B, the following reaction conditions apply:
[1016] Step 1: at a suitable temperature in a range between room temperature and 100° C., in the presence of a suitable base such as for example potassium carbonate, in the presence of a suitable catalyst such as [1,1′-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water; Alternatively, when R.sup.2=Me, a boron containing reagent such as trimethyl boroxine can be used in the presence of a suitable catalyst such as (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water in the presence of an inorganic base such as potassium carbonate at a reaction temperature between 80° C. and 120° C.;
[1017] Additional step to achieve the double bond reduction to obtain R.sup.2 is C.sub.3-6cycloalkyl, C.sub.1-4alkyl, or C.sub.1-4alkyl substituted with one, two or three halo substituents: at a suitable temperature such as room temperature, in the presence of a suitable catalyst such as palladium on charcoal (Pd/C), in a suitable solvent such as methanol, under H.sub.2 pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
[1018] Step 2: at a suitable temperature such as for example between 0° C. and room temperature, in the presence of a suitable bronination reagent such as for example N-Bromosuccinimide or CuBr.sub.2, in a suitable solvent such as for example dimethylformamide or acetonitrile;
[1019] Step 3: at a suitable temperature such as for example 80° C. and 130° C., in the presence of a suitable catalyst such as copper (Cu), in the presence of a base such as potassium carbonate, in a suitable solvent such as dimethylformamide; Alternatively a copper (I) source may be used, such as CuI in the presence of a suitable diamine ligand, such as trans-N,N′-dimethylcyclohexane-1,2-diamine in the presence of an inorganic base, such as potassium carbonate in an aprotic solvent such as dimethylformamide at a temperature between 80° C. and 150° C. In certain cases said conversion may also be effected by a nucleophilic aromatic substitution using an inorganic base such as potassium tert-butoxide or sodium hydride or the like, in an aprotic solvent such as dimethylformamide at a temperature between 0° C. and 80° C.;
[1020] Someone skilled in the art will appreciate that the steps 2 and 3 in Scheme 2B may also be reversed, i.e. first the cross coupling of intermediate (III) with the reagent (Va), followed by bromination of the aza indole moiety to provide the intermediate (V).
[1021] In general, intermediates of Formula (VIIa), can be prepared via intermediates of Formula (VIe). Intermediates of Formula (VIe) can also be prepared according to the following reaction Scheme 3. In Scheme 3, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl; all other variables are defined according to the scope of the present invention.
##STR00089##
[1022] In Scheme 3, the following reaction conditions apply:
[1023] Step 1: at a suitable temperature in a range between 70° C. and 100° C., in the presence of a suitable base such as for example potassium phosphate, in presence of a suitable catalyst such as palladium acetate (Pd(OAc).sub.2), optionally in the presence of a suitable phosphine ligand such as 2-dicyclohexylphosphino-2′-(N,N-dimethylamino)biphenyl (Davephos), in a suitable solvent such as for example dioxane or dimethylformamide;
[1024] Step 2: at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, THF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
[1025] In general, intermediates of Formula (IXb) can be prepared according to the following reaction Scheme 4. In Scheme 4 PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl; all other variables are defined according to the scope of the present invention.
##STR00090##
[1026] Step 1: at a suitable temperature such as for example −78° C., in the presence of a suitable deprotonating agent such as for example n-Butyllithium, in presence of a suitable reagent such as 2,2,6,6-Tetramethylpiperidine (HTMP), in a suitable solvent such as tetrahydrofuran;
[1027] In general, compounds of Formula (I-a), can be prepared according to the following reaction Scheme 5. In Scheme 5, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl and LG is a leaving group such as for example chloro, bromo, iodo or tosylate or mesylate or triflate; all other variables are defined according to the scope of the present invention.
##STR00091## ##STR00092##
[1028] In Scheme 5, the following reaction conditions apply:
[1029] Step 1: at a suitable temperature such as for example 100° C., in the presence of a suitable catalyst such as copper (Cu), in the presence of a base such as potassium carbonate, in a suitable solvent such as dimethylformamide; Alternatively a copper (I) source may be used, such as CuI in the presence of a suitable diamine ligand, such as trans-N,N′-dimethylcyclohexane-1,2-diamine, in the presence of an inorganic base, such as potassium carbonate in an aprotic solvent such as dimethylformamide at a temperature between 80° C. and 150° C.;
[1030] Step 2: at a suitable temperature such as for example room temperature, in the presence of a suitable condensation reagent such as 2-(7-Azabenzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HATU), in the presence of a base such as N,N-Diisopropylethylamine (DIPEA), in a suitable solvent such as dimethylformamide; Alternatively the acid chloride may be prepared by reacting intermediate VIII with thionyl chloride optionally in a halogenated solvent such as dichloromethane at a temperature in a range between 0° C. and room temperature. The intermediate acid chloride may then be reacted with the amine HNR.sup.xaR.sup.xb optionally in an aprotic solvent such as dimethylformamide and optionally in the presence of a tertiary amine such as N,N-diisopropylethylamine;
[1031] Step 3: at a suitable temperature in a range between 60° C. and 120° C., such as for example 100° C., in the presence of a suitable base such as for example potassium carbonate, in presence of a suitable catalyst such as [1,1′-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water;
[1032] Step 4: at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, THF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
[1033] Step 5: at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable acid, for example a protic acid such as trifluoroacetic acid (TFA) or hydrochloric acid, in a suitable solvent such as dichloromethane (DCM) or 1,4-dioxane; Step 6:
[1034] In the case of a reductive amination reaction employing an aldehyde or a ketone: at a suitable temperature in a range between room temperature and 70° C., in the presence of a suitable reducing agent such as for example sodium triacetoxyborohydride or sodium cyanoborohydride, in a suitable solvent such as for example methanol, dichloromethane or 1,2-dichloethane, optionally in the presence of zinc chloride or sodium acetate or acetic acid;
[1035] In the case of an alkylation reaction employing LG-Y—R.sup.3: at a suitable temperature such as for example room temperature, in the presence of a suitable deprotonating agent such as for example sodium hydride or potassium carbonate, or an amine base such as triethylamine in a suitable aprotic solvent such as for example dimethylformamide or dimethylsulfoxide or acetonitrile.
[1036] In general, compounds of Formula (I-b) wherein R.sup.1a is limited to —S(═O).sub.2—R.sup.18,
##STR00093##
and Q represents —CHR.sup.y—, can be prepared according to the following reaction Scheme 6. In Scheme 6, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl, 9-fluorenylmethoxycarbonyl, or benzyl; LG is a leaving group such as for example chloro, bromo, iodo or tosylate or mesylate; LGI is a leaving group such as for example fluoro, chloro, bromo, iodo or tosylate or mesylate; all other variables are defined according to the scope of the present invention.
##STR00094## ##STR00095##
[1037] In Scheme 6, the following reaction conditions apply:
[1038] Step 1: at a suitable temperature in a range between 50° C. and 90° C., in the presence of a suitable base such as for example potassium hydroxide or sodium hydroxide, in a suitable solvent, preferably a protic solvent, such as methanol, ethanol or isopropanol.
[1039] Step 2: at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, THF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
[1040] Step 3: at a suitable temperature in a range between 50° C. and 100° C., in the presence of a suitable inorganic base such as for example potassium carbonate or potassium tert-butoxide, in a suitable aprotic solvent such as for example dioxane, dimethylformamide or acetonitrile or dimethylsulfoxide;
[1041] Step 4: when PG=Boc, at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable acid, for example a protic acid such as trifluoroacetic acid or hydrochloric acid, in a suitable solvent such as dichloromethane or 1,4-dioxane;
[1042] Alternatively, when PG=9-Fluorenylmethoxycarbonyl, at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable base such as piperidine, in a suitable solvent such as dichloromethane (DCM);
[1043] Alternatively, when PG=benzyl, at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, THF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
[1044] Step 5: In the case of a reductive amination reaction employing an aldehyde or a ketone: at a suitable temperature in a range between room temperature and 70° C., in the presence of a suitable reducing agent such as for example sodium triacetoxyborohydride or sodium cyanoborohydride, in a suitable solvent such as for example methanol, dichloromethane or 1,2-dichloroethane, optionally in the presence of zinc chloride or sodium acetate or acetic acid;
[1045] In the case of an alkylation reaction employing LG-Y—R.sup.3: at a suitable temperature such as for example room temperature, in the presence of a suitable deprotonating agent such as for example sodium hydride or potassium carbonate, or an amine base such as triethylamine in a suitable aprotic solvent such as for example dimethylformamide or dimethylsulfoxide or acetonitrile;
[1046] In general, compounds of Formula (I-c), can be prepared according to the following reaction Scheme 7. In Scheme 7, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl, 9-fluorenylmethoxycarbonyl, or benzyl, all other variables are defined according to the scope of the present invention.
##STR00096## ##STR00097##
[1047] In Scheme 7, the following reaction conditions apply:
[1048] Step 1: at a suitable temperature such as for example −78° C., in the presence of a suitable deprotonating agent such as for example lithium bis(trimethylsilyl)amide (LiHMDS) and sodium hydride, in a suitable solvent such as for example tetrahydrofuran;
[1049] Step 2: at a suitable temperature in a range between room temperature and 100° C., in the presence of a suitable catalyst such as for example rhodium acetate dimer (Rh.sub.2(OAc).sub.4), in a suitable solvent such as for example dichloromethane;
[1050] Step 3: at a suitable temperature in a range between room temperature and 100° C., in the presence of a suitable catalyst such as for example tetrakis(triphenylphosphine)palladium (Pd(PPh.sub.3).sub.4), in the presence of a suitable base such as for example morpholine, in a suitable solvent such as for example tetrahydrofuran;
[1051] Step 4: at a suitable temperature such as for example −78° C., in the presence of a suitable deprotonating agent such as for example n-Butyllithium, in presence of a suitable reagent such as 2,2,6,6-Tetramethylpiperidine (HTMP), in a suitable solvent such as tetrahydrofuran;
[1052] Step 5: at a suitable temperature such as for example 100° C., in the presence of a suitable base such as for example potassium carbonate, in presence of a suitable catalyst such as [1,1′-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water;
[1053] Step 6: at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, THF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine;
[1054] Step 7: when PG=Boc, at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable acid, for example a protic acid such as trifluoroacetic acid or hydrochloric acid, in a suitable solvent such as dichloromethane or 1,4-dioxane;
[1055] Alternatively, when PG=9-fluorenylmethoxycarbonyl, at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable base such as piperidine, in a suitable solvent such as dichloromethane (DCM);
[1056] Alternatively, when PG=benzyl, at a suitable temperature such as room temperature, in the presence of a suitable heterogenous catalyst such as palladium on charcoal (Pd/C), in a common solvent such as methanol, ethanol, THF or the like under hydrogen pressure such as for example from 1 to 3 bar, optionally in the presence of a base such as triethylamine.
[1057] An example of steps 1 and 2 in Scheme 7 is the preparation of a 5-membered intermediate (XVIIcc), as shown in Scheme 7a which can be prepared according to the general procedures outlined in steps 1 and 2 in Scheme 7.
##STR00098##
[1058] In general, intermediates of Formula (XVIIId), can be prepared according to the following reaction Scheme 8. In Scheme 8, W.sub.2 represents chloro, bromo or iodo, all other variables are defined according to the scope of the present invention. A skilled person will realize that cyclobutyl in Scheme 8 can be C.sub.3-5cycloalkyl in general, and that an intermediate of Formula (XVIIId) can be further functionalized into a compound of Formula (I) by analogous reaction protocols as described in the general schemes herein, combined with standard synthetic processes commonly used by those skilled in the art of organic chemistry.
##STR00099##
[1059] In Scheme 8, the following reaction conditions apply:
[1060] Step 1: at a suitable temperature such as for example 0° C., in the presence of a suitable condensation reagent such as propylphosphonic anhydride (T.sub.3P), in the presence of a base such as N,N-Diisopropylethylamine (DIPEA), in a suitable solvent such as dimethylformamide or dichloromethane;
[1061] Step 2: at a suitable temperature such as for example 0° C., in a suitable solvent such as tetrahydrofuran;
[1062] Step 3: at a suitable temperature in a range between room temperature and 70° C., in the presence of a suitable reducing agent such as for example sodium triacetoxyborohydride or sodium cyanoborohydride, in a suitable solvent such as for example methanol, dichloromethane or 1,2-dichloroethane, optionally in the presence of zinc chloride or sodium acetate or acetic acid;
[1063] Step 4: at a suitable temperature in a range between 0° C. and 40° C., such as room temperature, in the presence of a suitable acid such as hydrochloric acid (HCl, 1N), in a suitable solvent such as acetonitrile.
[1064] In general, intermediates as described in Scheme 9, wherein Q represents —CHR.sup.y—, can be prepared according to the following reaction Scheme. In Scheme 9, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl, all other variables are defined according to the scope of the present invention.
##STR00100##
[1065] In Scheme 9, the following reaction conditions apply:
[1066] Step 1: at a suitable temperature, in a range between room temperature and 70° C., such as 60° C., in the presence of zinc, in the presence of suitable activating agents such as trimethylsilylchloride or 1-bromo, 2-chloroethane, in a suitable solvent such as tetrahydrofuran. Optionally, the procedure can also be performed with the use of a flow-apparatus;
[1067] Step 2: at a suitable temperature, in a range between room temperature and 70° C., such as 50° C., in the presence of a suitable catalyst such as 4.sup.th generation RuPhos Pd precatalyst (RuPhos Pd G4), in a suitable solvent such as tetrahydrofuran.
[1068] In general, intermediates as described in Scheme 10, wherein Q represents —CHR.sup.y—, can be prepared according to the following reaction Scheme. In Scheme 10, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl, all other variables are defined according to the scope of the present invention. BPin represents 4,4,5,5-tetramethyl-1,3,2-dioxaborolane. W.sup.1 and W.sup.3 represent fluoro, chloro, bromo or iodo.
##STR00101## ##STR00102##
[1069] Step 1: at a suitable temperature, such as −78° C., in the presence of a suitable deprotonating agent such as n-Butyllithium, in a suitable solvent such as tetrahydrofuran, in the presence of suitable electrophile, such as DMF;
[1070] Step 2: at a suitable temperature in a range between 80° C. and 120° C., in the presence of a diol protection reagent such as for example glycol, in the presence of a Bronsted acid such as for example para-toluenesulfonic acid in a suitable solvent such as for example toluene;
[1071] Step 3: at a suitable temperature in a range between room temperature and 100° C., in the presence of a suitable base such as for example potassium carbonate, in the presence of a suitable catalyst such as [1,1′-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water; Alternatively, when R.sup.2=Me, a boron containing reagent such as trimethyl boroxine can be used in the presence of a suitable catalyst such as (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water in the presence of an inorganic base such as potassium carbonate at a reaction temperature between 80° C. and 120° C.; Step 4: in the presence of a suitable base, such as for example sodium t-butoxide, in the presence of a suitable palladium source such as palladium(II)acetate (Pd(OAc).sub.2), in the presence of a suitable ligand, such as 1,1′-(9,9-Dimethyl-9H-xanthene-4,5-diyl)bis[1,1-diphenylphosphine], Xantphos, in the presence of a suitable solvent, such as 1,4-dioxane, at a suitable temperature range between 50° C. and 120° C.;
[1072] Step 5: in the presence of a suitable Bronsted acid, such as hydrochloric acid, in the presence of a suitable solvent such as 1,4-dioxane or tetrahydrofuran, and water, at a suitable temperature range such a room temperature and 60° C.;
[1073] Step 6: in the presence of a suitable deprotonating agent, such as n-butyllithium, in a suitable solvent such as tetrahydrofuran, at a suitable temperature range such as −78° C. and room temperature.
[1074] Step 7: in the presence of a suitable Bronsted acid, such as hydrochloric acid, in the presence of a suitable solvent such as 1,4-dioxane or tetrahydrofuran, and water, at a suitable temperature range such a room temperature and 100° C.;
[1075] Step 8: at a suitable temperature such as for example between 0° C. and room temperature, in the presence of a suitable bromination reagent such as for example N-bromosuccinimide or CuBr.sub.2, in a suitable solvent such as for example dimethylformamide or acetonitrile;
[1076] Step 9: at a suitable temperature such as for example 80° C. and 130° C., in the presence of a suitable catalyst such as copper (Cu), in the presence of a base such as potassium carbonate, in a suitable solvent such as dimethylformamide. Alternatively a copper (I) source may be used, such as CuI in the presence of a suitable diamine ligand, such as trans-N,N′-dimethylcyclohexane-1,2-diamine in the presence of an inorganic base, such as potassium carbonate in an aprotic solvent such as dimethylformamide at a temperature between 80° C. and 150° C. In certain cases said conversion may also be effected by a nucleophilic aromatic substitution using an inorganic base such as potassium tert-butoxide or sodium hydride or the like, in an aprotic solvent such as dimethylformamide at a temperature between 0° C. and 80° C.;
[1077] Step 10: at a suitable temperature such as for example 100° C., in the presence of a suitable base such as for example potassium carbonate, in presence of a suitable catalyst such as [1,1′-Bis(diphenylphosphino)ferrocene]dichloropalladium(II) (Pd(dppf)Cl.sub.2) in a suitable solvent such as for example dioxane or dimethylformamide and water.
[1078] As can be appreciated by a person skilled in the art, the intermediate obtained in scheme 10, can be further elaborated to obtain compounds of Formula (A) by means of using the procedures outlined in the general schemes mentioned above, in particular in scheme 1 and scheme 3.
[1079] In general, intermediates as described in Scheme 11, can be prepared according to the following reaction Scheme. In Scheme 11, PG represents a suitable protecting group, such as for example tert-butyloxycarbonyl, all other variables are defined according to the scope of the present invention. BPin represents 4,4,5,5-tetramethyl-1,3,2-dioxaborolane.
##STR00103##
[1080] Step 1: when PG″=a silyl containing protecting group, such as tert-butyldimethylsilyl, at a suitable temperature in a range between room temperature and 80° C., such as room temperature, in the presence of a base, such as imidazole, in the presence of a suitable reagent, such as tert-butyldimethylsilylchloride, in a suitable solvent, such as DMF. When, PG″ is a different protecting group as defined herein, general protection conditions may be used, known to those skilled in the art.
[1081] Step 2: at a suitable temperature, between room temperature and 60° C., such as room temperature, for example in the presence of a suitable alkyl halide, in the presence of a suitable base, such as K.sub.2CO.sub.3, in the presence of a suitable photocatalyst, such as [4,4′-Bis(1,1-dimethylethyl)-2,2′-bipyridine-N.sup.1,N.sup.1′]bis[3,5-difluoro-2-[5-(trifluoromethyl)-2-pyridinyl-N]phenyl-C]Iridium(III) hexafluorophosphate, [Ir{dF(CF.sub.3)ppy}.sub.2(dtbpy)]PF.sub.6, in the presence of suitable nickel salt, such as NiCl.sub.2-glyme, in the presence of a suitable ligand, such as 4-4′-dimethoxy-2-2′-bipyridine, in a suitable solvent, such as acetonitrile and in the presence of water as an additive, employing blue LED irradiation (Johnston, C., Smith, R., Allmendinger, S. et al. Metallaphotoredox-catalysed sp.sup.3-sp.sup.3 cross-coupling of carboxylic acids with alkyl halides. Nature 536, 322-325 (2016)).
[1082] Step 3: at a suitable temperature, such as room temperature, in the presence of a suitable fluoride source, such a tetrabutylammonium fluoride, in a suitable solvent, such as tetrahydrofuran. When, PG is a different protecting group as defined herein, general protection conditions may be used, known to those skilled in the art.
[1083] Step 4: at a suitable temperature, such as between −78° C. and 40° C., in the presence of Dess-Martin periodinane, in a suitable solvent such as dichloromethane. Other oxidation methods, known to those skilled in the art may also be employed.
[1084] Step 5: at a suitable temperature such as for example −78° C., in the presence of a suitable deprotonating agent such as for example n-Butyllithium, in presence of a suitable reagent such as 2,2,6,6-Tetramethylpiperidine (HTMP), in a suitable solvent such as tetrahydrofuran.
[1085] It will be appreciated that where appropriate functional groups exist, compounds of various formulae or any intermediates used in their preparation may be further derivatized by one or more standard synthetic methods employing condensation, substitution, oxidation, reduction, or cleavage reactions. Particular substitution approaches include conventional alkylation, arylation, heteroarylation, acylation, sulfonylation, halogenation, nitration, formylation and coupling procedures.
[1086] The compounds of Formula (I) may be synthesized in the form of racemic mixtures of enantiomers which can be separated from one another following art-known resolution procedures. The racemic compounds of Formula (I) containing a basic nitrogen atom may be converted into the corresponding diastereomeric salt forms by reaction with a suitable chiral acid. Said diastereomeric salt forms are subsequently separated, for example, by selective or fractional crystallization and the enantiomers are liberated therefrom by alkali. An alternative manner of separating the enantiomeric forms of the compounds of Formula (I) involves liquid chromatography using a chiral stationary phase. Said pure stereochemically isomeric forms may also be derived from the corresponding pure stereochemically isomeric forms of the appropriate starting materials, provided that the reaction occurs stereospecifically.
[1087] In the preparation of compounds of the present invention, protection of remote functionality (e.g., primary or secondary amine) of intermediates may be necessary. The need for such protection will vary depending on the nature of the remote functionality and the conditions of the preparation methods. Suitable amino-protecting groups (NH-Pg) include acetyl, trifluoroacetyl, t-butoxycarbonyl (Boc), benzyloxycarbonyl (CBz) and 9-fluorenylmethyleneoxycarbonyl (Fmoc). The need for such protection is readily determined by one skilled in the art. For a general description of protecting groups and their use, see T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 4th ed., Wiley, Hoboken, N.J., 2007.
Pharmacology
[1088] It has been found that the compounds of the present invention block the interaction of menin with MLL proteins and oncogenic MLL fusion proteins per se, or can undergo metabolism to a (more) active form in vivo (prodrugs). Therefore the compounds according to the present invention and the pharmaceutical compositions comprising such compounds may be useful for the treatment or prevention, in particular treatment, of diseases such as cancer, including but not limited to leukemia, myelodysplastic syndrome (MDS), and myeloproliferative neoplasms (MPN); and diabetes.
[1089] In particular, the compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of cancer. According to one embodiment, cancers that may benefit from a treatment with menin/MLL inhibitors of the invention comprise leukemias, lymphomas, myelomas or solid tumor cancers (e.g. prostate cancer, lung cancer, breast cancer, pancreatic cancer, colon cancer, liver cancer, melanoma and glioblastoma, etc.). In some embodiments, the leukemias include acute leukemias, chronic leukemias, myeloid leukemias, myelogeneous leukemias, lymphoblastic leukemias, lymphocytic leukemias, Acute myelogeneous leukemias (AML), Chronic myelogenous leukemias (CML), Acute lymphoblastic leukemias (ALL), Chronic lymphocytic leukemias (CLL), T cell prolymphocytic leukemias (T-PLL), Large granular lymphocytic leukemia, Hairy cell leukemia (HCL), MLL-rearranged leukemias, MLL-PTD leukemias, MLL amplified leukemias, MLL-positive leukemias, leukemias exhibiting HOX/MEIS1 gene expression signatures etc.
[1090] In particular, the compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of myelodysplastic syndrome (MDS) or myeloproliferative neoplasms (MPN).
[1091] In particular, compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of leukemias, in particular nucleophosmin (NPM1)-mutated leukemias, e.g. NPM1c.
[1092] In particular, compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of AML, in particular nucleophosmin (NPMT)-mutated AML (i.e., NPM1.sup.mut AML), more in particular abstract NPM1-mutated AML.
[1093] In particular, compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of MLL-rearranged leukemias, in particular MLL-rearranged AML or ALL.
[1094] In particular, compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of leukemias with MLL gene alterations, in particular AML or ALL with MLL gene alterations.
[1095] In particular, compounds according to the present invention and the pharmaceutical compositions thereof may be suitable for Q.D. dosing (once daily).
[1096] In particular, compounds according to the present invention and the pharmaceutical compositions thereof may be useful in the treatment or prevention of hematological cancer in a subject exhibiting NPM1 gene mutations and/or mixed lineage leukemia gene (MLL; MLL1; KMT2A) alterations, mixed lineage leukemia (MLL), MLL-related leukemia, MLL-associated leukemia, MLL-positive leukemia, MLL-induced leukemia, rearranged mixed lineage leukemia, leukemia associated with a MLL, rearrangement/alteration or a rearrangement/alteration of the MLL gene, acute leukemia, chronic leukemia, myelodysplastic syndrome (MDS), myeloproliferative neoplasms (MPN), insulin resistance, pre-diabetes, diabetes, or risk of diabetes, hyperglycemia, chromosomal rearrangement on chromosome 11q23, type-1 diabetes, type-2 diabetes; promoting proliferation of a pancreatic cell, where pancreatic cell is an islet cell, beta cell, the beta cell proliferation is evidenced by an increase in beta cell production or insulin production; and for inhibiting a menin-MLL interaction, where the MLL fusion protein target gene is HOX or MEIS1 in human.
[1097] Hence, the invention relates to compounds of Formula (I), the tautomers and the stereoisomeric forms thereof, and the pharmaceutically acceptable salts, and the solvates thereof, for use as a medicament.
[1098] The invention also relates to the use of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, or a pharmaceutical composition according to the invention, for the manufacture of a medicament.
[1099] The present invention also relates to a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, or a pharmaceutical composition according to the invention, for use in the treatment, prevention, amelioration, control or reduction of the risk of disorders associated with the interaction of menin with MLL proteins and oncogenic MLL fusion proteins in a mammal, including a human, the treatment or prevention of which is affected or facilitated by blocking the interaction of menin with MLL proteins and oncogenic MLL fusion proteins.
[1100] Also, the present invention relates to the use of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, or a pharmaceutical composition according to the invention, for the manufacture of a medicament for treating, preventing, ameliorating, controlling or reducing the risk of disorders associated with the interaction of menin with MLL proteins and oncogenic MLL fusion proteins in a mammal, including a human, the treatment or prevention of which is affected or facilitated by blocking the interaction of menin with MLL proteins and oncogenic MLL fusion proteins.
[1101] The invention also relates to a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, for use in the treatment or prevention of any one of the diseases mentioned hereinbefore.
[1102] The invention also relates to a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, for use in treating or preventing any one of the diseases mentioned hereinbefore.
[1103] The invention also relates to the use of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, for the manufacture of a medicament for the treatment or prevention of any one of the disease conditions mentioned hereinbefore.
[1104] The compounds of the present invention can be administered to mammals, preferably humans, for the treatment or prevention of any one of the diseases mentioned hereinbefore.
[1105] In view of the utility of the compounds of Formula (I), the tautomers and the stereoisomeric forms thereof, and the pharmaceutically acceptable salts, and the solvates thereof, there is provided a method of treating warm-blooded animals, including humans, suffering from any one of the diseases mentioned hereinbefore.
[1106] Said method comprises the administration, i.e. the systemic or topical administration, of a therapeutically effective amount of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, to warm-blooded animals, including humans.
[1107] Therefore, the invention also relates to a method for the treatment or prevention of any one of the diseases mentioned hereinbefore comprising administering a therapeutically effective amount of compound according to the invention to a patient in need thereof.
[1108] One skilled in the art will recognize that a therapeutically effective amount of the compounds of the present invention is the amount sufficient to have therapeutic activity and that this amount varies inter alias, depending on the type of disease, the concentration of the compound in the therapeutic formulation, and the condition of the patient. An effective therapeutic daily amount would be from about 0.005 mg/kg to 100 mg/kg. The amount of a compound according to the present invention, also referred to herein as the active ingredient, which is required to achieve a therapeutically effect may vary on case-by-case basis, for example with the particular compound, the route of administration, the age and condition of the recipient, and the particular disorder or disease being treated. A method of treatment may also include administering the active ingredient on a regimen of between one and four intakes per day. In these methods of treatment the compounds according to the invention are preferably formulated prior to administration.
[1109] The present invention also provides compositions for preventing or treating the disorders referred to herein. Said compositions comprising a therapeutically effective amount of a compound of Formula (I), a tautomer or a stereoisomeric form thereof, or a pharmaceutically acceptable salt, or a solvate thereof, and a pharmaceutically acceptable carrier or diluent.
[1110] While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical composition. Accordingly, the present invention further provides a pharmaceutical composition comprising a compound according to the present invention, together with a pharmaceutically acceptable carrier or diluent. The carrier or diluent must be “acceptable” in the sense of being compatible with the other ingredients of the composition and not deleterious to the recipients thereof.
[1111] The pharmaceutical compositions may be prepared by any methods well known in the art of pharmacy, for example, using methods such as those described in Gennaro et al. Remington's Pharmaceutical Sciences (18.sup.thed., Mack Publishing Company, 1990, see especially Part 8 Pharmaceutical preparations and their Manufacture).
[1112] The compounds of the present invention may be administered alone or in combination with one or more additional therapeutic agents. Combination therapy includes administration of a single pharmaceutical dosage formulation which contains a compound according to the present invention and one or more additional therapeutic agents, as well as administration of the compound according to the present invention and each additional therapeutic agent in its own separate pharmaceutical dosage formulation.
[1113] Therefore, an embodiment of the present invention relates to a product containing as first active ingredient a compound according to the invention and as further active ingredient one or more anticancer agent, as a combined preparation for simultaneous, separate or sequential use in the treatment of patients suffering from cancer.
[1114] The one or more other medicinal agents and the compound according to the present invention may be administered simultaneously (e.g. in separate or unitary compositions) or sequentially in either order. In the latter case, the two or more compounds will be administered within a period and in an amount and manner that is sufficient to ensure that an advantageous or synergistic effect is achieved. It will be appreciated that the preferred method and order of administration and the respective dosage amounts and regimes for each component of the combination will depend on the particular other medicinal agent and compound of the present invention being administered, their route of administration, the particular condition, in particular tumour, being treated and the particular host being treated.
[1115] The following examples further illustrate the present invention.
Examples
[1116] Several methods for preparing the compounds of this invention are illustrated in the following examples. Unless otherwise noted, all starting materials were obtained from commercial suppliers and used without further purification, or alternatively can be synthesized by a skilled person by using well-known methods.
TABLE-US-00001 Abbreviation Meaning CH.sub.3COONH.sub.4 ammonium acetate 1,2-DCE 1,2-dichloroethane sat. or Sat. saturated ° C. degree Celsius AcOH or CH.sub.3COOH acetic acid Ac.sub.2O acetic anhydride aq. aqueous atm atmosphere BH3•THF Borane tetrahydrofuran complex Boc or boc tert-butyloxycarbonyl BOC-anhydride di-tert-butyl dicarbonate BPin or PinB 4,4,5,5-tetramethyl-1,3,2-dioxaborolane Celite diatomaceous earth CO.sub.2 carbon dioxide Cs.sub.2CO.sub.3 cesium carbonate CPME cyclopentyl methylether DCM or CH2Cl2 dichloromethane DEA diethanolamine DEE diethyl ether DIEA or DIPEA N-ethyl-N-(propan-2-yl)propan-2-amine DMA N,N-dimethylacetamide DME 1,2-dimethoxyethane DMF N,N-dimethylformamide DMSO (methanesulfinyl)methane DSC differential scanning calorimetry EDCI or EDCI•HCl 3-{[(ethylimino)methylidene]amino}-N,N- dimethylpropan-1-amine ee enantiomeric excess ESI electrospray ionization EtOAc or EA ethyl acetate EtOH ethanol FA formic acid FCC flash column chromatography h or hr hour(s) HATU 1-[bis(dimethylamino)methylene]-1H- 1,2,3-triazolo[4,5-b]pyridinium 3-oxide hexafluorophosphate HCl hydrochloric acid Hex hexane HOBt 1-hydroxybenzotriazole IBX 2-iodoxybenzoic acid Insolute ® SCX-3 ethylbenzene sulfonic acid cation exchange resin Ir[dF(CF.sub.3)ppy].sub.2(dtbpy))PF6 [4,4′-Bis(1,1-dimethylethyl)-2,2′- bipyridine-N1,N1′]bis[3,5-difluoro- 2-[5-(trifluoromethyl)-2- pyridinyl-N]phenyl-C]Iridium(III) hexafluorophosphate i-PrNH.sub.2 or iPrNH isopropyl amine i-PrOH, iPrOH or IPA isopropyl alcohol IPAC isopropyl acetate K.sub.2CO.sub.3 potassium carbonate KOAc potassium acetate LCMS liquid chromatography-mass spectrometry LiAlH.sub.4 lithium aluminium hydride Li-HMDS or LiHMDS lithium bis(trimethylsilyl)amide M or N mol/L MeCN or CH.sub.3CN acetonitrile MeI iodomethane MeOH methanol mg milligram min minute(s) mL milliliter mmol millimole m-CPBA meta-chloroperoxybenzoic acid MS mass spectrometry N.sub.2 nitrogen Na.sub.2CO.sub.3 sodium carbonate Na.sub.2SO.sub.4 sodium sulfate NaBH(OAc).sub.3 sodium triacetoxyborohydride NaBH.sub.3CN sodium cyanoborohydride Na.sub.4EDTA Ethylenediaminetetraacetic acid tetrasodium salt NaHCO.sub.3 sodium hydrogencarbonate NaOAc sodium acetate NaOH sodium hydroxide NH.sub.3 ammonia NH.sub.3•H.sub.2O or NH.sub.4OH ammonium hydroxide NH.sub.4HCO.sub.3 ammonium hydrogencarbonate n-BuLi n-butyllithium NBS N-Bromosuccinimide NH.sub.4Cl ammonium chloride NMP 1-methyl-2-pyrrolidinone NMR nuclear magnetic resonance Pd(dppf)Cl.sub.2 [1,1′- bis(diphenylphosphino)ferrocene] dichloropalladium(II) Pd(PPh.sub.3).sub.4 tetrakis(triphenylphosphine)palladium(0) Pd/C palladium on carbon PE petroleum ether PIDA Diacetoxy iodobenze or iodobenzen diacetate Prep. HPLC preparative high-performance liquid chromatography Prep. SFC preparative supercritical fluid chromatography Prep. TLC preparative thin-layer chromatography Rf retention factor Rh.sub.2(OAc).sub.4 rhodium acetate RP Reverse(d) phase rt, r.t. or RT room temperature RuPhos Pd G4/ Palladium, [[2′,6′-bis(1-methylethoxy)[1,1′- 4.sup.th generation RuPhos Pd biphenyl]-2-yl]dicyclohexylphosphine- precatalyst κP](methanesulfonato-κO)[2′-(methyl- amino-κN)[1,1′-biphenyl]-2-yl-κC]-, (SP-4-3)-(ACI) CAS 1599466-85-9 sat saturated SFC supercritical fluid chromatography SiliaBond ® Propylsulfonic acid bound to silica propylsulfonic stationary phase support acid resin SiliaMetS ® N1-propylethane-1,2-diamine bound to Diamine silica stationary phase support t-butyl tert-butyl t-BuOK potassium tert-butoxide T3P propylphosphonic anhydride TEA or Et3N triethylamine Temp temperature TFA trifluo acetic acid THF tetrahydrofuran TLC thin-layer chromatography Tonset Temperature at which melting onset occurs (measure by DSC) Ts tosyl UV ultraviolet v/v volume to volume w/v weight to volume w/w weight to weight ZnCl2 zinc chloride Xantphos 4,5-bis(diphenylphosphino)-9,9- dimethylxanthene
[1117] As understood by a person skilled in the art, compounds synthesized using the protocols as indicated may exist as a solvate e.g. hydrate, and/or contain residual solvent or minor impurities. Compounds or intermediates isolated as a salt form, may be integer stoichiomnetric i.e. mono- or di-salts, or of intermediate stoichiometry. When an intermediate or compound in the experimental part below is indicated as ‘HCI salt’ without indication of the number of equivalents of HCl, this means that the number of equivalents of HCl was not determined. The same principle will also apply to all other salt forms referred to in the experimental part, such as e.g. ‘oxalate salt’, ‘HCOOH salt’ (‘formate salt’), or
##STR00104##
[1118] The stereochemical configuration for centers in some compounds may be designated “R” or “S” when the mixture(s) was separated and absolute stereochemistry was known, or when only one enantiomer was obtained and absolute stereochemistry was known; for some compounds, the stereochemical configuration at indicated centers has been designated as “*R” or “*S” when the absolute stereochemistry is undetermined (even if the bonds are drawn stereo specifically) although the compound itself has been isolated as a single stereoisomer and is enantiomerically pure. In case a compound designated as “*R” is converted into another compound, the “*R” indication of the resulting compound is derived from its starting material.
[1119] For example, it will be clear that Compound 135
##STR00105##
[1120] For compounds wherein the stereochemical configuration of two stereocentres is indicated by * (e.g. *R or *S), the absolute stereochemistry of the stereocentres is undetermined (even if the bonds are drawn stereospecifically), although the compound itself has been isolated as a single stereoisomer and is enantiomerically pure. In this case, the configuration of the first stereocentre indicated by * is independent of the configuration of the second stereocentre indicated by * in the same compound. “*R” or “*S” is assigned randomly for such molecules. Similar for compounds wherein the stereochemical configuration of three stereocentres is indicated by * (e.g. *R or *S), the absolute stereochemistry of the stereocentres is undetermined (even if the bonds are drawn stereospecifically), although the compound itself has been isolated as a single stereoisomer and is enantiomerically pure. In this case, the configuration of the stereocentres indicated by * are independent of the configuration of the other stereocentres indicated by * in the same compound. “*R” or “*S” is assigned randomly for such molecules.
[1121] For example, for Compound 9b
##STR00106##
this means that the compound is
##STR00107##
[1122] A skilled person will realize that the paragraphs above about stereochemical configurations, also apply to intermediates.
[1123] A skilled person will realize that, even where not mentioned explicitly in the experimental protocols below, typically after a column chromatography purification, the desired fractions were collected and the solvent was evaporated.
[1124] In case no stereochemistry is indicated, this means it is a mixture of stereoisomers or undetermined stereochemistry, unless otherwise is indicated or is clear from the context.
[1125] When a stereocenter is indicated with ‘RS’ this means that a racemic mixture was obtained at the indicated centre, unless otherwise indicated.
[1126] A double bond indicated with EZ means the compound/intermediate was obtained as a mixture of E and Z isomers.
Preparation of Intermediates and Compounds
[1127] For intermediates that were used in a next reaction step as a crude or as a partially purified intermediate, in some cases no mol amounts are mentioned for such intermediate in the next reaction step or alternatively estimated mol amounts or theoretical mol amounts for such intermediate in the next reaction step are indicated in the reaction protocols described below.
Preparation of Intermediate 1:
[1128] ##STR00108##
[1129] To a solution of 4-bromo-TH-pyrrolo[2,3-c]pyridine (2 g, 95% purity, 9.64 mmol) in 1,4-dioxane (30 mL) and water (4 mL) was added 2,4,6-trimethyl-1,3,5,2,4,6-trioxatriborinane (7.26 g, 50% in THF, 28.9 mmol) and potassium carbonate (4.0 g, 28.9 mmol). The suspension was degassed and exchanged with N.sub.2 twice. [1,1′-bis(diphenylphosphino)ferrocene]dichloropalladium(II) (706 mg, 0.964 mmol) was added into the reaction mixture. The reaction mixture was heated up to 100° C. and stirred at this temperature overnight. After cooled down to r.t., the reaction mixture was filtered and the filtrate was concentrated. The resulting residue was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 80% to give intermediate 1 (1.01 g, 95% purity, 75.3% yield).
[1130] Alternatively, intermediate 1 can also be prepared with the following procedure:
[1131] Into a 20 L 4-necked round-bottom flask were added 4-bromo-1H-pyrrolo[2,3-c]pyridine (1330 g, 6750 mmol, 1.00 equiv), Pd(dppf)Cl.sub.2 (493.9 g, 675 mmol, 0.10 equiv), K.sub.2CO.sub.3 (2798.69 g, 20250.21 mmol, 3.00 equiv), 1,4-dioxane (13 L), H.sub.2O (2 L) and 2,4,6-trimethyl-1,3,5,2,4,6-trioxatriborinane (2542.01 g, 20250.21 mmol, 3.00 equiv) at room temperature. The resulting mixture was stirred for overnight at 100° C. The mixture was allowed to cool down to room temperature. The resulting mixture was concentrated under reduced pressure. The resulting mixture was diluted with water (15 L). The aqueous layer was extracted with EtOAc (3×10 L) and the organic layer was washed with water (2×5 L). The resulting liquid was dried with Na.sub.2SO.sub.4, filtered and concentrated under vacuum. The residue was purified by silica gel column chromatography, eluting with with 10% methanol in dichloromethane to afford intermediate 1 (640 g, yield: 72%) as a grey solid.
Preparation of Intermediate 2:
[1132] ##STR00109##
[1133] At 0° C., to a solution of intermediate 1 (918 mg, 95% purity, 6.6 mmol) in DMF (60 mL) was added a solution of N-bromosuccinimide (1.17 g, 6.6 mmol) in DMF (10 mL) dropwise. The reaction mixture was stirred at this temperature for 30 minutes. The reaction mixture was quenched with water and extracted with ethyl acetate (50 mL) twice. The organic layer was washed with brine (25 mL), dried over sodium sulfate, filtered and concentrated to afford the crude product, which was purified by silica gel column chromatography eluting with ethyl acetate in petroleum from 0% to 60% to give intermediate 2 (1.14 g, 97.1% purity, 79.5% yield) as a white solid.
[1134] Alternatively, intermediate 2 can also be prepared with the following procedure:
[1135] Into a 10 L 4-necked round-bottom flask were added intermediate 1 (640 g, 4842.39 mmol, 1.00 equiv) and DMF (5.00 L) at room temperature. To the above mixture was added NBS (861.87 g, 4842.40 mmol, 1.00 equiv) in portions over 1 h at room temperature. The resulting mixture was stirred for additional 30 min at room temperature. The reaction was quenched by the addition of aqueous solution of Na.sub.2S.sub.2O.sub.3 (10 L, 10% (w/v)) at room temperature. The aqueous layer was extracted with EtOAc (3×5 L) and the organic layer was washed with brine (1×5 L). The resulting liquid was dried with Na.sub.2SO.sub.4 and concentrated. The residue was purified by silica gel column chromatography, eluting with 20% ethyl acetate in petroleum ether to afford intermediate 2 (800 g, yield: 78%) as a grey solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 2
TABLE-US-00002 Int. No. Structure Starting Materials Intermediate 3
Preparation of Intermediate 4:
[1136] ##STR00112##
[1137] To a solution of intermediate 2 (1.14 g, 97.1% purity, 5.24 mmol) in DMF (80 mL) were added 5-fluoro-2-iodobenzoic acid (1.40 mg, 5.24 mmol), copper powder (333 mg, 5.24 mmol) and potassium carbonate (2.18 g, 15.7 mmol). The reaction mixture was heated up to 100° C. and stirred at this temperature overnight. After the mixture was cooled down to r.t., the reaction mixture was concentrated and the resulting residue was acidified with HCl (1 N) to pH=˜3. The resulting mixture was filtered and the filter cake was washed with water twice. The filter cake was dried under vacuum to give crude intermediate 4 (1.8 g, 91% purity, 89.4% yield) as a yellow solid.
[1138] Alternatively, intermediate 4 can also be prepared with the following procedure:
[1139] Into a 10 L 4-necked round-bottom flask were added intermediate 2 (560 g, 2653.24 mmol, 1.00 equiv), Cu (252.91 g, 3979.87 mmol, 1.50 equiv), K.sub.2CO.sub.3 (1100.08 g, 7959.74 mmol, 3.00 equiv) and 5-fluoro-2-iodobenzoic acid (705.79 g, 2653.24 mmol, 1.00 equiv) in DMF (6.00 L) at room temperature. The resulting mixture was stirred for additional 2 h at 100° C. under nitrogen atmosphere. The resulting mixture was filtered, the filter cake was washed with DMF (1×5 L) and the filtrate was concentrated under reduced pressure. The resulting mixture was diluted with water (8 L). The mixture was acidified to pH 3 with aqueous HCl (conc.). The precipitated solids were collected by filtration and washed with water (3×3 L). The resulting solid was dried under vacuum to afford intermediate 4 (1300 g, crude) as a grey solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 4
TABLE-US-00003 Int. Starting No. Structure Materials Intermediate 5
Preparation of Intermediate 6:
[1140] ##STR00116##
[1141] At 0° C., to a solution of intermediate 4 (1.8 g, 91% purity, 4.69 mmol) in DMF (50 mL) was added HATU (4.46 g, 11.7 mmol), N,N-diisopropylethylamine (3.03 g, 23.5 mmol) and N-methylpropan-2-amine (858 mg, 11.7 mmol). After addition, the mixture was stirred at room temperature overnight. The reaction mixture was concentrated and the resulting residue was purified by silica gel column chromatography eluted with methanol in dichloromethane from 0% to 5% to give intermediate 6 (2.0 g, 93% purity, 98.1% yield) as a yellow oil.
[1142] Alternatively, intermediate 6 can also be prepared with the following procedure:
[1143] Into a 20 L 4-necked round-bottom flask were added intermediate 4 (920 g, 2634.90 mmol, 1.00 equiv, same as 1300 g crude), DMF (7.5 L), HATU (1102.06 g, 2898.39 mmol, 1.10 equiv) and DIEA (1021.63 g, 7904.70 mmol, 3.00 equiv) at room temperature. The resulting mixture was stirred for additional 30 min at room temperature. To the above mixture was added N-methylpropan-2-amine (211.99 g, 2898.39 mmol, 1.10 equiv) dropwise over 10 min at 0° C. The resulting mixture was stirred overnight at room temperature. The reaction was quenched by the addition of water (20 L) at room temperature. The aqueous layer was extracted with EtOAc (3×7 L) and the organic layer was washed with water (3×5 L). The resulting liquid was dried with Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The residue was purified by silica gel column chromatography, eluting with 50% ethyl acetate in petroleum ether (1:1) to afford intermediate 6 (700 g, yield: 66%) as a light yellow solid.
Alternative Approach for the Preparation of Intermediate 6
[1144] Intermediate 111 (1.3 g, 4.0 mmol) was dissolved in MeCN (40 mL). Next, CuBr.sub.2 (2.7 g, 12 mmol) was added, and the mixture was stirred at room temperature for 5 h. Next, 7N NH.sub.3/MeOH (20 mL) was added. The reaction mixture was stirred vigorously for −30 min. Then, water (40 mL) and isopropyl acetate were added. The layers were separated, and the water layer was extracted twice with isopropyl acetate. The organic layers were combined, washed with brine, dried over Na.sub.2SO.sub.4, filtered and evaporated to dryness. The residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 3% to provide intermediate 6 (1.2 g, yield 72%) as an orange oil.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 6
TABLE-US-00004 Int. No. Structure Starting Materials Intermediate 7
Preparation of Intermediate 9:
[1145] ##STR00123##
[1146] To a mixture of intermediate 6 (4 g, 4.312 mmol), tert-butyl 3-((4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)methylene)azetidine-1-carboxylate (2.92 g, 9.9 mmol) and potassium carbonate (2.7 g, 19.7 mmol) in 1,4-dioxane (70 mL) and water (23 mL) was added Pd(dppf)Cl.sub.2 (724 mg, 0.99 mmol). The mixture was degassed under nitrogen atmosphere three times and the reaction was stirred at 100° C. under nitrogen atmosphere for 16 h. After the mixture was cooled down to RT, the reaction mixture was diluted with H.sub.2O and extracted with EtOAc. The combined organic phase was washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under vacuum. The residue was purified by silica gel column chromatography eluting with 90% ethyl acetate in petroleum ether to give intermediate 9 (1.8 g, 45.7% purity, 38.7% yield) as a yellow solid.
Preparation of Intermediate 10:
[1147] ##STR00124##
[1148] A mixture intermediate 6 (12.0 g, 29.8 mmol), tert-butyl 3-((4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)methylene)pyrrolidine-1-carboxylate (9.2 g, 29.8 mmol) and potassium carbonate (12.3 g, 89.1 mmol) in 1,4-dioxane (120 mL) and water (20 mL) was degassed and exchanged with N.sub.2 twice. Pd(dppf)Cl.sub.2 (2.16 g, 2.95 mmol) was added and the reaction mixture was heated up to 100° C. and stirred at this temperature overnight. After the reaction mixture was cooled down to r.t., the resulting mixture was concentrated and the residue was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 80% to give intermediate 10 (12.0 g, 79.4% yield) as a yellow oil.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 10
TABLE-US-00005 Int. No. Structure Starting Materials Intermediate 11
Preparation of Intermediate 15:
[1149] ##STR00130##
[1150] A mixture of intermediate 9 (6.0 g, 12.2 mmol) in methanol (100 mL) was degassed under nitrogen atmosphere three times. 10 w/w % palladium on charcoal (3 g) was added and the mixture was degassed under hydrogen atmosphere three times. The mixture was stirred at r.t. under hydrogen atmosphere (balloon) for 16 h. The mixture was filtered and the filtrate was concentrated and purified by silica gel column chromatography eluting with 50% ethyl acetate in petroleum ether to give intermediate 15 (5.2 g, 97% purity, 83.7% yield) as a yellow solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 15
TABLE-US-00006 Int. No. Structure Starting Materials Intermediate 19
Preparation of Intermediate 16, 17 & 18:
[1151] ##STR00136##
[1152] To a solution of intermediate 10 (2.5 g, 93% purity, 4.59 mmol) in methanol (40 mL) was added w/w % palladium on charcoal (1 g) under N.sub.2. The suspension was degassed under vacuum and purged with H.sub.2 several times. The reaction mixture was heated up to 30° C. and stirred at this temperature overnight. After the reaction was cooled down to r.t., the reaction mixture was filtered and the filtrate was concentrated and purified by silica gel column chromatography eluted with methanol in dichloromethane from 0% to 5% to give intermediate 16 (2.5 g, 93% purity, 99.6% yield) as a yellow oil.
[1153] Intermediate 16 (8 g, 95% purity, 14.9 mmol) was separated by chiral IG-SFC (separation condition: Column: IG; Mobile Phase: CO.sub.2-IPA: 65:35, at 60 mL/min; Temp: 40° C.; Wavelength: 214 nm) to afford intermediate 17 (first fraction, 3.29 g, 98% purity, 42.4% yield) as a yellow oil and intermediate 18 (second fraction, 3.36 g, 98% purity, 43.3% yield) as a yellow solid.
[1154] Chiral SFC method 2 was employed to match the stereochemistry of intermediate 18 and intermediate 201, retention time=5.97-6.10 min.
Preparation of Intermediate 23 & 24:
[1155] ##STR00137##
[1156] Intermediate 22 (1.40 g, 2.65 mmol) was separated by SFC (DAICEL CHIRALPAK IG (250 mm*50 mm, 10 um)); Mobile phase: A: Supercritical CO.sub.2, B: 0.1% NH.sub.3H.sub.2O IPA; Isocratic: A:B=55:45; Flow rate: 200 mL/min) to afford two fractions. The first fraction was collected as intermediate 23 (620 mg, 98.6% purity, 44% yield) as yellow solid. The second fraction was collected as intermediate 24 (650 mg, 99.9% purity, 46% yield) as a yellow solid.
Preparation of Intermediate 25:
[1157] ##STR00138##
[1158] To a cooled (ice bath) solution of intermediate 15 (1.1 g, 2.2 mmol) in dichloromethane (14 mL) was added dropwise TFA (7 mL). Then, the mixture was stirred at r.t. for 2 h. The solvent was removed by evaporation and the residue was dissolved in DCM, the pH was adjusted to 8-9 with saturated sodium carbonate aqueous solution, and extracted with DCM. The organic phase was dried over Na.sub.2SO.sub.4 and concentrated under vacuum to give intermediate 25 (680 mg, 72% yield) as a white solid.
[1159] The Following Intermediates and Compounds were Synthesized by an Analogous Method as Described for Intermediate 25
TABLE-US-00007 Starting Materials & Int./Co No. Structure Methods Intermediate 26
Preparation of Intermediate 33:
[1160] ##STR00168##
[1161] To a solution of cis-3-[[(1,1-dimethylethoxy)carbonyl]amino]-cyclobutanecarboxylic acid (10.0 g, 46.5 mmol) in DMF (100 mL) was added HOBt (8.15 g, 60.3 mmol), EDCI (11.6 g, 60.5 mmol) and DIEA (30.0 mL, 182 mmol) at 0° C. Then N,O-dimethylhydroxylamine hydrochloride (5.90 g, 60.5 mmol) was added at 0° C. The mixture was stirred at room temperature for 16 hours. The mixture was diluted with ethyl acetate (500 mL), washed with 1 M aq. HCl solution (150 mL), saturated aq. NaHCO.sub.3 solution (100 mL×2) and brine (300 mL×3), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give intermediate 33 (11.0 g, crude) as a white solid, which was used in the next step without further purification.
Preparation of intermediate 34:
##STR00169##
[1162] To a solution of intermediate 33 (11.0 g, 6.97 mmol) in THF (100 mL) was added isopropylmagnesium chloride (64.0 mL, 128 mmol, 2M in THF) dropwise at 0° C. under N.sub.2 atmosphere. The mixture was stirred at room temperature for 12 hours under N.sub.2 atmosphere. The mixture was quenched with saturated aq. NH.sub.4Cl solution (100 mL). The mixture was filtered through a pad of Celite® and the filtrate was extracted with ethyl acetate (200 mL×2). The combined organic layers were washed with brine (200 mL×2), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 15% to yield intermediate 34 (6.30 g) as a white solid.
Preparation of Intermediate 35:
[1163] ##STR00170##
[1164] To a solution of 3,3-dimethoxycyclobutanecarboxylic acid (12.0 g, 75 mmol) in DCM (145 mL) was added T.sub.3P (100 mL, 168 mmol. 50% in EtOAc) and DIEA (64 mL, 372 mmol) at 0° C. Then N,O-dimethylhydroxylamine hydrochloride (8.8 g, 89.5 mmol) was added at 0° C. The mixture was stirred at room temperature for 16 hours. The mixture was poured into a saturated solution of NaHCO.sub.3 and EtOAc was added. The organic layer was separated, washed with brine, dried over MgSO.sub.4, filtered and concentrated under reduced pressure to give intermediate 35 (16.0 g, crude) which was used in the next step without further purification.
Preparation of Intermediate 36:
[1165] ##STR00171##
[1166] To a solution of intermediate 35 (15.7 g, 77.7 mmol) in THF (420 mL) was added isopropylmagnesium chloride (178.5 mL, 232 mmol, 2M in THF) dropwise at 0° C. under N.sub.2 atmosphere. The reaction mixtures were stirred at room temperature for 12 hours under N.sub.2 atmosphere. The reaction was performed twice on 15.7 g of intermediate 35 and respective reaction media were mixed for the work-up and purification. The combined reaction mixture was poured into ice-water and a 10% aqueous solution of NH.sub.4Cl and extracted with EtOAc. The organic layer was washed with brine, dried over MgSO.sub.4, filtered and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography eluting with 10% ethyl acetate in heptane. The pure fractions were collected and evaporated to dryness yielding 22 g (76% yield) of intermediate 36 as a colourless oil.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 36
TABLE-US-00008 Int. No. Structure Starting Materials Intermediate 37
Preparation of Intermediate 39:
[1167] ##STR00174##
[1168] To a solution of N,3,3-trimethoxy-N-methylcyclobutanecarboxamide (1.5 g) in THF (50 mL) was added 1 M lithium aluminum hydride in THF (14 mL, 13.8 mmol) dropwise at −78° C. under nitrogen atmosphere. The resulting mixture was stirred at −78° C. for 3 hours. The mixture was quenched by sodium sulfate decahydrate, and then filtered and concentrated to give intermediate 39 (crude, 1.2 g) as colorless oil, which was used directly in the next step.
Preparation of Intermediate 40:
[1169] ##STR00175##
[1170] A mixture of magnesium (6.0 g, 247 mmol) and diiodine (100 mg, 0.394 mmol) in THF (100 mL) was stirred at 25° C. Then, 2-(2-bromoethyl)-1,3-dioxolane (20.0 g, 110 mmol) in THF (50 mL) was slowly added to the mixture while maintaining the inner temperature between 20˜30° C. The mixture was stirred at 25° C. for 1 hr and slowly introduced to a solution of N-methoxy-N,2-dimethylpropanamide (10.0 g, 76.24 mmol) in THF (100 mL). The resulting mixture was stirred at 25° C. for 8 hours. The mixture was quenched with 300 mL of saturated solution of ammonium chloride and extracted with ethyl acetate (100 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to afford the crude product which was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 15% to afford intermediate 40 (12.8 g, 67% yield) as colorless oil.
The Following Intermediate was Synthesized by an Analogous Method as Described for Intermediate 40
[1171]
TABLE-US-00009 Int. No. Structure Starting Materials Intermediate 41
Preparation of Intermediate 42, 42a & 42b:
[1172] ##STR00177##
[1173] To a solution of intermediate 25 (2.7 g, 6.844 mmol) in methanol (60 mL) was added intermediate 36 (5.0 g, 26.8 mmol), sodium cyanoborohydride (2.149 g, 34.197 mmol) and zinc dichloride (932 mg, 6.837 mmol). The mixture was stirred at 60° C. in a sealed tube for 16 h. After the reaction mixture was cooled down to r.t., the reaction mixture was concentrated and purified by silica gel column chromatography eluting with 10% methanol in dichloromethane to give intermediate 42 (3.8 g) as a white solid, which was separated by chiral Prep. HPLC into the individual enantiomers (separation condition: Column: Chiralpak IA 5 μm 20*250 mm; Mobile Phase: Hex:IPA:DEA=85:15:0.3 at 25 mL/min; Temp: 30° C.; Wavelength: 230 nm) to give the first fraction as intermediate 42a (1.03 g, 26.6% yield) as a white solid and the second fraction as intermediate 42b (1.16 g, 30.0% yield) as a white solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 42
TABLE-US-00010 Int. No. Structure Starting Materials Intermediate 43
Preparation of Compound 366 & 367:
[1174] ##STR00197##
[1175] Compound 512 (1.0 g, 1.77 mmol) was separated by SFC (separation condition: Column DAICEL CHIRALCEL OD (250 mm*50 mm, 10 um); Mobile phase: A: 0.1% NH.sub.3H.sub.2O, B: MeOH, A:B=80:20 at 200 mL/min; Column Temp: 38° C.; Nozzle Pressure: 100 Bar; Nozzle Temp: 60° C.; Evaporator Temp: 20° C.; Trimmer Temp: 25° C.; Wavelength: 220 nm). The pure fractions were collected, and the volatiles were removed under vacuum. The first fraction was collected as Compound 366 (220 mg) and the second fraction was collected as Compound 367 (200 mg) as white solid.
Preparation of Compound 368 & 369:
[1176] ##STR00198##
[1177] Compound 513 (1.0 g, 1.77 mmol) was separated by SFC (separation condition: DAICEL CHIRALPAK AD (250 mm*50 mm, 10 um); Mobile phase: A: 0.1% NH.sub.3H.sub.2O, B: IPA, A:B=75:25 at 200 mL/min; Column Temp: 38° C.; Nozzle Pressure: 100 Bar; Nozzle Temp: 60° C.; Evaporator Temp: 20° C.; Trimmer Temp: 25° C.; Wavelength: 220 nm). The pure fractions were collected, and the volatiles were removed under vacuum. The first fraction was collected as Compound 368 (380 mg, 94.8% purity, 36% yield) and the second fraction was collected as Compound 369 (280 mg, 83.5% purity, 23% yield) as a white solid.
Preparation of Intermediate 56a & 56b:
[1178] ##STR00199##
[1179] Intermediate 56 (700 mg, 1.20 mmol) was separated by SFC (separation condition: DAICEL CHIRALPAK AD (250 mm*30 mm, 10 um); Mobile phase: A: Supercritical CO.sub.2, B: 0.1% NH.sub.3H.sub.2O IPA, A:B=65:35 at 70 mL/min). The pure fractions were collected and the solvent was evaporated under vacuum to give the products. The first fraction was collected as intermediate 56a (280 mg, 100% purity, 40.0% yield) as a colorless oil and the second fraction was collected as intermediate 56b (300 mg, 99.8% purity, 42.8% yield) as a colorless oil.
Preparation of Intermediate 58a & 58b:
[1180] ##STR00200##
[1181] Intermediate 58 (210 mg, 0.36 mmol) was separated by SFC (separation condition: DAICEL CHIRALPAK AD (250 mm*30 mm, 10 um)); Mobile phase: A: Supercritical CO.sub.2, B: 0.1% NH.sub.3H.sub.2O IPA, A:B=75:25 at 60 mL/min; Column Temp: 38° C.; Nozzle Pressure: 100 Bar; Nozzle Temp: 60° C.; Evaporator Temp: 20° C.; Trimmer Temp: 25° C.; Wavelength: 220 nm). The pure fraction was collected, and the solvent was evaporated under vacuum. The first fraction was collected as intermediate 58a (92.0 mg, 98.8% purity, 24.7% yield) as a yellow oil and the second fraction was collected as intermediate 58b (70.0 mg, 98.7% purity, 18.8% yield) as a yellow oil.
Preparation of Compound 371 & 372:
[1182] ##STR00201##
[1183] Compound 370 (250 mg, 0.427 mmol) was separated by SFC (DAICEL CHIRALCEL OD-H (250 mm*30 mm, 5 um); Mobile phase: A: Supercritical CO.sub.2, B: 0.1% NH.sub.3H.sub.2O MeOH; Isocratic: A:B=75:25; Flow rate: 70 mL/min). The pure fraction was collected, and the solvent was evaporated under vacuum. The first fraction was collected as Compound 371 (80 mg, 92.1% purity, 29% yield) as a yellow oil and the second fraction was collected as Compound 372 (90 mg, 89.6% purity, 32% yield) as a yellow oil.
Preparation of Compound 374 & 375:
[1184] ##STR00202##
[1185] Compound 373 (250 mg, 0.43 mmol) was separated by SFC (DAICEL CHIRALPAK AD (250 mm*30 mm, 10 um); Mobile phase: A: Supercritical CO.sub.2, B: 0.1% NH.sub.3H.sub.2O IPA; Isocratic: A:B=70:30; Flow rate: 70 mL/min). The pure fraction was collected, and the solvent was evaporated under vacuum. The first fraction was collected as Compound 374 (90 mg, 97.0% purity, 35% yield) as a yellow oil and the second fraction was collected as Compound 75 (80 mg, 97.7% purity, 31% yield) as yellow oil as a yellow oil.
Preparation of Intermediate 67a:
[1186] ##STR00203##
[1187] To a solution of intermediate 42a (110 mg, 95% purity from LCMS, 0.185 mmol) in acetonitrile (2.5 mL) was added aqueous hydrochloric acid solution (1 N, 0.8 mL) at room temperature. The reaction mixture was heated up to 35° C. and stirred at this temperature for 40 minutes. After the reaction mixture was cooled down to r.t., the reaction mixture was basified with saturated NaHCO.sub.3 aqueous solution until the pH=−8 and extracted with DCM (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over sodium sulfate, filtered and concentrated to afford intermediate 62, which was used in the next step without further purification.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 62a
TABLE-US-00011 Int. No. Structure Starting Materials Intermediate 62b
Preparation of Compound 376:
[1188] ##STR00231##
[1189] A 4M solution of HCl in dioxane (1.90 mL, 7.60 mmol) was added to a solution of compound 525 (310 mg, 0.48 mmol) in dioxane (3 mL) at 0° C. After stirring at r.t. for 1 hr, the reaction mixture was concentrated under reduced pressure to give Compound 376 (420 mg, crude), which was used in next step without further purification.
Preparation of Intermediate 82:
[1190] ##STR00232##
[1191] EDCI.Math.HCl (35.0 g, 183 mmol) was added to a solution of 4-((tert-butoxycarbonyl) (methyl)amino)butanoic acid (28.0 g, 129 mmol), N,O-dimethylhydroxylamine hydrochloride (16.0 g, 164 mmol), HOBt (17.5 g, 130 mmol) and 4-methylmorpholine (78.0 g, 771 mmol) in CHCl.sub.3 (500 mL). After stirring at r.t. for 16 hours, the reaction mixture was subsequently washed with water (250 mL×2), 0.1N aq. HCl solution (250 mL×2), sat. aq. NaHCO.sub.3 solution (250 mL×2) and brine (250 mL×2). The organic layer was dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated in vacuo to give the crude product which was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 50% to afford intermediate 82 (27 g, 80% yield) as a colorless oil.
Preparation of Intermediate 83:
[1192] ##STR00233##
[1193] At 0° C., to a solution of intermediate 82 (27.0 g, 104 mmol) in THF (800 mL) was added prop-1-en-2-ylmagnesium bromide (260 mL, 260 mmol, 1 M) under N.sub.2. The mixture was stirred at 0° C. under N.sub.2 for 1 hour, slowly warmed up to room temperature and stirred at room temperature for 16 hours. The mixture was quenched with sat. aq. NH.sub.4Cl solution (400 mL) and extracted with EtOAc (500 mL×3). The combined organic layers were washed with H.sub.2O (300 mL×2) and brine (300 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give intermediate 83 (25 g, crude) as light yellow oil, which was used in the next step without further purification.
_Preparation of Intermediate 84:
[1194] ##STR00234##
[1195] To a solution of intermediate 83 (11.0 g, crude) in MeOH (100 mL) was added 10 w/w % Pd/C (1 g) under N.sub.2 atmosphere. The mixture was degassed under vacuum and purged with H.sub.2 three times. The mixture was stirred at rt for 2 hours under H.sub.2 (15 psi) atmosphere. The reaction mixture was filtered through a pad of Celite®, and the filter cake was washed with MeOH (30×2 mL). The filtrate was concentrated under reduced pressure to give the crude product which was purified by silica gel column chromatography eluting with 20% ethyl acetate in petroleum ether to give intermediate 84 (9.5 g, 86% yield) as a colorless oil.
Preparation of Intermediate 85:
[1196] ##STR00235##
[1197] To a solution of intermediate 84 (20.0 g, 82.2 mmol) in DCM (200 mL) was added 4M HCl in dioxane solution (120 mL, 480 mmol). After stirring at r.t for 1 hour, the reaction mixture was concentrated under reduce pressure to give intermediate 85 (17.8 g, crude) as a white solid, which was used in next step without further purification.
Preparation of Intermediate 86:
[1198] ##STR00236##
[1199] To a solution of intermediate 85 (70 g, crude), K.sub.2CO.sub.3 (224 g, 1621 mmol) and NaI (146 g, 974 mmol) in DMF (700 ml) was added 1-bromo-2-methoxyethane (54 g, 389 mmol). The mixture was stirred at 50° C. for 5 hours. The insoluble residues were removed via filtration, and the filtrate was concentrated under reduced pressure to give the crude product, which was poured into water (500 mL) and extracted with ethyl acetate (500 mL×3). The combined organic layers were washed with brine (100 mL×3), 5% aq. LiCl solution (100 mL×3) and water (100 mL), dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to give intermediate 86 (25 g, 38% yield) as a brown oil.
Preparation of Intermediate 87:
[1200] ##STR00237##
[1201] To a solution of tert-butyl (trans)-rel-octahydropyrrolo[3,4-c]pyrrole-2-carboxylate hemioxalate (1.00 g, 3.89 mmol) in anhydrous dichloromethane (20.0 mL) was added triethylamine (2.00 g, 19.8 mmol). Then acetic anhydride (600 mg, 5.88 mmol) was added dropwise, and the reaction mixture was stirred at 25° C. for 70 minutes. The reaction mixture was diluted with dichloromethane (30 mL) and washed with water (20 mL×1), brine (20 mL×1) and saturated aqueous sodium bicarbonate solution (20 mL×1). The organic phase was dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to give intermediate 87 (990 mg, 95.0% purity, 95.2% yield) as a white solid.
Preparation of Intermediate 88:
[1202] ##STR00238##
[1203] Intermediate 87 was separated by SFC (separation condition: DAICEL CHIRALPAK AS (250 mm*50 mm, 10 um)); Mobile phase: A: Supercritical CO.sub.2, B: 0.1% NH.sub.3H.sub.2O EtOH, A:B=85:15 at 200 mL/min; Column Temp: 38° C.; Nozzle Pressure: 100 Bar; Nozzle Temp: 60° C.; Evaporator Temp: 20° C.; Trimmer Temp: 25° C.; Wavelength: 220 nm). The second fraction was collected as intermediate 88 (3.36 g, 97.0% purity, 43.2% yield) as a white solid.
Preparation of Intermediate 89:
[1204] ##STR00239##
[1205] To a solution of intermediate 88 (300 mg, 1.18 mmol) in anhydrous dichloromethane (2 mL) was added trifluoroacetic acid (2 mL). After stirring at 25° C. for 1 h, the reaction mixture was concentrated under reduced pressure to give intermediate 89 (300 mg, crude) as yellow oil, which was used in the next step without further purification.
Preparation of Compound 377:
[1206] ##STR00240##
[1207] To a solution of intermediate 26 (100 mg, 95% purity, 0.223 mmol) in methanol (3 mL) were added tert-butyl 4-formylpiperidine-1-carboxylate (104 mg, 0.465 mmol) and sodium triacetoxyborohydride (98.1 mg, 0.465 mmol). After stirring at r.t. for 6 hours, the reaction mixture was concentrated, and the residue was purified by preparative TLC (10% MeOH in DCM) to give Compound 377 (130 mg, 95% purity, 87.7% yield) as a white oil.
Preparation of Compound 378:
[1208] ##STR00241##
[1209] To a solution of intermediate 27 (3.5 g, 95%, 8.14 mmol) in DCM (80 mL) was added tert-butyl 4-formylpiperidine-1-carboxylate (3.66 g, 16.3 mmol) and sodium triacetoxyborohydride (2.58 g, 12.2 mmol). After stirring at room temperature for 6 hours, the reaction mixture was poured into saturated aqueous sodium bicarbonate solution and extracted with dichloromethane (80 mL) twice. The combined organic layers were washed with brine (80 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to afford the crude product, which was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 6% to give Compound 378 (4.66 g, 95% purity, 89.8% yield) as a white oil.
The Following Intermediates and Compounds were Synthesized by an Analogous Method as Described for Compound 378
[1210] In case reactions were performed with a ketone starting material, a typical procedure makes use of either 2 eq. acetic acid or 2 eq. of zinc(II)chloride (ZnC.sub.2), in the presence of 2 eq. sodium cyanoborohydride (NaCNBH.sub.3), in methanol at 50° C. or 70° C. overnight.
TABLE-US-00012 Int./Co No. Structure Starting Materials Compound 62
Preparation of Compound 381:
[1211] ##STR00301##
[1212] Compound 531 (70 mg, 0.104 mmol) was dissolved in DCM (3 mL, 46.837 mmol). TFA (1 mL, 13.067 mmol) was added. The mixture was stirred at RT for 2 hours. The solvent was removed to give Compound 381, which was used in the next step without further purification.
The Following Intermediates and Compounds were Synthesized by an Analogous Method as Described for Compound 381
TABLE-US-00013 Int./Co No. Structure Starting Materials Compound 429
Preparation of Compound 485:
[1213] ##STR00361##
[1214] At 0° C., to a solution of Compound 378 (650 mg, 95% purity, 1.02 mmol) in DCM (8 mL) was added hydrogen chloride in ethyl acetate (2.2 mL, 7 M). After stirring at room temperature for 2 hours, the reaction mixture was concentrated and the residue was basified with aqueous sodium hydroxide solution (1M) and extracted with DCM (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated to afford Compound 485, which was used in the next step without purification.
Preparation of Compound 486:
[1215] ##STR00362##
[1216] To a solution of intermediate 26 (300 mg, 0.734 mmol) and tert-butyl ((trans)-4-formylcyclohexyl)carbamate (334 mg, 1.47 mmol) in anhydrous methanol (8 mL) was added acetic acid (88.2 mg, 1.47 mmol). The reaction mixture was heated and stirred at 45° C. for 30 minutes before sodium cyanotrihydroborate (92.3 mg, 1.47 mmol) was added. After stirring at 45° C. for another 12 h, the reaction mixture was cooled down to room temperature, diluted with dichloromethane (50 mL), basified to pH=8 with saturated aq. sodium bicarbonate solution (40 mL) and extracted with dichloromethane (30 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue, which was purified by preparative-HPLC (Column: Boston Green ODS 150*30 mm*5 um, Mobile Phase A: water (0.225% FA), Mobile Phase B: acetonitrile, Flow rate: 35 mL/min, gradient condition from 1% B to 30% B). The pure fractions were collected and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give Compound 486 (400 mg, 92.5% purity, 81.3% yield) as a white powder.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 486
[1217]
TABLE-US-00014 Co No. Structure Starting Materials Compound 487
Preparation of Compound 488:
[1218] ##STR00364##
[1219] To a solution of Compound 486 (380 mg, 0.613 mmol) in anhydrous dichloromethane (4 mL) was added trifluoroacetic acid (4 mL). After stirring at 25° C. for 1 hour, the reaction mixture was concentrated under reduced pressure to give the Compound 488 (380 mg, crude, TFA salt) as a yellow oil.
Preparation of Intermediate 114:
[1220] ##STR00365##
[1221] To a mixture of (trans)-4-(methoxycarbonyl)cyclohexanecarboxylic acid (5 g, 26.8 mmol), methanamine hydrochloride (2.72 g, 40.3 mmol), EDCI (6.2 g, 32.3 mmol), HOBt (6.0 g, 32.5 mmol) in DCM (80 mL) was added DIPEA (22.5 mL, 136 mmol). After stirring at room temperature overnight, the reaction mixture was diluted with DCM (50 mL), washed with 1 mol/L aq. HCl (100 mL), NaHCO.sub.3 aq. (100 mL) and brine (100 mL) and dried over sodium sulfate. The solution was filtered and concentrated in vacuo to give intermediate 114 (4.4 g, 90% purity, 74.0% yield) as a white solid.
Preparation of Intermediate 115:
[1222] ##STR00366##
[1223] At 0° C., to a solution of LiAlH.sub.4 (570 mg, 15.0 mmol) in dry THF (10 mL) under N.sub.2, was added a solution of intermediate 114 (2.5 g, 12.5 mmol) in dry THF (20 mL) dropwise over 10 min. After addition, the reaction mixture was stirred at 0° C. for 2 h. The reaction was quenched with H.sub.2O (0.5 mL), 10% aq. NaOH (0.5 mL), THF (10 mL), H.sub.2O (1.5 mL), stirred for 10 min, and dried over Na.sub.2SO.sub.4. The suspension was filtered through Celite and the filtrate was concentrated to give crude intermediate 115 (1 g, 90% purity, 41.9% yield) as a white solid.
Preparation of Intermediate 116:
[1224] ##STR00367##
[1225] At 0° C., to a solution of intermediate 115 (500 mg, crude) and triethylamine (1 ml, 7.20 mmol) in DCM (5 ml) was added a solution 4-methylbenzene-1-sulfonyl chloride (557 mg, 2.92 mmol) in DCM (5 ml) and N,N-dimethylpyridin-4-amine (71.5 mg, 0.585 mmol). After stirring at room temperature overnight, the reaction mixture was concentrated and the residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 9% to afford intermediate 116 (300 mg, 99.1% purity, 31.1% yield) as white solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 116
TABLE-US-00015 Int. No. Structure Starting Materials Intermediate 207
Preparation of intermediate 117:
##STR00370##
[1226] To a solution of 6-chloro-N-methylpyrazine-2-carboxamide (0.55 g, 3.2 mmol) in DMA (20 mL) was added 1,4-dioxa-8-azaspiro[4.5]decane (0.46 g, 3.2 mmol), followed by DIPEA (1.7 mL, 9.6 mmol). The mixture was heated up to 130° C. and stirred at that temperature overnight. After the reaction mixture was cooled down to ambient temperature, water and EtOAc were added. The layers were separated, and the water layer was extracted 3×more with EtOAc. The organic layers were combined, dried over Na.sub.2SO.sub.4, filtered, and evaporated to dryness. The residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 5% to give intermediate 117 (0.83 g, 3.0 mmol, yield: 93%) as an orange oil.
Preparation of Intermediate 118:
[1227] ##STR00371##
[1228] Intermediate 117 (830 mg, 3.0 mmol) was dissolved in THF (33 mL). To this solution was added 1M aq. HCl (33 mL) and the mixture was stirred at 50° C. until full consumption of the starting material (˜3 h). The mixture was cooled down to ambient temperature and sat. aq. NaHCO.sub.3 solution and EtOAc were added. After separation of the layers, the water layer was extracted twice with EtOAc. The organic layers were combined, dried over Na.sub.2SO.sub.4, filtered, and evaporated to dryness. Purification by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 4% gave intermediate 118 (0.40 g, 1.7 mmol, yield: 57%) as a yellow solid.
Preparation of Intermediate 119:
[1229] ##STR00372##
[1230] Intermediate 6 (0.40 g, 0.99 mmol), Cs.sub.2CO.sub.3 (1.09 g, 3.4 mmol), Pd(dppf)Cl.sub.2 (0.072 g, 0.10 mmol) and t-butyl 3-methyleneazetidine-1-carboxylate (0.31 g, 1.8 mmol) were added to a flame dried vial, equipped with a stir bar. Next, the vial was evacuated and refilled with N.sub.2, which was repeated three times. Then, anhydrous DMF (8.0 mL) was added, and the mixture stirred at 100° C. overnight. MeOH was added to dissolve the mixture and evaporated to dryness. The residue was partitioned between DCM/water. The layers were separated, and the water layer was extracted twice more with DCM. Organic layers were combined, dried over Na.sub.2SO.sub.4, filtered, and evaporated to dryness. Purification by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 2.5% gave intermediate 119 (313 mg, 86% purity, 54% yield).
Preparation of Intermediate 120:
[1231] ##STR00373##
[1232] To a mixture of intermediate 119 (0.31 g, 0.55 mmol) in MeOH (30 mL) was added a catalytic amount of Pd/C (10% w/w), and the solution was stirred under H.sub.2 atmosphere with balloon for 2.5 h. Then, the mixture was filtered, washed with MeOH, and evaporated to dryness. The residue was purified by silica gel column chromatography eluting with ethyl acetate in heptane from 40% to 80% to give intermediate 120 (0.14 g, 0.29 mmol, 52% yield).
Preparation of Intermediate 121:
[1233] ##STR00374##
[1234] Dissolve intermediate 120 (0.14 g, 0.28 mmol) in DCM (3 mL). Next, TFA (3 mL) was added. The mixture was subsequently stirred at ambient temperature for ˜3 h. Then, the mixture was evaporated to dryness, and applied to a SiliaBond@ propylsulfonic acid resin as a solution in MeOH. The resin was eluted with MeOH (7 fractions), followed by 3.5N NH.sub.3 in MeOH (7 fractions). Product containing fractions were pooled and evaporated to dryness to give intermediate 121 (0.11 g, 0.26 mmol), which was used in the next step without further purification.
Preparation of Intermediate 122:
[1235] ##STR00375##
[1236] 2-Iodopropane (1.64 mL, 16.4 mmol) was added at r.t. to a solution of 2,5-difluorothiophenol (2.00 g, 13.7 mmol) and potassium carbonate (2.65 g, 19.2 mmol) in acetone (46 mL) and the reaction mixture was stirred at 75° C. for 2 h. The reaction mixture was cooled back to r.t., quenched with water (20 mL) and concentrated under reduced pressure to remove the acetone. The aqueous layer was extracted with DCM (4×40 mL) and the combined organic layers were washed with brine (100 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give intermediate 122 (2.35 g, 91.2% yield) as a pale yellow oil which was used without further purification in the following step.
Preparation of Intermediate 123:
[1237] ##STR00376##
[1238] Iodobenzene diacetate (PIDA) (8.16 g, 25.3 mmol) was added at rt to a stirred solution of intermediate 122 (2.34 g, 12.1 mmol) and ammonium carbamate (1.41 g, 18.1 mmol) in MeOH (24 mL) and the reaction mixture was stirred at rt overnight. The reaction mixture was concentrated under reduced pressure to afford a yellow mixture. The crude product was purified by silica gel column chromatography eluting with ethyl acetate in heptane from 10% to 100% to give intermediate 123 (2.45 g, yield 93%) as a colorless oil.
Preparation of Intermediate 124:
[1239] ##STR00377##
[1240] Mel (1.04 mL, 16.8 mmol) was added under nitrogen to a mixture of intermediate 123 (2.45 g, 11.2 mmol) and KOH (1.25 g, 22.4 mmol) in DMSO (61 mL) and the reaction mixture was stirred at r.t. for 90 min. The mixture was diluted with water (600 mL), extracted with ethyl acetate (×4), and the combined organic phases were dried over sodium sulfate, filtered and evaporated to dryness. The crude product was purified by silica gel column chromatography eluting with ethyl acetate in heptane from 30% to 100% to give intermediate 124 (2.41 g, 92.4% yield) as a pale yellow oil.
Preparation of Intermediate 125:
[1241] ##STR00378##
t-BuOK 1.0 M in THF (5.7 mL, 5.70 mmol) was added under nitrogen at 0° C. to a stirred solution of intermediate 123 (1.00 g, 4.56 mmol) in anhydrous THF (15 mL). After 15 min, BOC-anhydride (1.99 g, 9.12 mmol) in anhydrous THF (30 mL) was added and the reaction was left under stirring at rt for 60 h. The reaction was evaporated to dryness, and the residue was dissolved in EtOAc, and the organic phase was washed with water (×2), dried over sodium sulfate, filtered, and evaporated to dryness. The crude product was purified by silica gel column chromatography eluting with ethyl acetate in heptane from 10% to 80% to give intermediate 125 (1.5 g, 99.9% yield) as a white solid.
Preparation of Intermediate 126:
[1242] ##STR00379##
[1243] t-Butyl 3-formylpyrrolidine-1-carboxylate (4.15 g, 20.8 mmol) was added to a stirred mixture of intermediate 1 (2.50 g, 18.9 mmol) and NaOH (2.27 g, 56.7 mmol) in MeOH (77 mL), and the solution was refluxed for 26 h. The reaction was evaporated to dryness and purified by silica gel column chromatography eluting with methanol in dichloromethane from 2% to 20% to give intermediate 126 as an E & Z mixture (6.11 g, yield 62.9%, 61% purity) which was used in the following step without any further purification.
The Following Intermediate was Synthesized by an Analogous Method as Described for Intermediate 126
[1244]
TABLE-US-00016 Int. No. Structure Starting Materials Intermediate 237
Preparation of Intermediate 127:
[1245] ##STR00381##
[1246] To a solution of intermediate 126 (6.10 g, 19.5 mmol) in MeOH (79 mL) was added Pd/C (10% w/w) (1.90 g, 1.78 mmol) under nitrogen. The suspension was hydrogenated at 1 bar Hydrogen at rt for 16 h. The reaction was filtered over Celite®, and the filtrate was evaporated to dryness. The residue was purified by reversed-phase prep. HPLC purification (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give intermediate 127 (1.71 g, yield 45.7%) as a white solid.
The Following Intermediate was Synthesized by an Analogous Method as Described for Intermediate 127
[1247]
TABLE-US-00017 Int. No. Structure Starting Materials Intermediate 238
Preparation of Intermediate 128:
[1248] ##STR00383##
[1249] Potassium tert-butoxide (0.42 mL, 1 M in THF, 0.418 mmol) was added under nitrogen to a solution of intermediate 127 (110 mg, 0.350 mmol) in anhydrous dioxane (1.7 mL). After 10 min, this solution was added to a solution of intermediate 124 (203 mg, 0.872 mmol) in anhydrous dioxane (1.5 mL), and the mixture was stirred at 80 SC overnight. The reaction was cooled down to rt, evaporated to dryness, and the crude was purified by silica gel column chromatography eluting with methanol in dichloromethane from 000 to 15% to give intermediate 128 (96 mg, yield 35.4%) as a yellow glassy solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 128
TABLE-US-00018 Int. No. Structure Starting Materials Intermediate 129
Preparation of Intermediate 130:
[1250] ##STR00391##
[1251] TFA (1.01 mL, 13.2 mmol) was added to a stirred solution of intermediate 128 (97.0 mg, 0.183 mmol) in DCM (1.0 mL). After 30 min, the reaction was evaporated to dryness, and the crude product was dissolved in MeOH and transferred to a column loaded with SiliaBond® propylsulfonic acid resin resin. The column was first eluted with MeOH (20 mL), followed by NH.sub.3 in methanol (7N, 12 mL). The tubes containing the product were concentrated under reduced pressure to give intermediate 130 (78 mg, yield 66.5%) as a pale yellow glassy solid.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 130
TABLE-US-00019 Int. No. Structure Starting Materials Intermediate 131
Preparation of Intermediate 134:
[1252] ##STR00405##
[1253] To a solution of 5-(hydroxymethyl)piperidin-2-one (300 mg, 2.32 mmol) in DMF (5 mL), was added sodium hydride (60% in mineral oil) (140 mg, 3.484 mmol) at 0° C. After 10 min, 4-methylbenzene-1-sulfonyl chloride (532 mg, 2.787 mmol) was added and the mixture was stirred at 0° C. for 3 hr. The mixture was quenched by water (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated to get the crude, which was purified by silica gel column chromatography eluting with MeOH in DCM from 0% to 10% to give intermediate 134 (217 mg, 89.15% purity from LCMS, 29.4% yield) as a white solid.
Preparation of Intermediate 135:
[1254] ##STR00406##
[1255] At 0° C., to a solution of 6-(hydroxymethyl)piperidin-2-one (180 mg, 1.39 mmol), DIEA (0.48 mL, 2.8 mmol) and 4-dimethylaminopyridine (17.0 mg, 0.14 mmol) in DCM (10.8 mL) was added 4-methylbenzenesulfonyl chloride (433.2 mg, 2.27 mmol). After stirring at r.t. for 16 hours, the resulting mixture was washed with brine, drived over Na.sub.2SO.sub.4. The organic solvent was removed and the residue was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 50% to 100% to afford intermediate 135 (300 mg, 90% purity, 68% yield).
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 135
TABLE-US-00020 Int. No. Structure Starting Materials Intermediate 149
Preparation of Intermediate 138:
[1256] ##STR00417##
[1257] HCl in water (0.376 mL, 0.1 M, 0.038 mmol) was added to a stirred solution of intermediate 123 (550 mg, 2.51 mmol) and m-CPBA (1.237 g, 5.02 mmol) in THF (9.8 mL). The mixture was heated at reflux for 24 h. The mixture was cooled down to rt, diluted with EtOAc and washed with NaOH 1N (×3), water (×1), sat Na.sub.2S.sub.2O.sub.3 (×3), dried over sodium sulfate, filtered and evaporated to dryness. The crude was purified by by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 10% to 70% to give intermediate 138 (300 mg, yield 54.3%) as a colorless oil.
Preparation of Intermediate 127, 140a & 140b:
[1258] ##STR00418##
[1259] Intermediate 126 (6.10 g, 11.9 mmol) was dissolved in MeOH (48 mL) and added under nitrogen to Pd/C (10% w/w) (1.90 g, 1.78 mmol), and the mixture was hydrogenated at 1 bar hydrogen at r.t. during 16 h. The reaction was filtered over Celite®, evaporated to dryness to afford 5.3 g of crude product. 400 mg of crude product was purified by prep HPLC and the remaining was purified by reversed-phase prep HPLC purification (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give intermediate 127 (1.58 g, yield 42.3%) as white solid. A further purification was performed via Prep SFC (Stationary phase: Chiralpak Diacel AD 20×250 mm, Mobile phase: CO.sub.2, iPrOH+0.4 iPrNH.sub.2). The first fraction was collected as intermediate 140a and the second fraction as intermediate 140b.
Preparation of Intermediate 141:
[1260] ##STR00419##
[1261] Potassium tert-butoxide (0.68 mL, 1 M in THF, 0.681 mmol) was added under nitrogen to a solution of intermediate 127 (179 mg, 0.568 mmol) in anhydrous dioxane (2.6 mL) at rt. After 10 min, this solution was added to a solution of intermediate 138 (300 mg, 1.36 mmol) in dioxane (2.6 mL). The mixture was stirred at 80° C. overnight. The mixture was evaporated to dryness and purified by by silica gel column chromatography eluting with methanol in dichloromethane from 2% to 15% to give intermediate 141 (145 mg, yield 49.5%) as a pale yellow solid.
Preparation of Intermediate 142:
[1262] ##STR00420##
[1263] TFA (1.5 mL, 20.3 mmol) was added to a stirred solution of intermediate 142 (145 mg, 0.281 mmol) in DCM (1.5 mL). After 30 min the reaction was evaporated to dryness, and the crude product was dissolved in MeOH and added to a column loaded with SiliaBond® propylsulfonic acid resin. The column was first eluted with MeOH (10 mL), followed by NH.sub.3 in MeOH (7 N, 5 mL). The tubes containing the product were concentrated under reduced pressure to give intermediate 142 (99 mg, yield 84.7%) as a yellow solid.
Preparation of Compound 489:
[1264] ##STR00421##
[1265] A mixture of intermediate 142 (50 mg, 0.12 mmol) and tert-butyl 4-formylpiperidine-1-carboxylate (51.3 mg, 0.241 mmol) in MeOH (1.20 mL) was stirred for 30 min after which sodium cyanoborohydride (15.1 mg, 0.241 mmol) was added. The reaction mixture was stirred at rt for 2 h, after which it was quenched with water. The mixture was purified on a column loaded with SiliaBond® propylsulfonic acid resin. The column was first eluted with MeOH (10 mL), followed by NH.sub.3 in MeOH (7 N, 4 mL). The tubes containing the product were concentrated under reduced pressure to give Compound 489 (64 mg, yield 79%) as a yellow solid.
Preparation of Compound 490:
[1266] ##STR00422##
[1267] TFA (0.57 mL, 7.40 mmol) was added to a stirred solution of Compound 489 (63 mg, 0.10 mmol) in DCM (0.58 mL). After 30 min the reaction was evaporated to dryness, and the crude product was dissolved in MeOH (2 mL), stirred for 30 min and added to a column loaded with SiliaMetS® Diamine resin, filtered and evaporated to dryness to give Compound 490 (55 mg, quantitative yield) as a yellow solid.
Preparation of Intermediate 147:
[1268] ##STR00423##
[1269] 3,3-difluoropyrrolidine. HCl (0.30 g, 2.1 mmol) was suspended in DCM (10 mL). Next, the mixture was cooled to 0° C. in an ice bath. Then, triethylamine (0.73 mL, 5.2 mmol) was added and the mixture stirred at 0° C. for −5 min. Next, chloroacetylchloride (0.18 mL, 2.2 mmol) was added dropwise. The resulting mixture was stirred at 0° C. for ˜1 h, after which water was added. Then, the mixture was stirred for an additional 5 min, after which it was transferred to a separatory funnel. Next, 1M aq. HCl solution was added and the layers were separated. The organic layer was dried over Na.sub.2SO.sub.4, filtered and evaporated to dryness to give intermediate 147 as a dark coloured oil (0.29 g, yield 76%).
The Following Intermediate was Synthesized by an Analogous Method as Described for Intermediate 147
[1270]
TABLE-US-00021 Int. No. Structure Starting Materials Intermediate 148
Preparation of Compound 491:
[1271] ##STR00425##
[1272] To a mixture of intermediate 27 (70 mg, 0.171 mmol) in NMP (3 mL) was added intermediate 149 (182.7 mg, 0.51 mmol), DIEA (0.088 mL, 0.51 mmol) and potassium iodide (28.4 mg, 0.17 mmol) at rt. Then the mixture continued to stir for 6 h at 80° C. The mixture was diluted by water and extracted with DCM three times. The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and concentrated. The residue was purified by RP silica gel column chromatography eluting with MeCN in water with 0.05% formic acid from 5% to 95% to afford Compound 491 (50 mg, 49% yield) as a yellow oil.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 491
TABLE-US-00022 Co No. Structure Starting Materials Compound 492
Preparation of Intermediate 179:
[1273] ##STR00432##
[1274] To a solution of Compound 501 (70 mg, 0.055 mmol) in methanol (3 mL) and tetrahydrofuran (3 mL) was added 2 M aqueous lithium hydroxide hydrate solution (0.14 mL, 0.274 mmol). The mixture was stirred at room temperature for 1 hour. The mixture was concentrated under reduced pressure. The residue was dissolved in water (10 mL) and washed with ethyl acetate (10 mL) for three times. The combined aqueous phase was acidified with 1 M aq. hydrogen chloride to pH=1 and the precipitate was filtered and dried in vacuo to give intermediate 179, which used directly in the next step.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 179
TABLE-US-00023 Int. No. Structure Starting Materials Intermediate 209
Preparation of Intermediate 180:
[1275] ##STR00438##
[1276] n-Butyllithium (2.5 M in hexane, 2.41 mL, 6.02 mmol) was added dropwise to a solution of 2,2,6,6-tetramethylpiperidine (0.88 g, 6.02 mmol) in tetrahydrofuran (11 mL) under N.sub.2 at −40° C., after which the mixture was stirred at −40° C. for an extra 30 min. A solution of bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)methane (1.35 g, 5.02 mmol) in tetrahydrofuran (11 mL) was next added dropwise at −78° C. The resulting mixture was stirred at −78° C. for 30 min after which a solution of I-tert-butyl-2-methyl-4-oxopyrrolidine-1-carboxylate (1.0 g, 5.02 mmol) in tetrahydrofuran (11 mL) was added dropwise at −78° C. The mixture was allowed to warm to room temperature and stirred overnight. The mixture was quenched with saturated aq. ammonium chloride solution at 0° C. and stirred for an extra hour at 0° C. The precipitate was removed by filtration and the filtrate diluted with water and ethyl acetate. Phases were separated and the water layer was extracted with ethyl acetate. The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated. The crude product was purified by silica column chromatography eluting with ethyl acetate in heptane from 0% to 10% to give intermediate 180 (958 mg, yield 59%).
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 180
TABLE-US-00024 Int. No. Structure Starting Materials Intermediate 181
Preparation of Intermediate 182
[1277] ##STR00443##
[1278] A reaction flask was consecutively charged with intermediate 6 (921 mg, 2.28 mmol), dioxane (7.1 mL), water (0.9 mL), intermediate 180 (958 mg, 2.96 mmol), cesium carbonate (1.49 g, 4.56 mmol) and 1,1′-bis(diphenylphosphino)ferrocene dichloropalladium(II) dichloromethane complex (186 mg, 0.23 mmol), degassed and refilled with nitrogen. The resulting mixture was stirred at 100° C. for 5 h. The reaction mixture was diluted with water and ethyl acetate. Phases were separated and the water layer was extracted with ethyl acetate. The combined organic layers were washed with brine, dried over MgSO.sub.4, filtered and concentrated. The crude product was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 4% to give intermediate 182 (1.08 g, yield 87%) as a foam.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 182
TABLE-US-00025 Int. No. Structure Starting Materials Intermediate 183
Preparation of Intermediate 184 & 185:
[1279] ##STR00451##
[1280] To a mixture of intermediate 182 (1.08 g, 2.07 mmol) in MeOH (100 mL) was added a catalytic amount of Pd/C (10% w:w) (221 mg, 0.207 mmol) and the solution was stirred under H.sub.2 atmosphere overnight. Then, the mixture was filtered over Celite®, the Celite® washed with MeOH. The filtrate was concentrated under reduced pressure and the residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 5% to give the mixture of diastereomers (1030 mg, yield 91%) as a white foam, which were separated by chiral prep SFC (Stationary phase: Chiralpak Diacel AD 20×250 mm, Mobile phase: CO.sub.2, iPrOH+0.4 iPrNH.sub.2) to give intermediate 184 (192 mg, yield 18%) and intermediate 185 (551 mg, yield 51%). The absolute configuration was determined by NMR.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 184 & 185
TABLE-US-00026 Int. No. Structure Starting Materials Intermediate 186
Preparation of Intermediate 192:
[1281] ##STR00461##
[1282] A reaction flask was consecutively charged with tert-butyl carbamate (4.6 g, 39.0 mmol), sodium benzenesulfinate (9.6 g, 58.5 mmol), THF (16 mL), water (39 mL), 2-(tetrahydro-2H-pyran-4-yl)acetaldehyde (5.0 g, 39.0 mmol) and formic acid (10.3 mL, 273.1 mmol). The reaction mixture was stirred for 4 days at r.t. The precipitate was isolated by filtration, washed with water and dried in a vacuum oven at 50° C. to give intermediate 192 (10.9 g, yield 76%) as a white fluffy solid.
Preparation of Intermediate 193:
[1283] ##STR00462##
[1284] To a solution of allyl acetoacetate (5.0 g, 35.2 mmol), 4-acetamidobenzenesulfonyl azide (9.3 g, 38.7 mmol) in MeCN (176 mL) at 0° C. was added dropwise Et.sub.3N (9.8 mmol, 70.3 mmol). The reaction mixture was allowed to warm to room temperature and stirred for 3 h. The solvent was removed under reduced pressure. The residue was suspended in diethyl ether and the solid (4-acetamidobenzenesulfonamide) was removed by filtration. The filtrate was concentrated under reduced pressure and the crude product purified by silica gel column chromatography eluting with ethyl acetate in heptane from 0% to 20% to give intermediate 193 (4.9 g, yield 83%) as a yellow oil.
Preparation of Intermediate 194:
[1285] ##STR00463##
[1286] NaH (758 mg (60% dispersion in mineral oil), 18.9 mmol) was added portionwise to a solution of intermediate 192 (3185 mg, 18.9 mmol) in THF (80 mL) at r.t., after which stirring was continued for 20 min. Simultaneously Li-HMDS (18.9 mL, 1M in THF, 18.9 mmol) was added to a solution of intermediate 193 (3186 mg, 18.9 mmol) in THF (80 mL) at −78° C. The reaction mixture was stirred for 10 min at −78° C. after which the above reaction solution was added. The resulting reaction mixture was stirred for an additional 60 min after which it was quenched with 10 M acetic acid in THF. The mixture was warmed to room temperature and partitioned between EtOAc and water. The organic layer was separated, washed with water and brine, dried (MgSO.sub.4), filtered and concentrated in vacuo. The residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 2% to give intermediate 194 (3.44 g, yield 46%).
Preparation of Intermediate 195:
[1287] ##STR00464##
[1288] A mixture of intermediate 194 (500 mg, 1.26 mmol) and Rh.sub.2(OAc).sub.4 (14 mg, 0.03 mmol) in DCM (30 mL) was stirred under a nitrogen atmosphere at rt for 2 hr. The reaction mixture was transferred as such to be purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 2% to give intermediate 195 (262 mg, yield 57%) as a yellow oil.
Preparation of Intermediate 196:
[1289] ##STR00465##
[1290] Pd(PPh3).sub.4 (8 mg, 0.007 mmol) and morpholine (750 mg, 8.61 mmol) were added to a solution of intermediate 195 (2110 mg, 5.74 mmol) in THF (136 mL) and stirred at room temperature overnight. The reaction mixture was concentrated to give a crude product which was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 2% to give intermediate 196 (1.2 g, yield 74%).
Preparation of Intermediate 201—Method A:
[1291] ##STR00466##
[1292] Into a 2 L 4-necked round-bottom flask were added THF (345 mL) and Zn (120.87 g, 1847.90 mmol, 5.00 equiv) at 30° C. under a nitrogen atmosphere. A solution of TMSCl (8.03 g, 73.91 mmol, 0.2 equiv) and 1-bromo-2-chloroethane (10.60 g, 73.91 mmol, 0.20 equiv) in THF (230 mL) were added into above round-bottom flask with a Lead Fluid-BT100F peristaltic pump (rate: 10 mL/min) under a nitrogen atmosphere. The resulting mixture was stirred for additional 40 min at 30° C. Next, a Lead Fluid-BT100F peristaltic pump was used to remove the solvent in above RBF quickly, and then fresh THF (575 mL) was re-charged under a nitrogen atmosphere. The mixture was heated to 60° C. Next, a solution of tert-butyl (3R)-3-(iodomethyl)pyrrolidine-1-carboxylate (115 g, 369.58 mmol, 1.00 equiv) in THF (575 mL) was added into above RBF with a Lead Fluid-BT100F peristaltic pump (rate: 15.0 mL/min) under a nitrogen atmosphere (temperature rises to 60-65° C.). The solution was stirred at 60° C. for an additional 1 h. The mixture was then cooled to 30° C. and allowed to stand for 1 h. The solution of {[(3R)-1-(tert-butoxycarbonyl)pyrrolidin-3-yl]methyl}(iodo)zinc was used directly in the next step. The concentration of the product was about 0.37 moL/L in THE Into a 2 L 4-necked round-bottom flask were added intermediate 6 (105 g, 259.71 mmol, 1.00 equiv) and THF (500 mL) at 30° C. under nitrogen atmosphere. To the stirred solution was added the 4th Generation RuPhos Pd precatalyst (5.65 g, 6.49 mmol, 0.025 equiv) under nitrogen atmosphere. Next, the solution of {[(3R)-1-(tert-butoxycarbonyl)pyrrolidin-3-yl]methyl}(iodo)zinc was added with a Lead Fluid-BT100F peristaltic pump into the 2 L 4-need RBF quickly under a nitrogen atmosphere (the excess zinc dust was not transferred). The resulting mixture was stirred for an additional 16 h at 50° C. The reaction was repeated 6 times in parallel. The reaction was quenched by the addition of aqueous sat. NH.sub.4Cl solution (12 L). The aqueous layer was extracted with EtOAc (3×6 L), the organic layer was washed with water (2×3 L) and brine (1×3 L). The resulting mixture was dried with Na.sub.2SO.sub.4 and concentrated under reduced pressure. The crude product as a black oil (1100 g, crude) was used directly into the next step (preparation of intermediate 202)
Alternatively, the Procedure Described Below can be Employed for the Preparation of Intermediate 201—Method B
[1293] A column (1.5 cm×15 cm) was stoppered with cotton wool and filled with granular zinc (20-mesh), 22 g. The column volume of the filled column was determined by measuring the time for THF to fill the column at 1 m/min flow rate. Column volume=4.3 mL. The zinc was activated by flowing a strong activating solution through the column at 0.5 mL/min for 10 mins. The strong activating solution consists of 1 mL TMSCl (0.67 M) & 0.75 mL chlorobromoethane (0.71 M) in 10 mL THF. After activation, the column was washed with dry THF: 10 mL, 1 ml/min. tert-butyl (R)-3-(iodomethyl)pyrrolidine-1-carboxylate (10 g, 37 mmol) was dissolved in THF (60 mL). The iodide solution was flowed through the activated zinc column at 50° C., flow rate 0.45 mL/min. After reaction: titration with iodine shows a concentration of 0.30 M.
[1294] Intermediate 6 (1.2 g, 2.4 mmol) was added with RuPhos Pd G4 (0.051 g, 0.06 mmol) in a sealed vial with a stirring bar in a glove box. Then, a solution of freshly made R-((1-(tert-butoxycarbonyl)-3-yl)methyl)zinc(II) iodide (12 mL, 0.3 M, 3.6 mmol) which was prepared by the above procedure was added. Next, the solution was heated to 50° C. under nitrogen atmosphere during 16 h. The solution was concentrated in vacuo and the residue redissolved in DCM. Next, water was added, followed by aq. Na.sub.4EDTA solution (pH>10). The layers were separated and the water layer was extracted once more with DCM. Organic layers were combined, dried over Na.sub.2SO.sub.4, filtered and evaporated to dryness. The residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 000 to 10% to give intermediate 201 (1.4 g, 1.5 mmol (55% purity), 63& yield).
The Following Intermediates were Synthesized by an Analogous Method (Method B) as Described for Intermediate 201
TABLE-US-00027 Int. No. Structure Starting Materials Intermediate 212
Preparation of Intermediate 202:
[1295] ##STR00478##
[1296] The mixture of intermediate 201 (17 g, 33.09 mmol) in dichloromethane (50 mL), was added the solution 24 mL of chlorine hydride (7 M in ethyl acetate). After stirring at r.t. for 5 h, the reaction mixture was concentrated, and the residue was diluted with DCM and basified with sodium hydroxide aqueous solution (1M) to pH˜ 10. The layers were separated and the aqueous layer was extracted with DCM three times and the combined organic layer was washed with brine (30 mL), dried over sodium sulfate, filtered and concentrated to afford intermediate 202 (13 g, 31.1 mmol, 94.2% yield) as a yellow solid, which was used in the next step without purification.
[1297] Alternatively, intermediate 202 can also be prepared as a 0.2TFA salt by using the following procedure:
[1298] Intermediate 201 (5.2 g, 6.95 mmol, 68% pure) is dissolved in DCM (44.5 mL) and TFA (5.3 mL) was added and stirred for 4 h at rt. The solution was concentrated in vacuo and coevaporated with toluene. Next, the mixture was washed with 1M NaOH and extracted four times with 10 DCM and EtOAc and Me-THF to obtain the combined organics which were then dried with anhydrous Na.sub.2SO.sub.4, filtered and concentrated in vacuo. The residue was purified via by silica gel column chromatography eluting with methanol (containing 7N NH.sub.3) in dichloromethane from 0% to 10% to give intermediate 202 as a 0.2TFA salt.
[1299] Alternatively, intermediate 202 can also be prepared with the following procedure:
[1300] Into a 10 L 4-necked round-bottom flask were added 4N HCl in 1,4-dioxane (1.8 L). Then, crude intermediate 201 in THF (3 L) was added dropwise (calculated by 735 g intermediate 201, 1.82 mol, 1.0 equiv) at 0° C. The resulting mixture was stirred for an additional 2 h at 0° C. The resulting mixture was diluted with ethyl acetate (3 L) and water (3 L). The aqueous layer was washed with DCM (10×1 L). The pH of the aqueous layer was adjusted to pH 8 with saturated aqueous Na.sub.2CO.sub.3 solution and extracted with CH.sub.2Cl.sub.2 (4×2 L). The organic layers were dried with Na.sub.2SO.sub.4 and concentrated under vacuum to afford intermediate 202 (389 g, yield 53% over 2 steps) as a light yellow solid.
The Following Intermediate were Synthesized by an Analogous Method as Described for Intermediate 707
TABLE-US-00028 Int. No. Structure Starting Materials Intermediate 225
Preparation of Intermediate 203:
[1301] ##STR00481##
[1302] A stir bar, 4,4′-di-tert-butyl-2,2′-bipyridine (69.6 mg, 0.259 mmol), DME (40 mL), nickel(II) chloride ethylene glycol dimethyl ether complex (65.2 mg, 0.297 mmol) were added to 40 mL glass bottle, the mixture was purged with argon for 15 min, then intermediate 6 (1 g, 2.474 mmol), tert-butyl 3-(bromomethyl)-3-methylazetidine-1-carboxylate (1.3 g, 4.921 mmol), Ir[dF(CF.sub.3)ppy].sub.2(dtbpy))PF.sub.6 (282.6 mg, 0.252 mmol), sodium carbonate (782.6 mg, 7.384 mmol) and tris(trimethylsilyl)silane (1.3 mL, 4.214 mmol, 0.806 g/mL) were added to the mixture, the mixture was purged with argon for 15 min. The vial was sealed with parafilm and irradiated with blue light for 12 hours. The reaction mixture was diluted with dichloromethane (50 mL) and the saturated solution of sodium bicarbonate (50 mL) was added, the mixture was extracted with dichloromethane (40 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue which was purified by preparative-HPLC (Column: Boston Uni C18 40*150*5 um, Mobile Phase A: water, Mobile Phase B: acetonitrile, Flow rate: 60 mL/min, gradient condition from 30% B to 60% B). The pure fractions were collected and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give intermediate 203 (380 mg, 92.2% purity, 21.9% yield).
Preparation of Compound 498:
[1303] ##STR00482##
[1304] A stir bar, intermediate 25 (300 mg, 0.760 mmol), MeCN (3 mL), intermediate 207 (230 mg, 0.919 mmol), potassium carbonate (318 mg, 2.30 mmol) and potassium iodide (252 mg, 1.52 mmol) were added into a 8 mL glass. The reaction mixture was heated and stirred at 100° C. for 2 h under microwave irradiation. The reaction mixture was filtered through a pad of Celite®, the filter cake was washed with MeCN (5 mL×5). The combined filtrates were concentrated under reduced pressure to give the crude product which was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 9% to give Compound 498 (270 mg, 43.5% purity, 28.1% yield) as yellow solid.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 498
[1305]
TABLE-US-00029 Co No. Structure Starting Materials Compound 499
Preparation of Intermediate 211:
[1306] ##STR00484##
[1307] A mixture of Compound 92 (53 mg, 0.097 mmol) and iodine (2.5 mg, 0.01 mmol) in acetone (1.2 mL) was stirred at refluxing temperature (56° C.) for 10 min. The mixture was evaporated to dryness, and the crude was purified by silica gel column chromatography eluting with methanol (+1% NH.sub.3 (7N) in methanol) in dichloromethane from 1% to 10% to give intermediate 211 (35 mg, yield 58.9%) as a white solid.
The Following Intermediate was Synthesized by an Analogous Method as Described for Intermediate 211
[1308]
TABLE-US-00030 Int. No. Structure Starting Materials Intermediate 264
Preparation of Intermediate 216:
[1309] ##STR00486##
[1310] To a solution of (S)-tert-butyl 2-(hydroxymethyl)piperidine-1-carboxylate (400 mg, 1.86 mmol) in dichloromethane (8 mL) was added triethylamine (376 mg, 3.72 mmol) and methanesulfonyl chloride (277 mg, 2.42 mmol) at 0° C. The mixture was stirred at 0° C. for 60 minutes. The reaction was quenched with water and the mixture was diluted with dichloromethane, washed with 0.5M HCl (aq.), dried over Na.sub.2SO.sub.4, and concentrated to give intermediate 216 (385 mg, 17.5% purity from LCMS, 12.3% yield) as yellow oil which was used directly in the next step without further purification.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 216
TABLE-US-00031 Int. No. Structure Starting Materials Intermediate 222
Preparation of Intermediate 221:
[1311] ##STR00490##
[1312] To a solution of cyclopropylamine (2 g, 33.3 mmol) in dichloromethane (25 mL) in an ice water bath was added triethylamine (10.1 g, 99.8 mmol) and phenyl chloroformate (5.2 g, 33.3 mmol) in five portions. The reaction mixture was stirred at room temperature for 2 hours. It was poured into water and extracted with dichloromethane (30 mL) twice. The organic layer was washed with brine (30 mL), dried over sodium sulfate, filtered and concentrated to afford the crude product, which was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 20% to give intermediate 221 (4.22 g, 98% purity, 70.1% yield) as a white solid.
Preparation of Intermediate 233:
[1313] ##STR00491##
[1314] 2,2,6,6-tetramethylpiperidine (3.90 g, 27.6 mmol) was dissolved in THF (50 mL) and cooled to −30° C. under N.sub.2 atmosphere. n-BuLi (12.0 mL, 30.0 mmol, 2.5 M in n-Hexane) was added dropwise, and the reaction mixture was stirred at the same temperature for 30 minutes. Next, the reaction mixture was cooled to −78° C., and a solution of 2,2′-(ethane-1,1-diyl)bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolane) (6.00 g, 21.3 mmol) in THF (30.0 mL) was added dropwise at −78° C. After stirring for 30 min, a solution of 1-boc-3-azetidinone (4.40 g, 25.7 mmol) in THF (40 mL) was added dropwise at −78° C. The reaction mixture was warmed to 25° C. slowly and stirred at 25° C. for 12 hours. The reaction mixture was cooled to 0° C. and quenched with aq. NH.sub.4Cl solution (30 mL). After additional stirring for 10 minutes, the resulting mixture was concentrated under reduced pressure to remove THF, the residue was extracted with ethyl acetate (40 mL×2), and the organic layers were washed with brine (50 mL×1), dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The crude was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 0% to 6% to give intermediate 233 (4.00 g, 70% purity, 42.56% yield) as a colorless liquid.
Preparation of Compound 500:
[1315] ##STR00492##
[1316] To a mixture of intermediate 202 (200 mg, 0.49 mmol) in EtOH (4 mL) and H.sub.2O (0.4 mL) was added tert-butyl 1-oxa-6-azaspiro[2.5]octane-6-carboxylate (114.9 mg, 0.539 mmol) and TEA (49.6 mg, 0.49 mmol). The mixture was stirred at 25° C. for 12 hours. The mixture was neutralized with aqueous Na.sub.2CO.sub.3 (10 mL), poured into H.sub.2O (20 mL) and extracted with DCM (3×20 mL). The combined organic layer was dried over anhydrous Na.sub.2SO.sub.4 which was purified by preparative-HPLC (Column: Welch Xtimate C18 150*30 mm*5 um, Mobile Phase A: water (NH.sub.3H.sub.2O+NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 35 mL/min, gradient condition from 47% B to 77% B). The pure fractions were collected and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give Compound 500 (100 mg, 30.94% yield) as a white powder.
Preparation of Intermediate 258:
[1317] ##STR00493##
[1318] 1-(tetrahydro-2H-pyran-4-yl)ethan-1-one (2.5 g, 19.5 mmol) was dissolved in MeOH (39.5 mL) and NBS (3471.6 mg, 19.5 mmol) was added and the solution was stirred for 3 hours at 50° C. The reaction mixture was concentrated in vacuo and redissolved in DCM and washed with water three times. The combined organics were dried and purified by silica gel column chromatography eluting with 30% ethyl acetate in heptane to give intermediate 258 (2.4 g, 59% yield).
The Following Intermediate was Synthesized by an Analogous Method as Described for Intermediate 258
[1319]
TABLE-US-00032 Int. No. Structure Starting Materials Intermediate 265
Preparation of Intermediate 259:
[1320] ##STR00495##
[1321] Intermediate 258 (100 mg, 0.483 mmol) was dissolved in DMF (3.7 mL) and KOAc (142.19 mg, 1.449 mmol) was added and stirred for 4 hr at rt. The solution was extracted with EtOAc and washed with brine, and the combined organic layers were dried over Na.sub.2SO.sub.4 anhydrous, concentrated in vacuo and purified by silica gel column chromatography eluting with ethyl acetate in heptane from 0% to 100% to give intermediate 259 (65 mg, 72% yield) as an oil.
_Preparation of Intermediate 266:
[1322] ##STR00496##
[1323] Intermediate 265 (0.50 g, 1.0 mmol, 50% purity) was dissolved in MeOH (12 mL), after which sodium formate (0.41 g, 6.0 mmol) was added. The resulting solution was heated at 55° C. overnight, after which it was evaporated to dryness. The residue was suspended in DCM and purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 9% to give intermediate 266 (0.16 g, 0.78 mmol, 77% yield).
Preparation of Intermediate 274:
[1324] ##STR00497##
[1325] 1-bromo-3-chloropropane (0.37 mL, 3.76 mmol) was added to a stirred suspension of 2,5-difluorobenzenethiol (0.50 g, 3.42 mmol) and K.sub.2CO.sub.3 (0.61 g, 4.4 mmol) in anhydrous DMF (6.6 mL) and the mixture was left under stirring for overnight at rt. The mixture was diluted with water and extracted with EtOAc (×3). Reunited organic phases were washed with water (×2), brine (×1), dried over anhydrous sodium sulfate, filtered and evaporated to dryness to give intermediate 274 (951 mg, yield 93.6%) as a colorless oil. The desired product was used in the next step without further purification.
Preparation of Intermediate 275:
[1326] ##STR00498##
[1327] Iodobenzene diacetate (1.14 g, 3.54 mmol) was added to a solution of intermediate 274 (0.5 g, 1.684 mmol) and ammonium carbamate (0.276 g, 3.54 mmol) in MeOH (3.4 mL) at r.t. and the reaction mixture was stirred at r.t. overnight. The reaction mixture was diluted with water and extracted with DCM (×3). Reunited organic phases were dried over sodium sulfate, concentrated under reduced pressure and purified by silica gel column chromatography eluting with ethyl acetate in heptane from 10% to 100% to give intermediate 275 (281 mg, yield 65.7%) as a pale yellow oil.
Preparation of Intermediate 276:
[1328] ##STR00499##
[1329] NH.sub.3 (0.1% in H.sub.2O, 4.3 mL) was added to intermediate 275 (288 mg, 1.13 mmol) in MeOH (0.5 mL) into a microwave vial, which was sealed and heated at 80° C. for 5 h. The solvent reaction was cooled down at rt, quenched with NaOH 1N, and extracted with EtOAc (×3). Reunited organic phases were washed with water, brine, dried over anhydrous sodium sulfate, filtered, and evaporated to dryness to afford intermediate 276 (213 mg, yield 86.4%) as a colorless oil.
Preparation of Intermediate 299:
[1330] ##STR00500##
[1331] Intermediate 265 (0.50 g, 0.79 mmol) was dissolved in acetone (15 mL), after which, NaN.sub.3 was added (0.16 g, 2.4 mmol). The mixture was stirred 50° C. for 1 h, after which the mixture was cooled to ambient temperature. Then, the mixture was filtered and evaporated to dryness. The residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 10% to give intermediate 299 (510 mg, 2.4 mmol).
Preparation of Intermediate 300:
[1332] ##STR00501##
[1333] Intermediate 299 (0.40 g, 1.95 mmol) was dissolved in THF (20 mL), after Ac.sub.2O (0.18 mL, 2.0 mmol) and trimethylphosphine in THF (1M solution, 3.9 mL, 3.9 mmol) were added. The mixture was stirred at ambient temperature for 3 h. Then, MeOH was added and the mixture stirred at ambient temperature for ˜5 min. Next, the mixture was evaporated to dryness and the residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 8% to give intermediate 300 (0.24 g, yield: 54%).
Preparation of Intermediate 324:
[1334] ##STR00502##
[1335] Intermediate 258 (320 mg, 1.54 mmol) in MeCN (3.2 mL) was treated sequentially with K.sub.2CO.sub.3 (640.7 mg, 4.6 mmol) and dimethylamine (2.3 mL, 2 M, 4.6 mmol). After stirring overnight at room temperature, the mixture was charged with aqueous 1N NaOH (2 mL), and the layers were separated. The aqueous layer was extracted with EtOAc (2×5 mL). The combined organic layers were dried over Na.sub.2SO.sub.4 anhydrous and concentrated under reduced pressure. The crude oil was further purified by silica gel column chromatography eluting with ethyl acetate (containing 25% EtOH) in heptane from 0% to 100% to give intermediate 324 as an oil (199 mg, 75% yield).
Preparation of Intermediate 327:
[1336] ##STR00503##
[1337] To a solution of tert-butyl 4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate (2.5 g, 9.18 mmol) in tetrahydrofuran (30 ml) at 0° C. was added ethylmagnesium chloride (3.26 g, 36.7 mmol) and the resulting suspension was allowed to stir at room temperature for 4 hrs. After stirring at room temperature for 12 hours, the mixture was diluted with EtOAc, washed with sat. NH.sub.4Cl and concentrated. The residue was purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 20% to 100% to give intermediate 327 (3.1 g, yield: 83%).
Preparation of Intermediate 332:
[1338] ##STR00504##
[1339] A solution of tetrahydro-2H-pyran-4-carbaldehyde (4 g, 33.29 mmol) in THF (20 mL) was dropwise vinylmagnesium bromide (67 mL) for 30 min at 0° C. The mixture was stirred at room temperature overnight. The mixture were quenched with 20 mL of NH.sub.4Cl (aq) at 0° C. and extracted with EtOAc (20 mL*3). The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the crude product, which was purified by silica gel column chromatography eluting with EtOAc in petroleum ether from 0% to 50% to give intermediate 332 (3 g, 57.0% yield) as a colourless oil.
Preparation of Intermediate 333:
[1340] ##STR00505##
[1341] To a solution of intermediate 332 (3 g, 20.04 mmol) in dichloromethane (50 mL) was added Dess-Martin Periodinane (13.28 g, 30.06 mmol) at 0° C. After stirring at 20° C. for 5 h, the mixture was basified to pH 7-8 with saturated sodium bicarbonate aqueous solution and extracted with DCM (30 mL) for three times. The combined organic layers were washed with brine (30 mL), dried over Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated under vacuum and purified by silica gel column chromatography eluting with 20% ethyl acetate in petroleum ether to give the intermediate 333 (1.5 g, 48.05% yield) as a yellow oil.
Preparation of Intermediate 334:
[1342] ##STR00506##
[1343] To a solution of intermediate 333 (500 mg, 3.21 mmol) in methanol (10 mL), was added sodium carbonate (aq.) (6.4 mL, 6.4 mmol) at rt. After stirring at rt for 18 h. The reaction mixture was quenched with H.sub.2O (10 mL) and extracted with DCM. The combined organic phase was washed with brine, dried by Na.sub.2SO.sub.4, filtered and concentrated and purified by silica gel column chromatography eluting with 10% ethyl acetate in petroleum ether to give intermediate 334 (400 mg, 57.8% yield) as a yellow oil.
Preparation of Intermediate 335:
[1344] ##STR00507##
[1345] To a solution of intermediate 333 (1 g, 6.42 mmol) in H.sub.2O/MeCN (20 mL/5 mL), was added chromium(II) chloride (204 mg, 1.28 mmol) at rt. After stirring at 80° C. for 18 h, the reaction mixture was quenched with H.sub.2O (10 mL) and extracted with DCM. The combined organic phase was washed with brine, dried by Na.sub.2SO.sub.4, filtered and concentrated and purified by silica gel column chromatography eluting with ethyl acetate in petroleum ether from 50% to 100% to give intermediate 335 (800 mg, 63% yield) as a yellow oil.
Preparation of Intermediate 361:
[1346] ##STR00508##
[1347] Intermediate 4 (3.3 g, 9.451 mmol) was dissolved in MeOH (38.2 mL) and cooled to 0° C. before thionyl chloride (13.7 mL, 189.0 mmol) was added dropwise. The solution was then heated to 70° C. for 2 hours. After cooling to ambient temperature, the solution was concentrated in vacuo and directly purified by silica gel column chromatography eluting with methanol (containing 7N NH.sub.3) in dichloromethane from 0% to 10% to give intermediate 361 (3.7 g, 100% yield) as an oil.
Preparation of Intermediate 366:
[1348] ##STR00509##
[1349] Compound 527 (1.8 g, 3.66 mmol, 92% pure) was dissolved in THF (29.8 mL) and water (6.62 mL) and LiOH (175.6 mg, 7.3 mmol) was added. The solution was stirred at r.t. for 16 hours until full conversion. The solution was concentrated till dryness, then co-evaporated with tolunene till dryness to obtain intermediate 366 as lithium salt with 1 eq LiOH as excess as a solid (1.7 g, 90% yield).
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 366
TABLE-US-00033 Int. No. Structure Starting Materials Intermediate 370
Preparation of Compound 516:
[1350] ##STR00519##
[1351] Compound 530 (641 mg, 1.2 mmol) was dissolved in MeCN (2.4 mL) and DIPEA (3.3 mL, 19.15 mmol) and isobutyryl chloride (1279 mg, 12 mmol) was added. The resulting mixture was stirred at rt for 16 h. Afterwards, the crude mixture was diluted with DCM and washed with water. The organic phase was dried over Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure. The crude mixture was purified using silica gel column chromatography eluting with ethyl acetate in heptane from 0% to 100% to afford Compound 516 (454 mg, 71% yield).
The Following Intermediates were Synthesized by an Analogous Method as Described for Compound 516
TABLE-US-00034 Int. No. Structure Starting Materials Compound 517
Preparation of Compound 520:
[1352] ##STR00523##
[1353] Compound 530 (870 mg, 0.945 mmol) is dissolved in DMF (7.3 mL) and DIPEA (0.97 mL, 5.67 mmol) and 2-hydroxy-2-methyl-propanoic acid (118.0 mg, 1.13 mmol) then HATU (538.9 mg, 1.4 mmol) are added and stirred for 2 hours at rt. The solution is extracted with EtOAc and washed three times with water (50 mL) and the combined organics are dried with MgSO.sub.4 anhydrous, filtered and concentrated in vacuo. The crude was further purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 10% to give Compound 520 (450 mg, 85% yield).
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 520
TABLE-US-00035 Co No. Structure Starting Materials Compound 521
Preparation of Intermediate 1:
[1354] ##STR00525##
[1355] To a solution of intermediate 26 (300 mg, 98% purity, 0.72 mmol) in methanol (0.7 mL) were added intermediate 86 (457 mg, 95% purity, 2.16 mmol), sodium cyanoborohydride (136 mg, 2.16 mmol) and zinc chloride (294 mg, 2.16 mmol). The reaction mixture was heated up to 68° C. and stirred at this temperature overnight. After cooled down to r.t., the reaction mixture was concentrated and the residue was purified by prep. HPLC (column: SunFire C18 150*19 mm*5 um, Mobile Phase A: water (0.1% TFA), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 13% B to 20% B)). The collected fraction was lyophilized and the residue was basified with sodium hydroxide aqueous solution (1M), extracted with dichloromethane (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated to afford the free base of Compound 1 (120 mg, 99% purity, 25% yield) as a yellow solid. A solution of the free base (38 mg) and fumaric acid (12.6 mg) in water (5 mL) was freeze dried to give Compound 1 (50 mg, fumarate, 99.4% purity) as a yellow solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 1
TABLE-US-00036 Compound No. Structure Starting Materials Compound 2
Preparation of Compound 8:
[1356] ##STR00534##
[1357] To a solution of intermediate 72 (100 mg, 98% purity, 0.188 mmol) in methanol (2 mL) were added 1-(piperazin-1-yl)ethanone (48.2 mg, 0.376 mmol) and acetic acid (0.05 mL). The reaction mixture was stirred at room temperature for 30 minutes. Then sodium cyanoborohydride (23.6 mg, 0.376 mmol) was added into the mixture. After stirring at r.t. for 2 hours, the reaction mixture was basified with saturated NaHCO.sub.3 aqueous solution and extracted with dichloromethane (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over sodium sulfate, filtered and concentrated to afford the crude product, which was purified by Prep. HPLC (Column: SunFire C18 150*19 mm*5 um, Mobile Phase A: water (0.1% NH.sub.40Ac), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 10% B to 50% B) to give Compound 8 (100 mg, 99% purity, 83.1% yield) as a yellow gum.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 8
[1358] Alternatively, purification can also be performed using the following method: Prep. HPLC method (Column Welch Xtimate C18 150*25 mm*5 um, Mobile Phrase A: water (0.225% formic acid), mobile phase B: acetonitrile, Flow rate 25 mL/min, gradient condition from 1% B to 31% B).
TABLE-US-00037 Compound No. Structure Starting Materials Compound 8a
Preparation of Intermediate 9a:
[1359] ##STR00551##
[1360] To a solution of intermediate 73a (300 mg, 0.576 mmol) and 1-(piperazin-1-yl)ethanone (148 mg, 1.16 mmol) in anhydrous methanol (5 mL) was added acetic acid (69.2 mg, 1.15 mmol). The reaction mixture was heated up to 45° C. and stirred at this temperature for 30 minutes before the addition of sodium cyanotrihydroborate (72.4 mg, 1.15 mmol). After stirring at 45° C. for another 12 hours, the reaction mixture was cooled down to room temperature, diluted with dichloromethane (40 mL), basified to pH=8 with the saturated solution of sodium bicarbonate (30 mL) and extracted with dichloromethane (20 mL×3). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue, which was purified by preparative-HPLC (Column: Boston Green ODS 150*30 mm*5 um, Mobile Phase A: water (0.225% FA), Mobile Phase B: acetonitrile, Flow rate: 35 mL/min, gradient condition from 1% B to 30% B). The pure fractions were collected, and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give Compound 9a (200 mg, 98.7% purity, 47.3% yield) as a yellow solid.
Preparation of Compound 20:
[1361] ##STR00552##
[1362] At 0° C., to a solution of intermediate 89 (56.2 mg, 90% purity, 0.19 mmol) in methanol (2 mL) was added sodium hydroxide aqueous solution (0.07 mL, 1M) until the pH to 9. Then, intermediate 64 (67 mg, 0.094 mmol) and sodium cyanoborohydride (11.8 mg, 0.189 mmol) were added into the mixture. After stirring at r.t. for 4 hours, the reaction mixture was concentrated and the residue was purified with Prep. HPLC (Column: Xbridge C18 150*19 mm*5 um, Mobile Phase A: water (0.1% TFA), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 2% B to 30% B). The collected fraction was lyophilized and the residue was basified with sodium hydroxide aqueous solution (1M) and extracted with dichloromethane (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated to afford the product which was lyophilized to give Compound 20 (22.1 mg, 97.3% purity, 34% yield) as a white solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 20
TABLE-US-00038 Compound No. Structure Starting Materials Compound 21
Preparation of Compound 26a & 26b:
[1363] ##STR00562##
[1364] Triethylamine (113 mg, 1.12 mmol) was added to a solution of intermediate 89 (90 mg, 0.336 mmol) in dry dichloromethane (5 mL). Then intermediate 77 (120 mg, 0.223 mmol) was added. The reaction mixture was stirred at 25° C. for 30 minutes before the addition of sodium triacetoxyborohydride (95 mg, 0.448 mmol). After stirring at 25° C. for another 12 h, the reaction mixture was diluted with dichloromethane (50 mL) and saturated solution of sodium bicarbonate (50 mL). The mixture was extracted with dichloromethane (40 mL×3). The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue, which was purified by preparative-HPLC (Column: Welch Xtimate C18 150*25 mm*5 um, Mobile Phase A: water (0.225% FA), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 1% B to 28% B). The pure fractions were collected, and the solvent was evaporated under vacuum to give the mixture Compound 26a & 26b, which was further purified by preparative-HPLC (Column: Phenomenex Gemini-NX C18 75*30 mm*3 um, Mobile Phase A: water (0.04% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 35% B to 65% B). The pure fractions were collected, and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The first faction was lyophilized to dryness to give Compound 26a (25 mg, 96.7% purity, 16.0% yield) as a white powder and the second fraction was lyophilized to dryness to give Compound 26b (20.0 mg, 95.3% purity, 12.6% yield) as a white powder.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 26a & 26b
TABLE-US-00039 Compound No. Structure Starting Materials Compound 27a
Preparation of Compound 32a:
[1365] ##STR00567##
[1366] To a solution of intermediate 62a (240 mg, 70% purity, 0.324 mmol) in methanol (5 mL) were added 1-(piperazin-1-yl)ethanone (83 mg, 0.648 mmol) and acetic acid (0.05 mL). The reaction mixture was stirred at room temperature for 30 minutes. Then sodium cyanoborohydride (40.7 mg, 0.648 mmol) was added into the mixture. After stirring at r.t. for 1 hr, the reaction mixture was basified with saturated NaHCO.sub.3 aqueous solution and extracted with dichloromethane (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over sodium sulfate, filtered, and concentrated to afford the crude product, which was purified by prep. HPLC (Column: SunFire C18 150*19 mm*5 um, Mobile Phase A: water (0.1% TFA), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 2% B to 40% B). The collected fraction was lyophilized and the residue was basified with sodium hydroxide aqueous solution (1 M) and extracted with dichloromethane (20 mL) twice. The combined organic layer was washed with brine (20 mL), dried over Na.sub.2SO.sub.4, filtered and lyophilized to afford Compound 32a (90 mg, 97.8% purity, 43% yield) as a white solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 32
TABLE-US-00040 Compound No. Structure Starting Materials Compound 32b
Preparation of Compound 33a & 33b:
[1367] ##STR00570##
[1368] To a solution of intermediate 62a (82 mg, 80% purity, 0.126 mmol) in methanol (5 mL) was added 4-(methylsulfonyl)piperidine (41.3 mg, 0.25 mmol) and acetic acid (0.05 mL). The reaction mixture was heated to 25° C. and stirred at this temperature for 30 minutes. Then sodium triacetoxyborohydride (15.9 mg, 0.25 mmol) was added and the reaction mixture was stirred at this temperature overnight. The reaction mixture was concentrated, and the residue was purified by Prep. HPLC (Column: SunFire C18 150*19 mm*5 um, Mobile Phase A: water (0.1% TFA), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 10% B to 30% B). The collected fraction was lyophilized and the residue was basified with sodium hydroxide aqueous solution (1 M) and extracted with dichloromethane (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over Na.sub.2SO.sub.4, filtered and lyophilized to afford Compound 33a (40 mg, 99.8% purity, 47.4% yield) and Compound 33b (9 mg, 99.8% purity, 10.7% yield) as a white solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 33a & 33b
[1369] Alternatively, (additional) purification can also be performed using the following method Prep. HPLC method (Boston Green ODS 150*30 mm*5 um, Mobile Phase A: water (0.225% formic acid), Mobile Phase B: acetonitrile, Flow rate: 35 mE/min, gradient condition from 5% B to 35%).
TABLE-US-00041 Compound No. Structure Starting Materials Compound 34a
Preparation of Compound 41:
[1370] ##STR00585##
[1371] To a mixture of formaldehyde (194 mg, 6.46 mmol, 37% in H.sub.2O), Compound 376 (420 mg, 0.647 mmol) in MeOH (4 mL) was added NaOAc (265 mg, 3.23 mmol). The mixture was stirred at 25° C. for 1 h. Then NaBH.sub.3CN (81.6 mg, 1.30 mmol) was added to the mixture and the resulting mixture was stirred at 25° C. for 18 hours. The mixture was concentrated under reduced pressure to remove the solvent and the residue was diluted with ethyl acetate (10 mL), washed with saturated NaHCO.sub.3 (10 mL), H.sub.2O (10 mL) and brine (5 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give crude product, which was purified by preparative HPLC (Column: Boston Green ODS 150*30 mm*5 um, Mobile Phase A: water (0.225% FA), Mobile Phase B: acetonitrile, Flow rate: 35 mL/min, gradient condition from 10% B to 40% B). The pure fractions were collected, and the volatile solvent was evaporated under vacuum to give the residue, which was adjusted to pH=12 by NaOH (2 mol/L), then the mixture was extracted with ethyl acetate (20 mL). The organic phase was evaporated under vacuum to give the residue, which was lyophilized to afford the product (70 mg, purity 93.4%, yield 18%) as white solid.
Preparation of Compound 42:
[1372] ##STR00586##
[1373] To a solution of intermediate 26 (80 mg, 0.192 mmol) in methanol (0.7 mL) was added tetrahydro-2H-pyran-4-carbaldehyde (69.2 mg, 0.576 mmol), NaBH.sub.3CN (36.2 mg, 0.576 mmol) and acetic acid (0.05 mL). After stirring at r.t. overnight, the reaction mixture was concentrated and the residue was purified by prep. HPLC (Column: Xbridge C18 150*19 mm*5 um, Mobile Phase A: water (0.10% NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 30% B to 70% B). The collected fraction was lyophilized to give Compound 42 (40 mg, 99.5% purity, 40.9% yield) as a white solid.
Preparation of Compound 43:
[1374] ##STR00587##
[1375] To a mixture of intermediate 27 (90 mg, 0.22 mmol) and tetrahydro-2H-pyran-4-carbaldehyde (74 mg, 0.65 mmol) in methanol (2 mL) was added sodium cyanoborohydride (40 mg, 0.65 mmol). The reaction mixture was stirred at 20° C. overnight. The mixture was concentrated and purified by Prep. HPLC (Column: GiLSON-2 Xbridge C18 (5 μm 19*150 mm), Mobile phase A: water (0.1% ammonium bicarbonate), Mobile phase B: acetonitrile, UV: 214 nm, Flow rate: 15 mL/min, Gradient: 20% B to 60% B). The collected fraction was lyophilized to give Compound 43 (48 mg, 95% purity, 41% yield) as a white solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 43
[1376] In case reactions were performed with a ketone starting material, a typical procedure makes use of either 2 eq. acetic acid or 2 eq. of zinc(II)chloride (ZnCl.sub.2), in the presence of 2 eq. sodium cyanoborohydride (NaCNBH.sub.3), in methanol at 50° C. or 70° C. overnight.
TABLE-US-00042 Compound No. Structure Starting Materials Compound 44
Preparation of Compound 50:
[1377] ##STR00684##
[1378] To a solution of Compound 381 (70 mg, 0.102 mmol) and DIEA (79 mg, 0.61 mmol) in DCM (4 mL) was added acetic anhydride (52 mg, 0.51 mmol). After stirring at r.t. for 4 hours, the reaction mixture was concentrated, and the residue was purified by Prep-HPLC: Waters Xbridge C18 5 μm 19*150 mm. Mobile phase A:0.1% NH.sub.4OH+10 mM NH.sub.4HCO.sub.3 in water. B: CH.sub.3CN, gradient from 0% B to 100% B. The pure fraction was collected and lyophilized to afford Compound 50 (50 mg, 88% yield) as a white solid.
Preparation of Compound 51:
[1379] ##STR00685##
[1380] At 0° C., to a solution of Compound 485 (1.04 g, 95% purity, 1.95 mmol) in DCM (10 mL) was added acetyl chloride (160 mg, 2.05 mmol) and triethylamine (592 mg, 5.85 mmol). After stirring at room temperature for 2 hours, the resulting mixture was poured into water and extracted with dichloromethane (20 mL) twice. The combined organic layers were washed with brine (20 mL), dried over Na.sub.2SO.sub.4, filtered and concentrated to afford the crude product, which was purified by prep HPLC (Column: Xbridge C18 150*19 mm*5 um, Mobile Phase A: water (0.1% NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 15% B to 60% B). The collected fraction was lyophilized to give Compound 51 (1.25 g, 99.8% purity, 74.9% yield) as a white solid.
[1381] Alternatively, compound 51 can also be prepared with the following procedure:
[1382] Intermediate 202 (as 0.2TFA salt) (0.20 g, 0.49 mmol) and 1-acetylpiperidine-4-carbaldehyde (0.097 g, 0.62 mmol) were dissolved in MeOH (5.5 mL). After stirring at ambient temperature for −5 min, solid NaCNBH.sub.3 (0.039 g, 0.62 mmol) was added. The resulting mixture was stirred at ambient temperature for ˜2 h, after which sat. aq. NaHCO.sub.3 solution was added. Then, most of the MeOH was evaporated to dryness, and DCM was added. The pH of the water layer was adjusted to pH>10 with 1M aq. NaOH solution. The layers were separated and the water layer was extracted three times more with DCM. The organic layers were combined, dried over Na.sub.2SO.sub.4, filtered and evaporated. The residue was purified by silica gel column chromatography eluting with methanol (+1% 7N NH.sub.3 in MeOH) in dichloromethane from 0% to 10% to give compound 51 (0.060 g, 0.11 mmol, 35% yield).
[1383] Compound 51 (originating from route via intermediate 202; 0.051 g, purity 99.7%, LC/MS method 32) was dissolved in 2-3 drops of isopropylacetate (IPAC), after which the resulting solution was stirred at 45° C. for ˜5 h. Next, the mixture was allowed to stir at ambient temperature for 48 h, after which it was filtered to obtain a white solid material corresponding with Compound 51 in its crystalline free base Form. Melting point (via DSC): T.sub.onset=121.6° C.
[1384] Compound 51 ((originating from route via intermediate 202; ˜1 g, 98.7% purity, LC/MS method 33) was dissolved in cyclopentylmethylether (CPME) (3 mL), after which heptane (2 mL) was slowly added, followed by the addition of −10 mg of seeding crystals (obtained via previous procedure). Next, 1 mL of heptane was added and the mixture stirred for 20 h, after which the suspension was filtered to give solid material which was dried at 40° C. under vacuum to yield Compound 51 in its crystalline free base Form (96% yield).
[1385] Chiral SFC method 1 was employed to match the stereochemistry of compound 51 obtained through the route employing Compound 485 or intermediate 202; retention time=4.73-4.77 min.
Preparation of Compound 51a:
[1386] ##STR00686##
[1387] Compound 51 (0.50 g, 0.91 mmol, purity 95.2% (determined by LC/MS method 32)) was dissolved in acetone (0.50 mL) and stirred to give a clear solution. Next, a solution of 1M HCl in acetone was prepared as follows: 1 mL of concentrated aq. HCl solution was added to 11 mL of acetone. Then, a solution of 1M HCl in acetone (0.92 mL, 1 eq.) was added, keeping a solution. The solution was stirred at ambient temperature for ˜30-60 min, after which heptane (5.0 mL) was added. Next, acetone was added (3.0 mL). Vigorous stirring was initiated, and the mixture was stirred overnight. Then, a fine white suspension was obtained, and the suspension was filtered. The solid was rinsed with heptane and dried to give Compound 51a as a mono HCl trihydrate salt (when determined via dynamic vapor sorption analysis around 3 equivalents water) as a white solid (0.48 g, yield 78%). Melting point (via DSC): T.sub.onset=139° C.
[1388] Compound 51a was obtained as a variable hydrate with equilibrated water content varying as function of humidity —mainly trihydrate at ambient % relative humidity.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 51
[1389] Alternatively, compounds can also be purified by the following method: prep. HPLC: (Column: Waters Sunfire C18 5 μm, 19*150 mm, Mobile Phase A: water (0.1% HCOOH), Mobile Phase B: acetonitrile, Flow rate: 17 mL/min, gradient condition from 0% B to 20% B).
TABLE-US-00043 Compound No. Structure Starting Materials Compound 58
Preparation of Compound 59:
[1390] ##STR00720##
[1391] To a mixture of Compound 485 (70 mg, 0.138 mmol), methoxyacetic acid (18.7 mg, 0.208 mmol) and DIPEA (0.07 mL, 0.42 mmol) in DCM (4.2 mL) was added HATU (78.9 mg, 0.208 mmol). After stirring at rt for 16 hours, the reaction mixture was concentrated and the residue was purified by Prep. HPLC (Column: Waters Xbridge C18 5 μm, 19*150 mm, Mobile Phase A: water (0.1% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 17 mL/min, gradient condition from 30% B to 50% B). The pure fraction was collected and lyophilized to dryness to afford Compound 59 (65 mg, 79.6% yield).
Preparation of Compound 60:
[1392] ##STR00721##
[1393] To a mixture of Compound 485, (70 mg, 0.138 mmol), cyanoacetic acid (17.7 mg, 0.208 mmol) and DIPEA (0.07 mL, 0.415 mmol) in DCM (5 mL) was added HATU (78.9 mg, 0.208 mmol). After stirring at RT for 16 hours, the reaction mixture was concentrated, and the residue was purified by Prep. HPLC (Column: Waters Xbridge C18 5 μm, 19*150 mm, Mobile Phase A: water (0.1% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 17 mL/min, gradient condition from 30% B to 50% B). The pure fraction was collected and lyophilized to dryness to afford Compound 60 (65 mg, 81% yield).
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 60
[1394] Alternatively, purification can also be performed using the following method: Prep. HPLC (Column: Xbrige C18 150*19 mm*5 um, mobile phase A: water (0.1% HCOOH), mobile phase B: acetonitrile, flow rate: 15 mL/min, gradient condition from 5% B to 60% B)
TABLE-US-00044 Compound No. Structure Starting Materials Compound 82
Preparation of Compound 61:
[1395] ##STR00742##
[1396] To a solution of intermediate 25 (0.082 g, 0.21 mmol) in 1,2-DCE (2.0 mL) was add tetrahydropyran-4-carbaldehyde (0.028 g, 0.25 mmol), and followed by NaBH(OAc).sub.3 (0.062 g, 0.29 mmol). After stirring at ambient temperature overnight, another portion of tetrahydropyran-4-carbaldehyde (0.028 g, 0.25 mmol) and NaBH(OAc).sub.3 (0.062 g, 0.29 mmol) was added. After stirring for another 1.5 h, 1M aq. NaOH solution was added, followed by DCM. The layers were separated, and the aqueous layer was extracted 4× with DCM. The organic layers were combined, dried over Na.sub.2SO.sub.4, filtered and evaporated. The residue was purified by RP-preparative HPLC (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 61 (0.058 g, 57% yield), after lyophilization, as a white fluffy powder.
Preparation of Compound 62:
[1397] ##STR00743##
[1398] To a solution of intermediate 25 (0.18 g, 0.45 mmol) in 1,2-DCE (4.2 mL) was added N-Boc-piperidine-4-carboxaldehyde (0.11 g, 0.54 mmol), and followed by NaBH(OAc).sub.3 (0.13 g, 0.63 mmol). After stirring at ambient temperature overnight, DCM and 1M aq. NaOH were added. The layers were separated, and the aqueous layer was extracted 4×more with DCM. The organic layers were combined, dried over Na.sub.2SO.sub.4, filtered and evaporated. The residue was purified by silica gel column chromatography eluting with methanol (+1% 7N NH.sub.3 in MeOH) in dichloromethane from 0% to 10% to give Compound 62 (0.25 g, 94% yield) as a foam.
Preparation of Compound 63:
[1399] ##STR00744##
[1400] To a solution of Compound 62 (0.25 g, 0.42 mmol) in DCM (5 mL) was added TFA (5 mL). After stirring at ambient temperature for 2 h, the reaction mixture was evaporated to dryness and the residue applied to SiliaBond® propylsulfonic acid resin as a solution in MeOH. The column was eluted with MeOH (8 fractions), followed by 3.5 N NH.sub.3 in MeOH (8 fractions). Product containing fractions were pooled and evaporated to give an intermediate, which was dissolved in DCM (3.6 mL). The solution was cooled to 0° C. in an ice bath and DIPEA (0.13 mL, 0.76 mmol) was added, followed by Ac.sub.2O (0.06 mL, 0.63 mmol). The resulting mixture was stirred at ambient temperature for 2 h, after which LC/MS showed full conversion of the starting material. Then, sat. aq. NaHCO.sub.3 solution was added. The resulting mixture was partitioned between 1M aq. NaOH solution and DCM. The water layer was extracted 5× with DCM and the organic layers were combined, dried over Na.sub.2SO.sub.4, filtered, and evaporated to dryness. The residue was purified by RP-preparative HPLC (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 63 (0.046 g, 68% yield) after lyophilization as a white fluffy powder.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 63
TABLE-US-00045 Compound No. Structure Starting Materials Compound 64
Preparation of Compound 66:
[1401] ##STR00747##
[1402] To a solution of Compound 62 (450 mg, 0.760 mmol) in anhydrous dichloromethane (4 mL) was added trifluoroacetic acid (4 mL). After stirring at 25° C. for 30 minutes, the reaction mixture was concentrated under reduced pressure to give a residue, which was diluted with dichloromethane (80 mL) and then basified to pH=14 with 10% aqueous NaOH (50 mL). The mixture was extracted with dichloromethane (60 mL×3) and the combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the crude product (260 mg, crude) as a white solid, which was used for next step without further purification. To a solution of crude product (100 mg, 0.203 mmol) and 2-methoxyacetic acid (18.3 mg, 0.203 mmol) in anhydrous dichloromethane (3 mL) was added N,N-diisopropylethylamine (31.5 mg, 0.244 mmol). HATU (77.3 mg, 0.203 mmol) was added to the mixture under stirring, then the reaction mixture was stirred at 25° C. for 1 h. The reaction mixture was diluted with dichloromethane (20 mL), water (30 mL) was added. The mixture was extracted with dichloromethane (20 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue, which was purified by preparative-HPLC (Column: Phenomenex Gemini-NX C18 75*30 mm*3 um, Mobile Phase A: water (0.05% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 28% B to 58% B). The pure fractions were collected and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give Compound 66 (50.0 mg, 99.4% purity, 43.4% yield) as a white powder.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 66
[1403]
TABLE-US-00046 Compound No. Structure Starting Materials Compound 67
Preparation of Compound 68:
[1404] ##STR00749##
[1405] At 0° C., to a solution of Compound 488 (380 mg, 0.6 mmol) and triethylamine (500 mg, 4.94 mmol) in anhydrous dichloromethane (10 mL) was added methanesulfonyl chloride (500 mg, 4.37 mmol) dropwise. The reaction mixture was warmed up to r.t. and stirred for 2 hours. The reaction mixture was quenched with a saturated solution of sodium bicarbonate (20 mL) and H.sub.2O (20 mL) and extracted with dichloromethane (30 mL×3). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated under reduced pressure to give the crude product, which was purified by preparative-HPLC (Column: Phenomenex Gemini-NX C18 75*30 mm*3 um, Mobile Phase A: water (0.04% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 33% B to 63% B). The pure fractions were collected and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give the desired compound (150 mg, 97.9% purity, 41% yield) as a white powder.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound_68
TABLE-US-00047 Compound No. Structure Starting Materials Compound 69
Preparation of Compound 70:
[1406] ##STR00752##
[1407] Intermediate 26 (75 mg, 0.184 mmol), DMF (4 mL), intermediate 116 (75 mg, 0.230 mmol), cesium carbonate (180 mg, 0.552 mmol) and potassium iodide (7 mg, 0.042 mmol) were added to a 50 mL round-bottomed flask. After degassing with N.sub.2, the reaction mixture was heated and stirred at 100° C. overnight. The reaction mixture was poured into water (10 mL) and extracted with DCM (10 mL×3). The combined organic extracts were dried over anhydrous Na.sub.2SO.sub.4, filtered, and concentrated to dryness under reduced pressure to give the crude product which was purified by prep. HPLC (Phenomenex Gemini-NX C18 75*30 mm*3 um, Mobile Phase A: water (0.05% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 32% B to 62% B). The pure fractions were collected, and the solvent was evaporated under vacuum to give a residue. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The solution was lyophilized to dryness to give Compound 70 (34.27 mg, 98.3% purity, 33% yield) as a yellow solid.
Preparation of Compound 71:
[1408] ##STR00753##
[1409] A mixture of intermediate 27 (75 mg, 0.184 mmol), intermediate 116 (75 mg, 0.230 mmol), cesium carbonate (180 mg, 0.552 mmol) and potassium iodide (7 mg, 0.042 mmol) in DMF (4 mL) was degassed with N.sub.2 and the reaction mixture was heated and stirred at 100° C. overnight.
[1410] After cooled down to room temperature, the reaction mixture was poured into water (10 mL) and extracted with DCM (10 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered, and concentrated to dryness under reduced pressure to give the crude product which was purified by prep. HPLC (Welch Xtimate C18 150*30 mm*5 um, Mobile Phase A: water (0.05% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 35 mL/min, gradient condition from 25% B to 55% B). The pure fractions were collected, and the solvent was evaporated under vacuum to give a residue. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The solution was lyophilized to dryness to give Compound 71 (33 mg, 96.1% purity, 30.7% yield) as a yellow solid.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 71
[1411]
TABLE-US-00048 Compound No. Structure Starting Materials Compound 140
Preparation of Compound 72:
[1412] ##STR00755##
[1413] Triethylamine (80.0 mg, 0.791 mmol) was added to a solution of Compound 488 (80 mg, 0.126 mmol) in dichloromethane (3.0 mL). Then acetic anhydride (20.0 mg, 0.196 mmol) was added. After stirring at 25° C. for 30 minutes, the reaction mixture was suspended into aq. NaHCO.sub.3 solution (30 mL) and extracted with dichloromethane (20 mL×2). The combined organic layers were dried over anhydrous Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give a residue, which was purified by prep. HPLC (Column: Phenomenex Gemini-NX C18 75*30 mm*3 um, Mobile Phase A: water (0.05% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 46% B to 76% B). The pure fraction was collected and the solvent was evaporated under vacuum. The residue was re-suspended in water (10 mL) and the resulting mixtures were lyophilized to dryness to give Compound 72 (20.0 mg, 100% purity, 28.2% yield) as a white powder.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 72
[1414]
TABLE-US-00049 Compound No. Structure Starting Materials Compound 73
Preparation of Compound 74:
[1415] ##STR00757##
[1416] Intermediate 25 (185 mg, 0.469 mmol), DMF (5 mL), intermediate 116 (185 mg, 0.568 mmol), cesium carbonate (460 mg, 1.41 mmol) and potassium iodide (16 mg, 0.096 mmol) were combined into a 50 mL round-bottomed flask. After degassing with N.sub.2, the reaction mixture was heated and stirred at 100° C. for 6 hours. After cooled down to the room temperature, the reaction mixture was poured into water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic extracts were dried over Na.sub.2SO.sub.4, filtered, and concentrated to dryness under reduced pressure to give the crude product which was purified by prep. HPLC (Phenomenex Gemini-NX C18 75*30 mm*3 um, Mobile Phase A: water (0.05% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 33% B to 63% B). The pure fractions were collected, and the solvent was evaporated under vacuum to give a residue. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The solution was lyophilized to dryness to give Compound 74 (40.78 mg, 95.7% purity, 15% yield) as a brown powder.
Preparation of Compound 83:
[1417] ##STR00758##
[1418] Intermediate 25 (0.060 g, 0.152 mmol) was dissolved in MeCN (1.6 mL). Then, 4-(2-chloroacetyl)morpholine (0.027 g, 0.17 g) and triethylamine (0.13 mL, 0.91 mmol) was added and the resulting mixture stirred at ambient temperature for 2 h. Next, MeOH was added and the mixture was evaporated to dryness. The residue was purified by RP-preparative HPLC (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 83 (32 mg, 0.059 mmol, 39% yield).
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 83
TABLE-US-00050 Compound No. Structure Starting Materials Compound 96
Preparation of Compound 75:
[1419] ##STR00762##
[1420] To a solution of intermediate 118 (0.060 g, 0.24 mmol) and intermediate 25 (0.11 g, 0.29 mmol) in MeOH (1 mL) was added AcOH (28 μL, 0.48 mmol), followed by NaBH.sub.3CN (0.030 g, 0.48 mmol). The mixture was stirred at ambient temperature overnight. Next, sat. aq. NaHCO.sub.3 solution was added. After stirring for −5 min, the mixture was evaporated to dryness. The residue was purified by preparative HPLC (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 75 (0.042 g, 49% yield).
Preparation of Compound 76:
[1421] ##STR00763##
[1422] To a solution of intermediate 118 (0.058 g, 0.23 mmol) and intermediate 121 (0.14 g, 0.28 mmol) in MeOH (1 mL) was added AcOH (27 μL, 0.47 mmol), followed by NaBH.sub.3CN (0.029 g, 0.47 mmol). The mixture was stirred at ambient temperature overnight. Next, sat. aq. NaHCO.sub.3 solution was added. After stirring for ˜5 min, the mixture was evaporated to dryness. The residue was purified by preparative HPLC (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give the product (0.090 g, 0.13 mmol) with 92% purity determined via .sup.1H NMR integration. (˜5% on UV via SFC). Additional purification via prep. SFC (Stationary phase: Chiralcel Diacel IH 20×250 mm, Mobile phase: CO.sub.2, EtOH+0.4 iPrNH.sub.2) yielded pure Compound 76 (0.061 g, 0.098 mmol).
Preparation of Compound 77, 77a, 77b, 77c, 77d:
[1423] ##STR00764## ##STR00765##
[1424] A mixture of intermediate 130 (77.0 mg, 0.183 mmol) and tetrahydropyran-4-carbaldehyde (27.5 mg, 0.241 mmol) in MeOH (1.20 mL) was stirred for 30 min after which sodium cyanoborohydride (15.1 mg, 0.241 mmol) was added. The reaction mixture was stirred at rt overnight. The reaction was quenched with water and used as such for reversed-phase prep HPLC purification (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN), followed by purification by silica gel column chromatography eluting with ethyl acetate, followed by 20% methanol in dichloromethane to give Compound 77 (32 mg, 50.5% yield) as a white solid.
[1425] Compound 77 was further purified by Prep SFC (Stationary phase: Chiralpak Diacel AD 20×250 mm, Mobile phase: CO.sub.2, iPrOH+0.4 iPrNH.sub.2). The first fraction was collected at Compound 77a, the second fraction as Compound 77b, the third fraction as Compound 77c and the fourth fraction as Compound 77d.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 77
TABLE-US-00051 Compound No. Structure Starting Materials Compound 78
Preparation of Compound 84:
[1426] ##STR00773##
[1427] At 0° C., to a solution of Compound 430 (256 mg, 0.506 mmol) in dichloromethane (10 mL) were added acetyl chloride (40 mg, 0.510 mmol) and triethylamine (155 mg, 1.532 mmol). After stirring at r.t. for 1 hr, the mixture was quenched with saturated aqueous sodium hydrogen carbonate solution and extracted with dichloromethane three times. The combined organic layers were washed with brine, dried over anhydrous Na.sub.2SO.sub.4 and concentrated under vacuum. The residue was purified by prep. HPLC (Column: Waters Xbridge C18 OBD 5 μm, 19*150 mm, Mobile Phase A: water (0.1% NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 15 mL/min, gradient condition from 20% B to 60% B) to give Compound 84 (88 mg, 30.8% yield) as a white solid.
Preparation of Compound 88:
[1428] ##STR00774##
[1429] Intermediate 27 (50 mg, 0.12 mmol), intermediate 134 (69.3 mg, 0.24 mmol), DIEA (0.105 mL, 0.61 mmol) and potassium iodide (20.3 mg, 0.12 mmol) were added to NMP (2 mL). The mixture was stirred at 70° C. for 16 hours. The mixture was separated by HPLC (Column: Waters Xbridge C18 5 μm, 19*150 mm, Mobile Phase A: water (0.1% NH.sub.3H.sub.2O+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 17 mL/min, gradient condition from 20% B to 50% B). The pure fraction was collected and lyophilized to afford Compound 88 (20 mg, yield 29.80%).
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 88
TABLE-US-00052 Compound No. Structure Starting Materials Compound 89
Preparation of Compound 91:
[1430] ##STR00786##
[1431] A mixture of intermediate 25 (127 mg, 0.322 mmol), 2-(Boc-amino)-6-oxospiro[3.3]heptane (145 mg, 0.644 mmol) and AcOH (36.9 μL, 0.644 mmol) in MeOH (3.2 mL) was stirred for 30 min after which sodium cyanoborohydride (40.5 mg, 0.644 mmol) was added. The reaction mixture was stirred at 50° C. overnight. The reaction was cooled down to r.t., quenched with water, and evaporated to dryness. The residue was purified by silica gel column chromatography eluting with methanol (+1% NH.sub.3 in MeOH) in dichloromethane from 1% to 50%. The purest fractions were collected, evaporated to dryness to afford Compound 91 (64 mg, yield 32.6%) as a white solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 91
TABLE-US-00053 Compound No. Structure Starting Materials Compound 92
Preparation of Compound 93:
[1432] ##STR00791##
Compound 490 (55 mg, 0.107 mmol) was dissolved in DCM (1.2 mL). Then, DIPEA (0.11 mL, 0.64 mmol) was added, followed by Ac.sub.2O (0.051 mL, 0.536 mmol). The resulting mixture was then stirred at ambient temperature for 2 h. Next, a small amount of MeOH was added, and the mixture evaporated to dryness. The compound was purified by silica gel column chromatography eluting with methanol (+1% 7N NH3 in MeOH) in dichloromethane from 1% to 20% to afford the product (80 mg), which was triturated with DEE to give Compound 93 (52.3 mg, yield 83.5%).
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 93
TABLE-US-00054 Compound No. Structure Starting Materials Compound 94
Preparation of Compound 101:
[1433] ##STR00819##
[1434] To a solution of Compound 485 (100 mg, 0.20 mmol), triethylamine (61 mg, 0.59 mmol) in dichloromethane (10 mL) was added a solution of methylaminoformyl chloride (23 mg, 0.22 mmol) in 2 mL of DCM. After stirring at 20° C. for 5 hr, the mixture was diluted with water (20 mL) and extracted with DCM (10 mL) for three times. The combined organic layers were washed with brine (30 mL), dried over Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated under vacuum, which was purified by Prep-HPLC (Prep HPLC (Column: Xbridge C18 (5 m 19*150 mm), Mobile Phase A: Water (0.1% NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, UV: 214 nm, Flow rate: 15 mL/min, Gradient: 15% B to 55% B) to give Compound 101 (90 mg, 0.15 mmol, 76.8% yield) as a white solid.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 101
TABLE-US-00055 Compound No. Structure Starting Materials Compound 168
Preparation of Compound 129:
[1435] ##STR00823##
[1436] A mixture of intermediate 179 (85 mg, 0.16 mmol), 2 M methanamine in tetrahydrofuran (0.16 mL, 0.32 mmol), HATU (90 mg, 0.24 mmol, 1.5 equivalent), triethylamine (48 mg, 0.48 mmol, 3.0 equivalent) and DMF (10 mL) was stirred at room temperature overnight. The mixture was diluted with water (20 mL) and extracted with ethyl acetate (25 mL) for three times. The combined organic layers were dried over Na.sub.2SO.sub.4, filtered and concentrated to give the crude product, which was purified by prep. TLC eluting with 10% methanol in dichloromethane to give Compound 129 (55.3 mg, yield: 61.7%).
Preparation of Compound 134, 134a, 134b, 134c, 134d:
[1437] ##STR00824##
[1438] TFA (1.39 mL, 18.13 mmol) was added to a solution of intermediate 199 (550 mg, 0.906 mmol) in DCM (10 mL) and stirred at rt for 3 h. The reaction mixture was concentrated under reduced pressure to give the TFA salt. TFA removal was done using SiliaBond@ propylsulfonic acid resin. The product was dissolved in MeOH and transferred to a column loaded with SiliaBond® propylsulfonic acid resin. The column was first eluted with MeOH after which the product was released by elution with ammoniated methanol (7 N). Tubes containing the product were concentrated under reduced pressure. The crude product was purified by silica gel column chromatography eluting with methanol (+1% 7N NH.sub.3 in methanol) in dichloromethane from 0% to 10% to give Compound 134 (350 mg, yield 76%). Compound 134 was further separated via Prep. SFC (Stationary phase: Chiralpak Diacel AD 20×250 mm, Mobile phase: CO.sub.2, EtOH+0.4 iPrNH.sub.2) and Prep. SFC (Stationary phase: Chiralcel Diacel IH 20×250 mm, Mobile phase: CO.sub.2, iPrOH+0.4 iPrNH.sub.2) to afford Compound 134a (25 mg, 5.4% yield), Compound 134b (95 mg, 21% yield), Compound 134c (115 mg, 25% yield) & Compound 134d (36 mg, 7.7% yield).
Preparation of Compound 142:
[1439] ##STR00825##
[1440] A stir bar, intermediate 209 (50 mg, 0.086), EDCI (22 mg, 0.115 mmol), HOBt (21 mg, 0.114 mmol), DIEA (60 mg, 0.464 mmol), DCM (1 mL) and dimethylamine hydrochloride (16 mg, 0.196 mmol) were added into a 8 mL glass. The resulting mixture was stirred at room temperature for 4 h. The reaction mixture was poured it into water (5 m&), separated the layers, and the aqueous layers was extracted with DCM (5 mL×2). The combined organic extracts were dried over anhydrous Na.sub.2S.sub.4, filtered, and concentrated to dryness under reduced pressure to give the crude product which was purified by prep. HPLC (Column: Welch Xtimate C18 150*30 mm*5 um, Mobile Phase A: water (NH.sub.3H.sub.2O+NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 35 mE/min, gradient condition from 43% B to 73% B). The pure fractions were collected and the solvent was evaporated under vacuum to give a residue. The residue was partitioned between acetonitrile (2 mE) and water (10 mL). The solution was lyophilized to dryness to give Compound 142 (19 mg, 38.8% yield) as white power.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 142
[1441] Alternatively, purification can also be performed using the following method: prep-HPLC (Column: Welch Xtimate C18 150*25 mm*5 um, Mobile Phase A: water (+HCOOH), Mobile Phase B: acetonitrile Flow rate: 25 mL/min gradient condition from 2% B to 32% B).
TABLE-US-00056 Compound No. Structure Starting Materials Compound 143
Preparation of Compound 144:
[1442] ##STR00836##
[1443] Intermediate 211 (35.8 mg, 0.0582 mmol) and AcOH (6.66 μL, 0.116 mmol) were stirred in MeOH (0.581 mL) at rt for 30 min. Sodium cyanoborohydride (7.3 mg, 0.116 mmol) was added and the reaction was heated at 50° C. The reaction mixture was quenched with water and used as such for reversed-phase prep HPLC purification (Stationary phase: RP XBridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 144 (13.2 mg, 44.8% yield) as a white solid.
Preparation of Compound 148:
[1444] ##STR00837##
[1445] To a solution of intermediate 202 (60 mg, 0.14 mmol) in acetonitrile (5 mL) was added intermediate 216 (354 mg, 0.21 mmol), potassium carbonate (59 mg, 0.42 mmol) and potassium iodide (14 mg, 0.09 mmol). The reaction mixture was heated at 80° C. for 16 h. The mixture was cooled to room temperature, diluted with EtOAc and filtered. The filtrate was concentrated and purified by silica gel column chromatography eluting with 6% methanol in dichloromethane and prep. HPLC (Column: Xbridge C18 (5 μm 19*150 mm), Mobile Phase A: Water (0.1% ammonium bicarbonate), Mobile Phase B: acetonitrile, UV: 214 nm, Flow rate: 15 mL/min, Gradient: 15% B to 75% % B).
The Following Compound was Synthesized by an Analogous Method as Described for Compound 148
[1446] The product obtained from the alkylation step was immediately treated with 7M HCl in ethyl acetate.
TABLE-US-00057 Compound No. Structure Starting Materials Compound 199
Preparation of Compound 152:
[1447] ##STR00839##
[1448] To a solution of Compound 448 (80 mg, 0.152 mmol) in tetrahydrofuran (4 mL) was added intermediate 221 (55 mg, 0.304 mmol). The reaction mixture was heated to 80° C. and stirred at this temperature overnight. The resulting mixture was concentrated and the residue was purified by silica gel column chromatography eluting with methanol in dichloromethane from 0% to 10% to give Compound 152 (65 mg, 70.6% yield) as a white solid.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 152
[1449]
TABLE-US-00058 Compound No. Structure Starting Materials Compound 157
Preparation of Compound 153:
[1450] ##STR00841##
[1451] Intermediate 222 (50 mg, 0.2 mmol) was added to a stirred mixture of intermediate 202 (81.6 mg, 0.2 mmol), sodium iodide (32.9 mg, 0.22 mmol) and K.sub.2CO.sub.3 (55.2 mg, 0.399 mmol) in MeCN (1.6 mL) and the mixture was heated at 80° C. overnight. The mixture was cooled down to rt, quenched with water, and extracted with EtOAc (×3). Reunited organic phases were dried over anhydrous sodium sulfate, filtered, evaporated to dryness and purified by silica gel column chromatography eluting with methanol (+1% NH.sub.3 in MeOH) in dichloromethane from 1% to 10% to give Compound 153 (71 mg, yield 58%) as a white solid.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 153
[1452]
TABLE-US-00059 Compound No. Structure Starting Materials Compound 154
Preparation of Compound 162:
[1453] ##STR00843##
[1454] A stir bar, Compound 526a (50.0 mg, 0.089 mmol) and methanamine (2 mL, 30% in ethanol) were added to a 8 mL glass bottle. The reaction mixture was heated and stirred at 70° C. for 4 days. The reaction mixture was cooled down to room temperature and concentrated under reduced pressure to give a residue, which was purified by preparative-HPLC (Column: Boston Prime C18 150*30 mm*5 um, Mobile Phase A: water (CH.sub.3COOH+CH.sub.3COONH.sub.4), Mobile Phase B: acetonitrile, Flow rate: 25 mL/min, gradient condition from 35% B to 65% B). The pure fractions were collected and the solvent was evaporated under vacuum. The residue was partitioned between acetonitrile (2 mL) and water (10 mL). The mixture was lyophilized to dryness to give Compound 162 (20.0 mg, 97.66% purity, 39.13% yield) as a white powder.
The Following Compound was Synthesized by an Analogous Method as Described for Compound 162
[1455]
TABLE-US-00060 Compound No. Structure Starting Materials Compound 163
Preparation of Compound 172:
[1456] ##STR00845##
[1457] To a solution of Compound 448 (30 mg, 0.0593 mmol) and DIPEA (0.102 mL, 0.59 mmol) in DCM (6 mL) was added triphosgene (48.1 mg, 0.162 mmol). The mixture was stirred at r.t. for 0.5 hour. 2-methoxy-N-methylethan-1-amine (5.288 mg, 0.0593 mmol) was added and the mixture was stirred for further 2 hours. The solvent was removed and the residue was dissolved in MeOH (3 ml) and purified by preparative-HPLC (Column: Waters Sunfire C18 5 μm, 19*150 mm, Mobile Phase A: water (0.1% HCOOH), Mobile Phase B: acetonitrile, Flow rate: 17 mL/min, gradient condition from 0% B to 30% B) to afford Compound 172 (10 mg, 23% yield).
Preparation of Compound 184, 184a & 184b:
[1458] ##STR00846##
[1459] NaH (60% dispersion in mineral oil) (7.9 mg, 0.197 mmol) was added, under nitrogen at 0° C., to a solution of Compound 169 (70 mg, 0.131 mmol) in anhydrous DMF (1 mL). After 10 min, Mel (9.8 μL, 0.157 mmol) was added, and the reaction was left under stirring at rt overnight. The reaction was quenched with ice, diluted with MeOH to give the crude product, which was used as such for reversed-phase prep HPLC purification (Stationary phase: RP Xbridge Prep C18 OBD-5 μm, 50×250 mm, Mobile phase: 0.5% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 184 (30.5 mg, 41.1% yield) as a white solid. A purification was performed via Prep. SFC (Stationary phase: Chiralpak Diacel AD 20×250 mm, Mobile phase: CO.sub.2, EtOH-iPrOH (50-50)+0.4% iPrNH.sub.2). The first fraction was collected as Compound 184a (9.5 mg, 13% yield) and the second fraction as Compound 184b (9.5 mg, 13% yield) as white solids.
Preparation of Compound 205, 205a & 205b:
[1460] ##STR00847##
[1461] NaBH.sub.4 (9.6 mg, 0.25 mmol) was added to a stirred solution of intermediate 264 (66 mg, 0.127 mmol) in MeOH (1.2 mL) at r.t. and the mixture was left under stirring for 20 min. The reaction was quenched with water and purified by Prep. HPLC to give Compound 205 (41 mg, yield 61.9%) as a white solid. A further purification was performed via Prep. SFC (Stationary phase: Chiralpak Diacel AD 20×250 mm, Mobile phase: CO.sub.2, EtOH-iPrOH (50-50)+0.4% iPrNH.sub.2) to give Compound 205a (25 mg, 38% yield) and Compound 205b (7 mg, 10.6% yield).
Preparation of Compound 207:
[1462] ##STR00848##
[1463] Compound 448 (120 mg, 0.237 mmol) and DIPEA (0.12 mL, 0.71 mmol) were added to DCM (5 mL). Isocyanatotrimethylsilane (32.8 mg, 0.28 mmol) was added and the mixture was stirred at r.t. for 16 hours. The solvent was removed and the residue was purified by preparative-HPLC (Column: Waters Xbridge C18 5 μm, 19*150 mm, Mobile Phase A: water (0.1% NH.sub.4OH+10 mM NH.sub.4HCO.sub.3), Mobile Phase B: acetonitrile, Flow rate: 17 mL/min, gradient condition from 25% B to 35% B) to give Compound 207 (100 mg, 75% yield).
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 207
TABLE-US-00061 Compound No. Structure Starting Materials Compound 217
Preparation of Compound 261:
[1464] ##STR00852##
[1465] 1-azaspiro[3.3]heptane (0.165 mmol, 1.2 eq.) was pre-weighed into a 2-dram vial. A stock solution (23 mL) of intermediate 366 (1.38 g, 0.14 M), HATU (1.8 g, 0.2 M) and DIPEA (1.32 mL, 0.36 M) was prepared in DMF and stirred for 1 h. A 2nd stock solution of DIPEA (1.32 mL in 11.5 mL DMF) was also prepared. The DIPEA stock solution (0.5 mL) was added to each vial to solubilize the amine HCl salt. Intermediate 366/HATU/DIPEA solution (1 mL) was then added to each amine well. The reactions were stirred for 2 h, whereupon an extra 1.5 eq. HATU was added, and stirring continued overnight. The solvent was evaporated, and the samples redissolved in DMSO (0.5 mL) and MeCN (2.5 mL) for purification. Purification was performed via Prep HPLC (Stationary phase: RP XBridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 261 (3.6 mg, 4.8% yield) after lyophilization.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 261
[1466] Alternative purification methods that can be employed for the purification of examples listed below are as follows:
[1467] Purifications can also be performed via Prep HPLC (Stationary phase: RP Xselect CSH Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.1% FA solution in water, CH.sub.3CN or MeOH).
[1468] Purifications can also be performed via Prep HPLC: (Stationary phase: RP Xbridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, MeOH).
[1469] Purifications can also be performed via Prep SFC (Stationary phase: Torus Diol 30×150 mm, Mobile phase: CO.sub.2, MeOH+20 mM NH.sub.4OH).
[1470] These purification methods can also be used in combination.
TABLE-US-00062 Compound No. Structure Starting Materials Compound 262
Preparation of Compound 283:
[1471] ##STR00874##
[1472] The 3-formyl-N-methylbenzamide (0.4 mmol, 2 eq.) was pre-weighed into a 2-dram vial with a stirrer bar. Stock solutions of intermediate 25 (0.79 g, 7.5 mL, 0.27 M) and sodium cyanoborohydride (0.23 g, 7.5 mL, 0.48 M) were prepared in MeOH. 0.75 mL of intermediate stock solution was added and the solutions stirred for 2 h. Next, sodium cyanoborohydride stock solution (0.75 mL) was then added. The reaction mixture was then stirred at room temperature overnight. After reaction completion, the solution was added to MeOH-washed ethylbenzenesulfonic acid resin cartridge (Isolute® SCX-3), and eluted with MeOH (3×2 mL) followed by 3.5 M NH.sub.3 in MeOH (3×2 mL). The basic washes containing the product was evaporated and re-dissolved in 3 mL 1:1 MeCN/MeOH for purification. Purification was performed via Prep SFC (Stationary phase: Torus Diol 30×150 mm, Mobile phase: CO.sub.2, MeOH+20 mM NH.sub.4OH) to give Compound 283 (41 mg, 38% yield), after lyophilization.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 283
[1473] For reactions employing ketone building blocks, the following applies: acetic acid was added (23 μL, 2 eq.) into the reaction mixture before the addition of the sodium cyanoborohydride stock solution. The reaction mixture was stirred at 50° C. overnight (during the reductive amination step).
[1474] Alternative purification methods that can be employed for the purification of examples listed below are as follows:
[1475] Purifications can also be performed via Prep HPLC (Stationary phase: RP Xselect CSH Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.1% FA solution in water, CH.sub.3CN or MeOH).
[1476] Purifications can also be performed via Prep HPLC: (Stationary phase: RP Xbridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN or MeOH).
[1477] These purification methods can also be used in combination.
TABLE-US-00063 Compound No. Structure Starting Materials Compound 284
Preparation of Compound 292a:
[1478] ##STR00883##
[1479] (R)-tert-Butyl 2-methyl-4-oxopiperidine-1-carboxylate (0.4 mmol, 2 eq.) was pre-weighed into a 2-dram vial with a stirrer bar. Stock solutions of intermediate 25 (0.63 g, 6.0 mL, 0.27 M) and sodium cyanoborohydride (0.18 g, 6.0 mL, 0.48 M) were prepared in MeOH. 0.75 mL of intermediate 25 stock solution was added to the reaction vial, together with acetic acid (23 μL, 2 eq.) and the solutions stirred for 1 h. The sodium cyanoborohydride stock solution (0.75 mL) was then added. The reaction mixtures were stirred at 50° C. overnight. After reaction completion, the solutions were added to MeOH-washed ethylbenzenesulfonic acid resin cartridge (Isolute® SCX-3), and eluted with MeOH (3×2 mL) followed by 3.5 M NH.sub.3 in MeOH (3×2 mL). The basic washes containing the product were evaporated.
[1480] The crude products from the reductive amination were dissolved in DCM (1 mL) and TFA (2 mL), and stirred at 50° C. for 1 h. The solvents were evaporated and redissolved in MeCN (2 mL). Siliamet® Diamine resin was added and the mixture stirred for 0.5 h. The resin was removed via filtration on a 24-well filter plate, and the filtrate concentrated.
[1481] The Boc deprotected products were dissolved in 1 mL DCM, and DIPEA (0.55 mL, 3.2 mmol), and Ac.sub.2O (0.25 mL, 2.6 mmol) were added. The reaction mixture was stirred for 2 h at room temperature, at which time they were quenched with MeOH (2 mL) and concentrated. The samples were re-dissolved in 3 mL 1:1 MeCN/MeOH for purification. Purification was performed via Prep SFC (Stationary phase: Torus Diol 30×150 mm, Mobile phase: CO.sub.2, MeOH+20 mM NH.sub.4OH) to give Compound 292a (22.9 mg, yield: 21%), after lyophilization.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 292a
[1482] For reactions employing ketone building blocks, the following applies: acetic acid was added (23 μL, 2 eq.) into the reaction mixture before the addition of the sodium cyanoborohydride stock solution. The reaction mixture was stirred at 50° C. overnight (during the reductive amination step).
[1483] Alternative purification methods that can be employed for the purification of examples listed below are as follows:
[1484] Purifications can also be performed via Prep HPLC (Stationary phase: RP Xselect CSH Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.100 FA solution in water, CH.sub.3CN or MeOH).
[1485] Purifications can also be performed via Prep HPLC: (Stationary phase: RP Xbridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN or MeOH).
[1486] These purification methods can also be used in combination.
TABLE-US-00064 Compound No. Structure Starting Materials Compound 292b
Preparation of Intermediate 393:
[1487] ##STR00891##
[1488] 1-(1-[(tert-butoxy)carbonyl]piperidin-2-yl)cyclopropane-1-carboxylic acid (0.40 g, 1.5 mmol) was dissolved in anhydrous THF (20 mL). Then, the mixture was cooled to 0° C. in an ice bath. Next, BH3-THF (1M solution, 2.2 mL, 2.2 mmol) was added dropwise. The mixture was then allowed to stir at ambient temperature for ˜2 h, after which LC/MS showed full conversion of the starting material. Then, water was carefully added. After gas formation ceased, solid K2CO3 (0.26 g) was added and the mixture stirred at ambient temperature for −30 min. Then, EA was added and the mixture transferred to a separatory funnel. The layers were separated and the water layer was extracted twice more with EA. Organic layers were combined, dried over Na2SO4, filtered and evaporated. The residue was purified by silica gel chromatography eluting with ethyl acetate in petroleum ether from 30% to 80% to give Intermediate 393 (0.36 g, 1.4 mmol, yield: 95%) as an oil.
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 393
TABLE-US-00065 Intermediate No. Structure Starting Materials Intermediate 394
Preparation of Intermediate 396:
[1489] ##STR00894##
[1490] Intermediate 393 (0.15 g, 0.59 mmol) was dissolved in ethyl acetate (4 mL). Next, IBX (0.49 g, 1.8 mmol) was added and the resulting mixture was heated to 80° C., open to air. After 3 h, TLC analysis (50% EA/Heptane) showed full conversion of the starting material. The mixture was cooled to ambient temperature, and filtered. The filter cake was washed once with EA. The filtrate was evaporated to dryness to give intermediate 396 (0.13 g, 0.51 mmol, yield: 87%).
The Following Intermediates were Synthesized by an Analogous Method as Described for Intermediate 396
TABLE-US-00066 Intermediate No. Structure Starting Materials Intermediate 397
Preparation of Compound 297:
[1491] ##STR00897##
[1492] Intermediate 396 (0.4 mmol, 2 eq.) was pre-weighed into 2-dram vials with a stirrer bar. Stock solutions of intermediate 25 (0.63 g, 6.0 mL, 0.27 M) and sodium cyanoborohydride (0.18 g, 6.0 mL, 0.48 M) were prepared in MeOH. 0.75 mL of intermediate 25 stock solution was added to the vial and the solution stirred for 1 h. The sodium cyanoborohydride stock solution (0.75 mL) was then added. The reaction mixture was stirred at room temperature (for aldehydes). After reaction completion, the solutions were added to MeOH-washed ethylbenzenesulfonic acid resin cartridge (Isolute® SCX-3) cartridge, and eluted with MeOH (3×2 mL) followed by 3.5 M NH.sub.3 in MeOH (3×2 mL). The basic washes containing the product were evaporated to dryness.
[1493] The crude products from the reductive amination were dissolved in DCM (1 mL) and TFA (2 mL), and stirred at 50° C. for 1 h. The solvents were evaporated and redissolved in MeCN (2 mL). Siliamet® Diamine resin was added and the mixtures stirred for 0.5 h. The resin was removed via filtration on a 24-well filter plate, and the filtrate concentrated.
[1494] The Boc deprotected products were dissolved in 1 mL DCM, and DIPEA (0.55 mL, 3.2 mmol), and Ac.sub.2O (0.25 mL, 2.6 mmol) were added. The reaction mixtures were stirred for 2 h at room temperature, at which time they were quenched with MeOH (2 mL) and concentrated. The samples were re-dissolved in 3 mL 1:1 MeCN/MeOH for purification. Purification was performed via Prep SFC (Stationary phase: Torus Diol 30×150 mm, Mobile phase: CO.sub.2, MeOH+20 mM NH.sub.4OH) to give Compound 297 (91 mg, yield=79%) after lyophilization.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 297 For reactions employing ketone building blocks, the following applies: acetic acid was added (23 μL, 2 eq.) into the reaction mixture before the addition of the sodium cyanoborohydride stock solution. The reaction mixture was stirred at 50° C. overnight (during the reductive amination step).
[1495] Alternative purification methods that can be employed for the purification of examples listed below are as follows:
[1496] Purifications can also be performed via Prep HPLC (Stationary phase: RP Xselect CSH Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.1% FA solution in water, CH.sub.3CN or MeOH).
[1497] Purifications can also be performed via Prep HPLC: (Stationary phase: RP Xbridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN or MeOH).
[1498] These purification methods can also be used in combination.
TABLE-US-00067 Compound No. Structure Starting Materials Compound 298
Preparation of Compound 310:
[1499] ##STR00912##
[1500] 1-azaspiro[3.3]heptane hydrochloride (0.17 mmol, 1.2 eq.) were pre-weighed into a 2-dram vial. A stock solution (21 mL) of intermediate 370 (1.26 g, 0.12 M), HATU (1.46 g, 0.18 M) and DIPEA (1.1 mL) was prepared in DMF and stirred for 1 h. A 2nd stock solution of DIPEA (1.1 mL in 10.5 mL DMF) was also prepared. The DIPEA stock solution (0.5 mL) was added to each the vial to solubilize the amine HCl salt. Intermediate 370/HATU/DIPEA solution (1 mL) was then added. The reaction was stirred overnight at room temperature. The DMF was removed by evaporation. The crude was redissolved in DCM/EtOAc 2/1 (2.2 mL), and water (2.2 mL) was added. The mixture was stirred for 10 minutes. Then, the mixture was left standing for 10 minutes. 2 mL of the organics were removed using a pipette and these were filtered over a fritted filter. The remaining water layer was extracted another time using 2 mL of the DCM/EtOAc mixture. Again, 2 mL was removed and filtered over the same fritted filter. The fritted filter was rinsed with 500 μL of DMSO. The obtained filtrates were concentrated in vacuo until only DMSO remained. The obtained crude were redissolved in MeOH/MeCN 1/1 (2.2 mL) and submitted for purification. Purification was performed via Prep HPLC (Stationary phase: RP XBridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 310 (8.7 mg, yield: 12%) after lyophilization.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 310
[1501] Alternative purification methods that can be employed for the purification of examples listed below are as follows:
[1502] Purifications can also be performed via Prep HPLC (Stationary phase: RP Xselect CSH Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.1% FA solution in water, CH.sub.3CN or MeOH).
[1503] Purifications can also be performed via Prep HPLC: (Stationary phase: RP Xbridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, MeOH).
[1504] Purifications can also be performed via Prep SFC (Stationary phase: Torus Diol 30×150 mm, Mobile phase: CO.sub.2, MeOH+20 mM NH.sub.4OH).
[1505] These purification methods can also be used in combination.
TABLE-US-00068 Compound No. Structure Starting Materials Compound 311
Preparation of Compound 328:
[1506] ##STR00938##
[1507] A stock solution of intermediate 374 (39.1 mg, 0.075 mmol), DIPEA (0.038 mL, 0.2 mmol) and HATU (42.8 mg, 0.1 mmol) in DMF (0.56 mL) was added to a pre-weighed (S)-(+)-2-pyrrolidinemethanol (0.15 mmol, 2 equiv). The resulting solution was stirred for 2 h at rt. Afterwards the solvent was removed under reduced pressure. To the vial was added 2 mL of a DCM/EtOAc=2/1 mix and 1 mL aq. 1N citric acid solution and mixture was stirred for 5 minutes. The organic phase was collected, and the solvent removed under reduced pressure. 3 mL of a 2/1 mix MeOH/MeCN was added. Purification was performed via Prep HPLC (Stationary phase: RP XBridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, CH.sub.3CN) to give Compound 328 (31 mg, 69% yield) after lyophilization.
The Following Compounds were Synthesized by an Analogous Method as Described for Compound 328
[1508] Alternative purification methods that can be employed for the purification of examples listed below are as follows:
[1509] Purifications can also be performed via Prep HPLC (Stationary phase: RP Xselect CSH Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.1% FA solution in water, CH.sub.3CN or MeOH).
[1510] Purifications can also be performed via Prep HPLC: (Stationary phase: RP Xbridge Prep C18 OBD-10 μm, 30×150 mm, Mobile phase: 0.25% NH.sub.4HCO.sub.3 solution in water, MeOH).
[1511] Purifications can also be performed via Prep SFC (Stationary phase: Torus Diol 30×150 mm, Mobile phase: CO.sub.2, MeOH+20 mM NH.sub.4OH).
[1512] These purification methods can also be used in combination.
TABLE-US-00069 Compound No. Structure Starting Materials Compound 329
LCMS (Liquid Chromatography/Mass Spectrometry)
General Procedure
[1513] The High Performance Liquid Chromatography (HPLC) measurement was performed using a LC pump, a diode-array (DAD) or a UV detector and a column as specified in the respective methods. If necessary, additional detectors were included (see table of methods below).
[1514] Flow from the column was brought to the Mass Spectrometer (MS) which was configured with an atmospheric pressure ion source. It is within the knowledge of the skilled person to set the tune parameters (e.g. scanning range, dwell time . . . ) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW). Data acquisition was performed with appropriate software.
[1515] Compounds are described by their experimental retention times (Rt) and ions. If not specified differently in the table of data, the reported molecular ion corresponds to the [M+H].sup.+ (protonated molecule) and/or [M−H].sup.− (deprotonated molecule). In case the compound was not directly ionizable the type of adduct is specified (i.e. [M+NH.sub.4].sup.+, [M+HCOO].sup.−, etc. . . . ). For molecules with multiple isotopic patterns (Br, Cl . . . ), the reported value is the one obtained for the lowest isotope mass. All results were obtained with experimental uncertainties that are commonly associated with the method used.
[1516] Hereinafter, “SQD” means Single Quadrupole Detector, “RT” room temperature, “BEH” bridged ethylsiloxane/silica hybrid, “HSS” High Strength Silica, “DAD” Diode Array Detector.
TABLE-US-00070 TABLE 1a LCMS Method codes (Flow expressed in mL/min; column temperature (T) in ° C.; Run time in minutes). “TFA” means trifluoroacetic acid; “FA” means formic acid Flow (ml/min) - - - Run Method Mobile Column time code Instrument Column phase Gradient T (° C.) (min) 1 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Techno- 5 um CH.sub.3COONH.sub.4; 5% A in 4.00 min, held for - - - logies 1200 4.6*50 mm B: CH.sub.3CN 1.50 min, back to 95% A in 40 Series, 0.10 min, held for 0.40 G6110A min 2 Agilent Xbridge C18, A: 0.05% 95% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; 50% A in 4.00 min, then - - - logies 1200 4.6*50 mm B: CH.sub.3CN to 5% A in 0.50 min, held 40 Series, for 1.00 min, back to 95% G6110A A in 0.10 min, held for 0.40 min 3 Agilent Xbridge C18, A: 0.05% 95% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; 5% A in 4.00 min, held for - - - logies 1200 4.6*50 mm B: CH.sub.3CN 1.50 min, back to 95% A 40 Series, in 0.10 min, held for 0.40 G6110A min 4 Agilent Xbridge C18, A: 0.05% 90% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; B: 70% A in 4.00 min, then - - - logies 1200 4.6*50 mm CH.sub.3CN to 5% A in 0.50 min, held 40 Series, for 1.00 min, back to 90% G6110A A in 0.10 min, held for 0.40 min 5 Agilent Xbridge C18, A: 0.05% 98% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; B: 60% A in 4.00 min, then - - - logies 1200 4.6*50 mm CH.sub.3CN to 5% A in 0.50 min, held 40 Series, for 1.00 min, back to 98% G6110A A in 0.10 min, held for 0.40 min 6 Agilent Xbridge C18, A: 0.05% 95% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; B: 5% A in 4.00 min, held for - - - logies 1200 4.6*50 mm CH.sub.3CN 1.50 min, back to 95% A 40 Series, in 0.10 min, held for 0.40 G6130A min 7 Agilent Xbridge C18, A: 0.05% 95% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; B: 50% A in 4.00 min, then - - - logies 1200 4.6*50 mm CH.sub.3CN to 5% A in 0.50 min, held 40 Series, for 1.00 min, back to 95% G6130A A in 0.10 min, held for 0.40 min 8 Agilent ZORBAX A: 0.05% 90% A for 3.00 min, to 1.5 15 Techno- SB-C8, TFA; B: 5% A in 8.00 min, held for - - - logies 1200 3.5 um CH.sub.3CN 3.60 min, back to 90% A 40 Series, 4.6*150 mm in 0.10 min, held for 0.30 G6110A min. 9 Agilent Xbridge C18, A: 0.05% 95% A for 0.50 min, to 1.5 6.5 Techno- 5 um TFA; B: 40% A in 4.00 min, then - - - logies 1200 4.6*50 mm CH.sub.3CN to 5% A in 0.50 min, held 40 Series, for 1.00 min, back to 95% G6110A A in 0.10 min, held for 0.40 min. 10 Agilent Waters mobile phase First, 90% A was held for 0.8 10 1200-6100 XBridge A: H.sub.2O with 0.8 min. Then a gradient - - - C18, 0.04% TFA; was applied to 20% A and 50 (2.0 × 50 mm, mobile phase B: 80% B in 3.7 min and held 5 uM) ACN with for 3 min. And then return 0.02% TFA to 90% A in 2 min and held for 0.5 min. The post time is 0.5 min 11 Agilent Agilent mobile phase a gradient condition from 1.5 3.0 Prime- Poroshell A: 95% A, 5% B to 20% A, - - - 6125B 120 HPH- water(4 L) + N 80% B in 1.2 min, then to 30 C18 1.9 um H.sub.3•H.sub.2O(2.0 5% A, 95% B in 1.3 min, 3.0*30 mm mL); mobile and then to 95% A, 5% B phase B: in 0.01 min and held for acetonitrile(4 0.49 min L) 12 Agilent Agilent mobile phase a gradient condition from 1.5 3.0 Prime- Poroshell A: 95% A, 5% B to 20% A, - - - 6125B 120 EC-C18 water(4 L) + T 80% B in 1.2 min, then to 50 1.9 um FA(1.5 mL) 5% A, 95% B in 1.3 min, 3.0*30 mm and then to 95% A, 5% B in 0.01 min and held for 0.49 min 13 Waters: H- Waters: A: 0.1% Gradient start from 5% of 0.8 3.0 Class + ACQUITY NH.sub.4OH in B increase to 95% within - - - Zspray UPLC BEH water, B: 1.5 min and keep at 95% 40 C18 (1.7 μm, CH.sub.3CN till 2.5 min, then decrease 2.1 × 30 mm) to 5% within 0.01 min and keep at 5% till 3.0 min 14 Agilent: Waters: A: 0.1% FA Gradient start from 5% of 1.2 3.5 1260 Sunfire C18 solution in B increase to 95% within - - - Infinity and 6120 (2.5 μm, water; B: 2.5 min and keep at 95% 50 Quadrupole LC/MS 3.0 × 30 mm) CH.sub.3CN till 3.5 min 15 Waters: Waters: A: 10 mM From 100% A to 5% A 0.6 3.5 Acquity ® BEH NH.sub.4HCO.sub.3 in in 2.10 min, to 0% A in 0.9 - - - UPLC ®- (1.8 μm, 95% H.sub.2O + min, to 5% A in 0.5 min 55 DAD and 2.1*100 mm) 5% CH.sub.3CN; SQD B: CH.sub.3CN 16 Waters: Waters: A: 10 mM From 100% A to 5% A in 0.6 3.5 Acquity ® BEH NH.sub.4HCO.sub.3 in 2.10 min, to 0% A in 0.9 - - - UPLC ® - (1.8 μm, 95% H.sub.2O + min, to 5% A in 0.5 min 55 DAD and 2.1*100 mm) 5% CH.sub.3CN; SQD and B: CH.sub.3CN ELSD 17 Waters: Waters: A: 10 mM From 100% A to 5% A in 0.6 3.5 Acquity ® BEH NH.sub.4HCO.sub.3 in 2.10 min, to 0% A in 0.9 - - - UPLC ®- (1.8 μm, 95% H.sub.2O + min, to 5% A in 0.5 min 55 DAD and 2.1*100 mm) 5% CH.sub.3CN; SQD B: CH.sub.3CN 18 Agilent Xbridge C18, A: 0.02% 1.5 6.5 Technologies 3.5 um CH.sub.3COONH.sub.4; 95% A for 0.50 min, to - - - 1200 4.6*50 mm B: CH.sub.3CN 5% A in 4.00 min, held for 40 Series, 1.50 min, back to 95% A G6110A in 0.10 min, held for 0.40 min. 19 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Technologies 3.5 um 4.6*50 mm CH.sub.3COONH.sub.4; 5% A in 4.00 min, held for - - - 1200 B: CH.sub.3CN 1.50 min, back to 95% A 40 Series, in 0.10 min, held for 0.40 G6130A min. 20 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Technologies 5 um 4.6*50 mm CH.sub.3COONH.sub.4; 40% A in 4.00 min, then - - - 1200 B: CH.sub.3CN to 5% A in 0.50 min, held 40 Series, for 1.00 min, back to 95% G6110A A in 0.10 min, held for 0.40 min. 21 Agilent Xbridge C18, A: 0.02% 85% A for 0.50 min, to 1.5 6.5 Technologies 1200 5 um 4.6*50 mm CH.sub.3COONH.sub.4; 60% A in 4.00 min, then - - - Series, B: CH.sub.3CN to 5% A in 0.50 min, held 40 G6110A for 1.00 min, back to 85% A in 0.10 min, held for 0.40 min. 22 Agilent Xbridge C18, A: 0.05% 95% A for 0.50 min, to 1.5 6.5 Technologies 1200 3.5 um 4.6*50 mm TFA; B: 5% A in 4.00 min, held for - - - Series, CH.sub.3CN 1.50 min, back to 95% A 40 G6130A in 0.10 min, held for 0.40 min 23 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Technologies 1200 3.5 um 4.6*50 mm CH.sub.3COONH.sub.4; 5% A in 4.00 min, held for - - - Series, B: CH.sub.3CN 1.50 min, back to 95% A 40 G6130A in 0.10 min, held for 0.40 min. 24 Agilent Xbridge C18, A: 0.02% 80% A for 0.50 min, to 1.5 6.5 Technologies 1200 3.5 um 4.6*50 mm CH.sub.3COONH.sub.4; 40% A in 4.00 min, then - - - Series, B: CH.sub.3CN to 5% A in 0.50 min, held 40 G6130A for 1.00 min, back to 80% A in 0.10 min, held for 0.40 min. 25 Agilent Xbridge C18, A: 0.02% 90% A for 0.50 min, to 1.5 6.5 Technologies 1200 5 um 4.6*50 mm CH.sub.3COONH.sub.4; 50% A in 4.00 min, then - - - Series, B: CH.sub.3CN to 5% A in 0.50 min, held 40 G6130A for 1.00 min, back to 90% A in 0.10 min, held for 0.40 min. 26 Agilent Xbridge C18, A: 0.05% 85% A for 0.50 min, to 1.5 6.5 Technologies 1200 5 um 4.6*50 mm TFA; B: 70% A in 4.00 min, then - - - Series, CH.sub.3CN to 5% A in 0.50 min, held 40 G6110A for 1.00 min, back to 85% A in 0.10 min, held for 0.40 min. 27 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Technologies 1200 5 um 4.6*50 mm CH.sub.3COONH.sub.4; 5% A in 4.00 min, held for - - - Series, B: CH.sub.3CN 1.50 min, back to 95% A 40 G6130A in 0.10 min, held for 0.40 min. 28 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Technologies 1200 5 um 4.6*50 mm CH.sub.3COONH.sub.4; 40% A in 4.00 min, then - - - Series, B: CH.sub.3CN to 5% A in 0.50 min, held 40 G6130A for 1.00 min, back to 95% A in 0.10 min, held for 0.40 min. 29 Agilent Xbridge C18, A: 0.02% 95% A for 0.50 min, to 1.5 6.5 Technologies 1200 5 um 4.6*50 mm CH.sub.3COONH.sub.4; 50% A in 4.00 min, then - - - Series, B: CH.sub.3CN to 5% A in 0.50 min, held 40 G6110A for 1.00 min, back to 95% A in 0.10 min, held for 0.40 min. 30 Waters: Waters: A: 10 mM From 100% A to 5% A in 0.6 3.5 Acquity ® BEH CH.sub.3COONH.sub.4 2.10 min, to 0% A in - - - UPLC ®- (1.7 μm, in 95% H.sub.2O + 5% 0.9 min, to 5% A in 55 DAD and 2.1*100 mm) CH.sub.3CN 0.5 min SQD B: CH.sub.3CN 31 Waters: Waters: A: 10 mM From 100% A to 5% A 0.6 3.5 Acquity ® BEH NH.sub.4HCO.sub.3 in in 2.10 min, to 0% A in 0.9 - - - UPLC ®- (1.7 μm, 95% H.sub.2O + min, to 5% A in 0.5 min 5 DAD and 2.1*100 mm) 5% CH.sub.3CN SQD B: CH.sub.3CN 32 Waters: Waters: A: 0.1% From 95% A to 0.3 28 Acquity ® BEH NH.sub.4HCO.sub.3 5% A in 20 min, hold 3 - - - UPLC ®- (1.7 μm, in 95% H.sub.2O + 5% min, 45 DAD and 2.1*150 mm) CH.sub.3CN to 95% A in 1 min, SQD B: CH.sub.3CN hold 4 min 33 Agilent XBridge A: 10 mM From 95% A to 20% A in 1.0 30 Technologies C18, 3.5 NH.sub.4HCO.sub.3 in 20 min, hold 2 min, to 95% - - - 1260 um, 4.6 × water pH 9.5 A in 1 min, hold 7 min 45 Series 150 mm B: CH.sub.3CN 34 Waters: Waters: A: 10 mM From 100% A to 0.6 3.5 Acquity ® BEH CH.sub.3COONH.sub.4 5% A in 2.10 min, - - - UPLC ®- (1.7 μm, in 95% H.sub.2O + to 0% A in 0.90 min, 55 DAD and 2.1*100 mm) 5% CH.sub.3CN to 5% A in 0.5 min SQD B: CH.sub.3CN 35 Waters: Waters: A: 0.1% From 100% A to 0.8 2.0 Acquity BEH NH.sub.4HCO.sub.3 5% A in 1.3 min, - - - UPLC ®- (1.7 μm, in 95% H.sub.2O + hold 0.7 min 55 DAD and 2.1*50 mm) 5% CH.sub.3CN SQD B: CH.sub.3CN 36 Waters: Waters: A: 10 mM From 95% A to 0.8 2.0 Acquity ® BEH CH.sub.3COONH.sub.4 5% A in 1.3 min, - - - UPLC ® - (1.7 μm, in 95% H.sub.2O + held for 0.7 min 55 DAD and 2.1*50 mm) 5% CH.sub.3CN SQD B: CH.sub.3CN 37 SHIMADZ MERCK, A:water(4 L) + a gradient condition from 1.5 1.5 U LC20- RP-18e 25- TFA (1.5 mL) 95% A, 5% B to 5% A, - - - MS2010 2 mm B: aceto- 95% B in 0.7 minutes, 50 nitrile (4 L) + hold at these conditions TFA for 0.4 minutes, and then (0.75 mL) to 95% A, 5% B in 0.01 min and held for 0.49 min. 38 Agilent Xtimate C18 A: water(4 L) ) + a gradient condition from 1.2 2.0 LC1200- 2.1*30 mm, 3 TFA (1.5 mL) 90% A, 10% B to 20% A, - - - MS6110 um B: aceto- 80% B in 0.9 minutes, and 50 nitrile(4 L) + T hold at these conditions FA (0.75 mL) for 0.6 minutes, then to 90% A, 10% B in 0.01 min, and held for 0.49 min. 39 SHIMADZ Xbridge A: water(4 L) + a gradient condition from 0.8 7.0 U LC20- Shield RP- NH.sub.3•H.sub.2O 90% A to 20% A, 80% B - - - MS2020 18, 5 um, 2.1* (0.8 mL) in 6 minutes, and hold at 50 50 mm B: aceto- these conditions for 0.5 nitrile minutes, then to 90% A and 10% B in 0.1 min and held for 0.49 min. 40 SHIMADZ Xbridge A: water(4 L) + a gradient condition from 0.8 7.0 U LC20- Shield RP- NH.sub.3•H.sub.2O 70% A to 10% A, 90% B - - - MS2020 18, 5 um, 2.1* (0.8 mL) in 6 minutes, and hold at 50 50 mm B: aceto- these conditions for 0.5 nitrile minutes, then to 70% A and 30% B in 0.1 min and held for 0.49 min.
TABLE-US-00071 TABLE 1b LCMS and melting point data. Co. No. means compound number; R.sub.t means retention time in min. Co. No. Rt [M + 1].sup.+ LCMS method 1 2.81 594.5 9 2 2.81 594.5 9 2a 2.89 594.6 2 3 1.11 614.5 12 4 1.11 614.5 12 4a 1.12 614.5 12 4b 1.11 614.5 12 6 1.67 598.9 13 7 1.33 648.3 14 8 3.02 633.5 4 8a 1.70 633.5 11 8b 1.00 633.5 12 9 3.04 633.5 4 9a 1.00 633.5 12 9a 0.98 633.5 12 9b 1.00 633.5 12 10 2.99 668.6 1 11 2.65 668.6 9 12 2.76 659.5 2 13 2.26 659.6 3 14 3.02 580.6 2 15 2.88 580.5 2 16 3.20 645.5 2 17 2.79 645.6 2 18a 1.09 679.5 12 18b 1.08 679.5 12 19a 1.09 679.5 12 19b 1.09 679.5 12 20 2.87 671.3 2 21 3.10 671.3 4 22 2.70 657.6 2 23 2.23 657.5 6 24 2.73 631.3 2 25 2.74 631.3 2 26a 1.07 677.5 12 26b 1.07 677.5 12 27a 1.69 677.5 11 27b 1.75 677.5 11 27c 1.69 677.5 11 27d 1.75 677.5 11 28 2.60 643.5 2 28b 2.62 643.6 2 30 3.00 629.3 5 31 2.23 629.6 6 32a 2.83 631.3 2 32b 3.02 631.2 4 33a 2.31 666.2 3 33b 2.31 666.2 3 33c 2.96 666.2 2 34a 2.91 667.2 2 34b 2.92 667.2 2 35a 2.91 645.3 2 35b 2.91 645.3 2 36a 2.99 680.5 7 36b 2.97 680.5 7 37a 3.05 681.5 7 37b 3.05 681.5 7 38a 2.89 671.6 7 38b 2.92 671.6 7 39a 1.08 677.5 12 39b 1.09 677.5 12 40a 1.07 677.5 12 40b 1.08 677.5 12 41 0.85 568.3 10 42 2.85 507.4 1 43 3.05 507.4 4 44 0.96 465.3 14 45 1.57 465.7 13 46 1.23 479.7 13 47 1.23 479.8 13 48 3.05 521.2 2 49 3.03 521.2 2 49a 1.081 521.4 12 49b 1.081 521.4 12 50 1.29 548.8 13 51 7.28 548.2 8 58 1.33 562.8 13 59 1.29 578.9 13 60 1.31 573.9 13 61 1.57 493.4 15 62 2.00 592.5 15 63 1.50 534.4 16 64 1.61 570.4 16 65 1.70 550.4 16 66 1.01 564.4 12 67 1.01 559.4 12 68 1.64 598.4 11 69 1.63 598.4 11 70 1.55 562.4 11 71 1.55 562.4 11 72 1.05 562.4 12 73 1.04 562.4 12 74 1.48 548.5 11 75 1.64 613.4 15 76 1.62 625.5 15 77 1.81 527.4 17 77a 1.73 527.5 15 77b 1.73 527.5 15 77c 1.73 527.5 15 77d 1.73 527.5 15 78 1.52 513.4 15 78a 1.57 513.5 15 78b 1.56 513.5 15 78c 1.56 513.5 15 78d 1.57 513.5 15 79 1.55 513.4 15 80 1.41 499.4 15 81 1.14 534.78 13 82 1.16 578.84 13 83 1.48 522.4 16 84 2.681 548.2 1 85 3.399 578.2 1 86 2.771 578.2 1 87 2.734 564.2 1 88 1.11 520.82 13 89 1.21 520.85 13 90a 1.6 534.6 15 90b 1.6 534.6 15 91 1.92 604.5 16 92 1.69 549.4 16 93 1.72 555.4 17 94 1.49 520.5 15 95 3.774 506.4 1 96 1.67 542.4 17 97 1.67 518.4 17 98 1.73 520.4 17 99 1.15 534.89 13 100 1.15 534.89 13 101 2.739 563.2 1 102 2.579 534.2 1 103 1.44 508.4 11 104 1.45 520.5 16 105 2.989 520.1 1 106 2.858 652.1 1 107 0.9 560.3 13 108 2.77 652.2 1 109 2.435 521.4 1 110 2.220 520.1 1 111 2.262 564.2 1 112 2.644 548.1 1 113 2.645 548.2 1 114 1.36 506.4 30 116a 1.589 562.4 12 116b 1.503 564.4 12 117a 1.065 592.5 12 117b 1.068 592.5 12 118 1.044 548.4 11 119a 1.01 508.4 12 119b 0.998 508.4 12 120 2.536 506.1 1 121 3.083 576.2 1 122 3.068 562.2 1 123 2.954 578.2 1 124 1.38 556.09 13 125 1.36 593.06 13 126 1.52 602.07 13 127 1.36 546.4 30 128 1.58 568.4 16 128a 1.6 568.5 15 128b 1.6 568.5 15 128c 1.6 568.5 15 128d 1.6 568.5 15 129 7.343 548.2 1 130 1.76 562.6 15 131 1.8 562.6 15 132 1.8 562.6 15 133 1.76 562.6 15 134 1.45 507.6 15 134a 1.44 507.5 15 134b 1.41 507.5 15 134c 1.44 507.5 15 134d 1.44 507.5 15 135 2.986 574.2 1 136 2.813 578.2 1 137a 1.31 548.93 13 137b 1.4 548.83 13 138 1.85 507.4 16 138a 1.87 507.5 15 138b 1.88 507.3 15 139 1.45 520.4 16 139a 1.52 520.5 17 139b 1.52 520.5 17 140 1.535 562.5 11 141 1.4 566.98 13 142 1.589 562.5 11 143 1.562 562.6 11 144 1.45 507.4 16 145 1.59 562.5 17 146 1.66 562.4 30 147a 1.83 507.5 15 147b 1.83 507.5 15 148 3.885 506.4 1 149 2.493 577.2 1 150 1.046 548.4 11 151 1.03 548.4 11 152 2.979 589.5 1 153 1.97 563.4 16 154 1.96 563.4 16 155 1.531 587.4 11 156 1.16 534.87 13 157 3.635 589.5 2 158 1.5 592.4 11 159 1.546 574.4 11 160 1.83 576.5 30 161 1.37 571.09 13 162 1.071 562.4 11 163 1.068 562.3 11 164a 1.089 562.4 12 164b 1.088 562.4 12 165a 1.61 551.5 15 165b 1.62 551.6 15 166a 1.59 513.5 15 166b 1.59 513.5 15 167a 1.45 499.5 15 167b 1.45 499.5 15 168 2.628 563.2 2 169 1.51 534.4 16 169a 1.54 534.5 16 169b 1.49 534.5 16 170 2.853 577.2 2 171 2.826 534.1 3 172 1.48 621.9 13 173 1.51 593.95 13 174 1.42 619.8 13 175 1.003 534.3 11 176 1.005 534.3 11 177 1.01 564.4 11 178 1.52 588.4 30 179 1.65 588.5 16 180a 1.59 527.5 15 180b 1.6 527.5 15 181a 1.57 527.3 16 181b 1.56 527.4 16 182a 1.31 527.5 15 182b 1.31 527.5 15 183a 1.6 527.5 15 183b 1.6 527.5 15 184a 1.63 548.5 15 184b 1.63 548.6 15 184 1.6 548.4 16 185 1.54 562.4 16 186a 3.449 520.1 26 186b 2.803 520.1 27 187 3.634 546.1 3 188a 1.35 548.88 13 188b 1.44 548.67 13 189 1.41 562.5 17 190a 1.73 493.5 16 190b 1.73 493.5 15 191a 1.43 479.5 17 191b 1.42 479.5 17 192 1.47 547.3 16 193 2.2 505.97 13 194 2.22 505.95 13 195 1.3 534.88 13 196 2.977 506.1 6 197 1.056 557.4 12 198a 1.57 537.4 16 198b 1.57 537.4 16 199 2.569 506.2 8 200 2.708 548.1 9 201 2.758 548.2 9 202 1.37 577.97 13 203 1.55 607.9 13 204 1.46 633.9 13 205 1.61 521.5 17 205a 1.62 521.5 17 205b 1.63 521.5 17 206a 1.33 578.5 15 206b 1.32 578.6 15 207 1.3 549.95 13 208 3.334 546.2 9 209 3.370 546.1 9 210 2.685 548.2 9 211 2.734 548.2 9 212 2.588 520.1 9 213a 1.483 555.3 12 213b 1.481 555.3 12 214 1.37 552.4 16 214a 1.42 552.4 16 214b 1.37 552.4 16 215 1.29 534.88 13 216 2.763 548.2 19 217 1.38 563.87 13 218 1.39 563.8 13 219 1.27 549.7 13 220 2.755 546.1 20 221 1.648 562.4 12 222 2.796 548.2 20 223 3.000 546.1 21 224 1.24 552.4 30 224a 1.24 552.4 30 224b 1.23 552.4 30 225 1.55 619.4 31 226 1.63 562.5 16 227 1.7 562.6 30 228 1.65 562.5 16 229 1.67 562.5 16 230a 1.3 568.5 30 230b 1.29 568.5 30 231a 1.3 568.5 30 231b 1.29 568.5 30 232a 1.29 568.5 30 232b 1.29 568.5 30 233a 1.29 568.5 30 233b 1.3 568.5 30 234 3.200 562.2 22 235 1.51 591.9 13 236 1.079 562.4 12 237 1.47 606.85 13 238 2.277 534.4 22 239 2.431 521.4 22 240a 1.73 564.6 17 240b 1.73 564.5 17 241 1.528 548.4 12 242 1.535 548.4 12 244 1.44 592.69 13 245 1.36 590.8 13 246 1.104 576.5 12 247 1.109 576.4 12 248 1.437 564.4 12 249 1.41 590.61 13 250 1.34 578.56 13 251 1.3 576.59 13 252a 2.618 565.5 28 252b 2.632 565.5 28 253a 2.789 551.2 29 253b 2.778 551.1 18 254 2.474 548.4 22 255 2.552 562.4 22 256 2.770 562.5 22 257 2.710 521.4 23 258 2.932 576.5 23 259 2.840 562.5 26 260 3.092 562.4 25 261 0.81 517 15 262 0.74 503 16 263 0.68 519 16 264 0.7 519 15 265 0.79 491 15 266 0.67 519 16 267 0.75 535 16 268 0.67 521 16 269 0.69 521 16 270 0.7 522 15 271 0.66 521 16 272 0.68 535 16 273 0.65 519 16 274 0.65 521 16 275 0.64 521 16 276 0.69 535 16 277 0.66 521 16 278 0.67 521 16 279 0.77 505 16 280 0.85 519 15 281 0.69 523 16 282 0.65 521 16 283 0.81 542 16 284 0.76 501 16 285 0.73 489 16 286 0.79 479 16 287 0.74 479 16 288 0.76 479 16 289 0.78 493 16 290 0.73 506 16 291 0.76 520 16 292a 0.83 534 16 292b 0.77 534 16 293a 0.83 534 16 293b 0.77 534 16 294a 0.72 546 16 294b 0.73 546 16 295 0.73 534 16 296 0.81 560 16 297 0.87 575 15 298 0.83 575 15 299 0.84 549 15 300 0.78 575 15 301 0.82 549 15 302 0.83 549 15 303 0.75 575 15 304 0.73 547 15 305 0.7 533 15 306 0.75 547 15 307 0.71 510 15 308 0.87 491 15 309a 0.85 533 15 309b 0.75 533 15 310 0.81 573 15 311 0.74 559 15 311a 1.42 558.5 17 311b 1.41 558.5 17 312 0.66 575 15 313 0.68 591 15 313a 1.31 590.6 17 313b 1.32 590.6 17 314 0.75 552 15 315 0.75 561 15 316 0.79 575 15 317 0.81 575 15 318 0.74 591 15 319 0.75 561 15 320 0.73 593 15 320a 1.39 592.6 17 320b 1.5 592.6 17 321 0.75 591 15 322 0.67 577 15 323 0.67 577 15 324 0.65 577 15 325 0.66 577 15 326 0.69 579 15 327 0.65 577 15 328 0.74 605 16 329 0.74 607 16 330 0.79 621 16 331 0.79 621 16 332 0.72 605 16 333 0.72 605 16 334 0.75 595 16 335 0.79 609 16 336 0.79 609 16 337 0.75 593 16 338 0.8 607 16 339 0.8 607 16 340 0.83 617 15 341 0.73 602.5 16 342 0.98 619 15 343 0.96 619 15 344 0.82 619 16 345 0.66 619 16 346 0.76 619 16 347 0.8 630 15 348 0.84 646 15 349 0.71 617 15 350 0.76 633 15 351a 6.47 544.4 32 351b 7.78 544.4 32 352a 1.4 560.6 17 352b 1.39 560.6 17 353a 1.34 546.5 17 353b 1.34 546.5 17 354 1.46 574.6 17 357 0.69 537.4 32 358 0.65 535.4 32 359 0.65 535.4 32 360 0.67 535.3 32 361 0.68 535.4 32 362a 1.35 549.6 15 362b 1.3 549.6 15 363a 1.53 549.5 16 363b 1.55 549.5 16 364a 1.35 549.5 17 364b 1.34 549.5 17 365a 1.65 551.5 17 365b 1.65 551.6 17 366 3.53 565.2 2 367 3.53 565.2 2 368 3.52 565.2 2 369 4.94 565.4 39 370 0.707 585.1 37 371 0.703 585.2 37 372 0.693 585.2 37 373 0.701 585.1 37 374 0.658 585.2 37 375 0.658 585.1 37 378 1.69 606.84 14 380 1.74 620.89 14 383 2.11 592.5 15 386 1.464 618.3 14 387 0.708 620.4 37 388 0.708 620.4 37 392 1.490 624.3 14 394 2.29 606.4 15 395 4.560 606.5 39 396 4.635 606.5 39 398 0.689 592.3 37 399 0.693 592.3 37 400 2.10 620.5 15 401 2.00 606.5 15 402 0.758 620.5 37 403 0.757 620.4 37 407 1.83 563.4 15 414 1.97 620.5 14 415 1.98 620.4 14 420 0.701 606.2 37 421 0.699 606.2 37 422 0.664 634.9 37 423 0.660 634.9 37 428 2.754 620.5 1 429 1.37 492.4 16 431 1.37 492.4 15 433 1.12 520.5 14 434 0.334 492.3 14 435 0.409 492.3 14 437 0.609 466.3 37 438 0.364 518.3 14 441 0.566 506.2 37 442 0.321 520.3 37 443 0.427 520.3 37 449 0.351 506.4 40 444 0.609 466.3 37 446 1.35 504.4 15 448 0.98 506.4 35 452 0.595 492.2 37 453 0.591 492.3 37 454 0.396 522.3 38 456 1.41 520.4 15 457 1.35 506.4 15 458 0.321 520.3 37 459 0.427 520.3 37 468 1.69 520.2 14 469 1.68 520.54 14 486 0.665 620.3 37 487 0.743 606.8 37 488 0.577 520.3 37 489 2.24 613 15 490 1.44 513.4 15 491 1.487 592.3 14 492 1.51 592.9 14 497 1.95 563.4 15 498 4.209 549.4 39 499 4.282 549.5 39 500 4.266 622.6 39 503 1.33 423.3 15 504 1.34 423.3 31 505 1.33 423.3 15 507 1.33 423.3 15 508 1.29 423.3 15 509 1.34 423.4 34 510 1.34 423.4 34 516 1.08 535.5 35 517 1.09 523.3 35 519 1.51 547.5 34 520 0.74 551 36 521 1.76 560.5 34 522 1.33 423.3 15 525 0.765 640.3 37 526a 0.681 563.3 37 526b 0.674 563.3 37 527 0.76 452 36 528 1.44 507.4 34 529 1.00 565 36 530 0.61 465 36 532 1.30 565 35 533 0.68 493 36 534 1.51 466.3 16
Analytical SFC
General Procedure for SFC Methods
[1517] The SFC measurement was performed using an Analytical Supercritical fluid chromatography (SFC) system composed by a binary pump for delivering carbon dioxide (CO.sub.2) and modifier, an autosampler, a column oven, a diode array detector equipped with a high-pressure flow cell standing up to 400 bars. If configured with a Mass Spectrometer (MS) the flow from the column was brought to the (NIS), It is within the knowledge of the skilled person to set the tune parameters (e.g. scanning range, dwell time . . . ) in order to obtain ions allowing the identification of the compound's nominal monoisotopic molecular weight (MW). Data acquisition was performed with appropriate software.
TABLE-US-00072 TABLE 1c Analytical SFC Methods (Flow expressed in mL/min; column temperature (T) in ° C.; Run time in minutes, Backpressure (BPR) in bars or pound-force per square inch (psi). “ACN” means acetonitrile; “MeOH” means methanol; “EtOH” means ethanol; “iPrNH.sub.2” means isopropylamine. All other abbreviations used in the table below are as defined before Flow- (ml/mn) Run time — (min) Method Column T — code Column Mobile phase Gradient (° C.) BPR (bar) 1 Daicel A: supercritical 10%-50% B in 6 2.5 9.5 Chiralpak ® CO.sub.2 min, hold 3.5 min — — AD3 B: iPrOH + 0.2% 40 130 column (3.0 iPrNH.sub.2 μm, 150 × 4.6 mm) 2 Daicel A: supercritical 10%-50% B in 6 2.5 9.5 Chiralpak ® CO.sub.2 min, hold 3.5 min — — IG3 B: EtOH + 0.2% 40 130 column (3.0 iPrNH.sub.2 μm, 150 × 4.6 mm)
NMR:
NMR-Methods
[1518] Some NMR experiments were carried out using a Bruker Avance III 400 spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with BBO 400 MHz S1 5 mm probe head with z gradients and operating at 400 MHz for the proton and 100 MHz for carbon. Chemical shifts (d) are reported in parts per million (ppm). J values are expressed in Hz.
[1519] Some NMR experiments were carried out using a Varian 400-MR spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with Varian 400 4NUC PFG probe head with z gradients and operating at 400 MHz for the proton and 100 MHz for carbon. Chemical shifts (d) are reported in parts per million (ppm). J values are expressed in Hz.
[1520] Some NMR experiments were carried out using a Varian 400-VNMRS spectrometer at ambient temperature (298.6 K), using internal deuterium lock and equipped with Varian 400 ASW PFG probe head with z gradients and operating at 400 MHz for the proton and 100 MHz for carbon. Chemical shifts (d) are reported in parts per million (ppm). J values are expressed in Hz.
TABLE-US-00073 Compound number NMR data Compound 8 .sup.1H NMR (400 MHZ, DMSO-d6) 8.43-8.33 (m, 1H), 7.92 (d, J = 7.2 Hz, 1H), 7.65-7.62 (m, 1H), 7.50-7.42 (m, 2H), 7.27-7.22 (m, 1H), 6.54 (s, 3.0H), 4.43-4.36 (m, 0.54H), 3.52-3.46 (m, 0.55H), 3.37-3.35 (m, 4H), 2.93-2.89 (m, 2H), 2.63-2.58 (m, 6H), 2.36-2.34 (m, 8H), 1.96 (s, 3H), 1.84 (s, 6H), 1.48-1.36 (m, 5H), 0.96-0.83 (m, 9H), 0.46-0.16 (m, 3H). Compound 8a .sup.1H NMR (400 MHz, METHANOL-d4) = 8.46 (s, 1H), 8.41 (d, J = 11.6 Hz, 1H), 7.98 (d, J = 4.8 Hz, 1H), 7.70-7.64 (m, 1H), 7.55-7.43 (m, 2H), 7.38 (dd, J = 2.4, 8.0 Hz, 1H), 3.84-3.46 (m, 8H), 3.26-3.07 (m, 4H), 2.89-2.71 (m, 4H), 2.69-2.47 (m, 9H), 2.31 (s, 2H), 2.10 (s, 3H), 1.96-1.54 (m, 5H), 1.31 (d, J = 18.0 Hz, 1H), 1.13-0.83 (m, 9H), 0.69- 0.20 (m, 2H) Compound 9a .sup.1H NMR (400 MHZ, METHANOL-d4) = 8.43-8.34 (m, 1H), 7.93 (d, J = 8.0 Hz, 1H), 7.66-7.60 (m, 1H), 7.47-7.40 (m, 1H), 7.37-7.31 (m, 2H), 3.54 (d, J = 18.0 Hz, 4H), 3.10-2.91 (m, 3H), 2.81-2.67 (m, 6H), 2.51-2.33 (m, 8H), 2.09 (s, 3H), 2.03 (d, J = 5.2 Hz, 2H), 1.75-1.40 (m, 4H), 1.31 (d, J = 18.0 Hz, 5H), 1.05-0.88 (m, 9H), 0.53 (s, 1H), 0.22 (dd, J = 6.4, 12.0 Hz, 2H) Compound 32a .sup.1H NMR (400 MHZ, DMSO-d6) 8.42-8.34 (m, 1H), 7.93-7.92 (m, 1H), 7.65-7.62 (m, 1H), 7.48-7.41 (m, 2H), 7.18-7.15 (m, 1H), 4.42-4.38 (m, 0.54H), 3.50-3.45 (m, 0.55H), 3.37 (s, br, 5H), 3.07-3.05 (m, 2H), 2.89- 2.81 (m, 2H), 2.60-2.56 (m, 5H), 2.33-2.30 (m, 2H), 2.18-2,11 (m, 4H), 1.96 (s, 3H), 1.87 (s, 10H), 1.67-1.60 (m, 2H), 1.52-1.47 (m, 1H), 0.94- 0.81 (m, 7H), 0.48-0.18 (m, 1H). Compound 43 .sup.1H NMR (400 MHZ, DMSO-d6) d 8.43-8.34 (m, 1H), 7.94-7.92 (m, 1H), 7.65-7.62 (m, 1H), 7.50-7.42 (m, 2H), 7.28-7.22 (m, 1H), 4.41- 4.39 (m, 0.5H), 3.80 (dd, J = 7.2 Hz; 3.6 Hz, 2H), 3.51-3.48 (m, 1H), 3.31-3.23 (m, 2.5H), 2.93-2.86 (m, 2H), 2.68-2.66 (m, 1H), 2.61- 2.58 (m, 5H), 2.55-2.51 (m, 0.5H), 2.48-2.46 (m, 0.5H), 2.44-2.37 (m, 1.5H), 2.34 (s, 1.5H), 2.33-2.18 (m, 3H), 1.96-1.95 (m,1H), 1.68- 1.60 (m, 3H), 1.49-1.45 (m, 1H), 1.16-1.06 (m, 2H), 0.96-0.94 (m, 2.5H), 0.48-0.47 (m, 1H), 0.20-0.17 (m, 1.5H). Compound 51 .sup.1H NMR (400 MHZ, DMSO-d6): δ 8.43-8.34 (m, 1H), 7.94-7.92 (m, 1H), 7.67-7.62 (m, 1H), 7.50-7.42 (m, 2H), 7.28-7.22 (m, 1H), 4.42-4.39 (m, 0.43H), 4.34-4.31 (m, 1H), 3.78-3.74 (m, 1H), 3.51-3.46 (m, 0.53H), 3.00-2.84 (m, 3H), 2.71-2.55 (m, 7H), 2.48-2.34 (m, 4H), 2.28-2.14 (m, 3H), 2.00-1.90 (m, 4H), 1.75-1.65 (m, 3H), 1.50-1.44 (m, 1H), 1.06-0.84 (m, 5H), 0.48-0.17 (m, 3H). Compound 51a .sup.1H NMR (400 MHZ, DMSO-d.sub.6, 27° C.) δ ppm 0.18-0.53 (m, 3 H), 0.89- 1.29 (m, 5 H), 1.68-1.89 (m, 3 H), 1.98 (d, J = 1.3 Hz, 4 H), 2.07-2.29 (m, 1 H), 2.37 (s, 1 H), 2.57 (s, 2 H), 2.63 (s, 3 H), 2.94-3.15 (m, 6 H), 3.48-3.54 (m, 0.5 H), 3.56-3.75 (m, 2 H), 3.76-3.86 (m, 1 H), 4.35 (br d, J = 14.3 Hz, 2 H), 4.38-4.42 (m, 0.5 H), 7.32-7.42 (m, 1 H), 7.44- 7.54 (m, 2 H), 7.62-7.71 (m, 1 H), 7.97 (d, J = 5.5 Hz, 1 H), 8.34-8.47 (m, 1 H), 10.01-10.48 (m, 1 H). Compound 59 .sup.1H NMR (400 MHZ, DMSO-d6) δ = 8.56-8.25 (m, 1H), 8.04-7.82 (m, 1H), 7.70-7.58 (m, 1H), 7.56-7.38 (m, 2H), 7.33-7.17 (m, 1H), 4.49- 4.35 (m, 0.5H), 4.35-4.24 (m, 1H), 4.10-3.93 (m, 2H), 3.82-3.66 (m, 1H), 3.55-3.37 (m, 0.5H), 3.27-3.21 (m, 3H), 2.99-2.79 (m, 3H), 2.73-2.55 (m, 7H), 2.43-2.30 (m, 3H), 2.30-2.09 (m, 4H), 2.04-1.84 (m, 1H), 1.81-1.59 (m, 3H), 1.54-1.36 (m, 1H), 1.12-0.81 (m, 5H), 0.63-0.10 (m, 3H). Compound 60 .sup.1H NMR (400 MHZ, DMSO-d6) δ = 8.48-8.27 (m, 1H), 7.98-7.90 (m, 1H), 7.72-7.60 (m, 1H), 7.53-7.40 (m, 2H), 7.31-7.19 (m, 1H), 4.48- 4.33 (m, 0.5H), 4.33-4.23 (m, 1H), 4.08-3.92 (m, 2H), 3.66-3.57 (m, 1H), 3.55-3.42 (m, 0.5H), 3.08-2.79 (m, 3H), 2.74-2.55 (m, 7H), 2.43-2.11 (m, 6H), 2.06-1.82 (m, 1H), 1.80-1.61 (m, 3H), 1.56-1.37 (m, 1H), 1.16-0.82 (m, 5H), 0.62-0.09 (m, 3H). Compound 117a .sup.1H NMR (400 MHZ, METHANOL-d4) 8.44-8.32 (m, 1H), 7.92 (d, J = 7.6 Hz, 1H), 7.67-7.59 (m, 1H), 7.47-7.39 (m, 1H), 7.38-7.30 (m, 2H), 4.52-4.46 (m, 0.5H), 4.22-4.07 (m, 2H), 3.92-3.84 (m, 1H), 3.63-3.54 (m, 0.5H), 3.39 (s, 3H), 3.11-2.80 (m, 4H), 2.79-2.48 (m, 9H), 2.46-1.85 (m, 6H), 1.84-1.74 (m, 1H), 1.72-1.51 (m, 2H), 1.30- 1.12 (m, 2H), 1.10-0.87 (m, 6H), 0.59-0.18 (m, 3H) Compound 125 .sup.1H NMR (400 MHZ, DMSO-d6) δ ppm −0.04 (br d, J = 2.1 Hz, 1 H), 0.13- 0.22 (m, 2 H), 0.36-0.60 (m, 1 H), 0.85-0.88 (m, 1 H), 0.90-0.99 (m, 3 H), 1.24 (br s, 1 H), 1.29 (s, 6 H), 1.41-1.53 (m, 1 H), 1.64 (br d, J = 1.7 Hz, 1 H), 1.67-1.75 (m, 2 H), 1.87-2.02 (m, 1 H), 2.13-2.28 (m, 3 H), 2.32-2.42 (m, 3 H), 2.56-2.63 (m, 5 H), 2.64-2.74 (m, 1 H), 2.77-3.01 (m, 3 H), 3.14-3.27 (m, 1 H), 3.38-3.58 (m, 1 H), 4.33- 4.48 (m, 1 H), 5.30 (s, 1 H), 7.23 (d, J = 8.2 Hz, 1 H), 7.28 (s, 1 H), 7.42- 7.51 (m, 2 H), 7.61-7.68 (m, 1 H), 7.93 (d, J = 7.9 Hz, 1 H), 8.30-8.47 (m, 1 H), 8.34 (s, 1 H), 8.43 (d, J = 2.6 Hz, 1 H) Compound 169a .sup.1H NMR (400 MHZ, DMSO-d6, 27° C.) d ppm 0.12-0.25 (m, 2 H), 0.36- 0.63 (m, 1 H), 0.81-1.12 (m, 5 H), 1.33-1.55 (m, 1 H), 1.59-2.06 (m, 4 H), 2.08-2.27 (m, 4 H), 2.34 (s, 5 H), 2.56-2.65 (m, 5 H), 2.79- 3.16 (m, 4 H), 3.42 (s, 1 H), 4.32-4.48 (m, 1 H), 7.18-7.31 (m, 1 H), 7.32-7.54 (m, 3 H), 7.57-7.72 (m, 1 H), 7.86-7.99 (m, 1 H), 8.27- 8.51 (m, 1 H) Compound 228 .sup.1H NMR (400 MHZ, DMSO-d6, 100° C.) d ppm 0.25-0.89 (m, 6 H), 0.95 (s, 2 H), 1.04 (s, 3 H), 1.39-1.52 (m, 1 H), 1.61-1.72 (m, 2 H), 1.78-1.85 (m, 1 H), 1.87-1.95 (m, 2 H), 1.97 (s, 3 H), 2.09 (dd, J = 12.1, 4.5 Hz, 1 H), 2.16 (quin, J = 6.2 Hz, 1 H), 2.25 (q, J = 8.4 Hz, 1 H), 2.41 (br s, 1.5 H rotamer), 2.51-2.52 (m, 1 H), 2.60 (s, 1.5 Hrotamer), 2.62-2.65 (m, 3 H), 2.72 (br dd, J = 14.9, 9.3 Hz, 1 H), 3.02- 3.11 (m, 2 H), 3.51-3.62 (m, 0.5 H rotamer), 3.64-4.33 (m, 4 H), 4.35- 4.44 (m, 0.5 H rotamer), 7.25 (s, 1 H), 7.35 (dd, J = 8.5, 3.0 Hz, 1 H), 7.43 (td, J = 8.5, 3.0 Hz, 1 H), 7.58 (dd, J = 8.8, 5.0 Hz, 1 H), 7.94 (br s, 1 H), 8.29-8.44 (m, 1 H) Compound 365b .sup.1H NMR (400 MHZ, DMSO-d6, 27° C.) δ ppm 0.28 (br d, J = 6.2 Hz, 1 H), 0.39 (br d, J = 6.4 Hz, 1 H), 0.68 (d, J = 6.3 Hz, 1 H), 0.74-0.83 (m, 2 H), 0.83-0.91 (m, 2 H), 0.91-1.00 (m, 2 H), 1.04-1.16 (m, 2 H), 1.42- 1.52 (m, 1 H), 1.56-1.67 (m, 3 H), 1.92-2.02 (m, 1 H), 2.17-2.29 (m, 3 H), 2.32-2.48 (m, 2 H), 2.52-2.65 (m, 5 H), 2.81-2.92 (m, 3 H), 2.96 (br dd, J = 13.6, 5.7 Hz, 1 H), 3.10 (br dd, J = 13.6, 6.2 Hz, 1 H), 3.18- 3.30 (m, 3 H), 3.39-3.62 (m, 2 H), 3.67-3.89 (m, 3 H), 4.57-4.77 (m, 1 H), 7.24-7.29 (m, 1 H), 7.37-7.56 (m, 2 H), 7.56-7.64 (m, 1 H), 7.90-7.94 (m, 1 H), 8.26-8.37 (m, 1 H)
DSC
[1521] For a number of compounds, melting points (MP) were determined with a TA Instrument (Discovery DSC 250 or a DSC 2500). Melting points were measured with a temperature gradient of 10° C./minute. Maximum temperature was 300° C. Values are melting peak onset values.
XPRD
[1522] Compound 51 as a Crystalline Free Base Form Compound 51 as a crystalline free base Form may be characterized by an X-ray powder diffraction pattern.
[1523] X-ray powder diffraction (XRPD) analysis was carried out on a PANalytical Empyrean diffractometer. The compound was loaded onto a zero-background silicon wafer sample holder by gently pressing the powder sample onto the flat surface.
[1524] Samples were run on XRPD using the method below: [1525] Radiation: Cu K-Alpha (λ=1.5418 Å) [1526] Tube voltage/current: 45 kV/40 mA [1527] Divergence slit: ⅛° [1528] Geometry: Bragg-Brentano [1529] Scan mode: Continuous Scan [1530] Scan Range: 3-40° 2θ [1531] Step size: 0.013° 2θ [1532] Scan speed: 20.4 s/step [1533] Rotation: On [1534] Detector: PIXcel.sup.1D
[1535] One skilled in the art will recognize that diffraction patterns and peak positions are typically substantially independent of the diffractometer used and whether a specific calibration method is utilized. Typically, the peak positions may differ by about ±0.2° 2θ, or less. The intensities (and relative intensities) of each specific diffraction peak may also vary as a function of various factors, including but not limited to particle size, orientation, sample purity, etc.
[1536] The X-ray powder diffraction pattern comprises peaks at 9.3, 12.6, 15.7, 21.9 and 22.5° 2θ 0.2° 2θ. The X-ray powder diffraction pattern may further comprise at least one peak selected from 8.1, 11.6, 13.2, 16.8, 18.5, 18.7, 19.2, 19.9, 20.5° 2θ 0.2° 2θ.
[1537] Compound 51 as a crystalline free base Form may further be characterized by an X-ray powder diffraction pattern having four, five, six, seven, eight, nine or more peaks selected from those peaks identified in Table 2a.
[1538] Compound 51 as a crystalline free base Form may further be characterized by an X-ray powder diffraction pattern comprising those peaks identified in Table 2a, wherein the relative intensity of the peaks is greater than about 2%, preferably greater than about 5%, more preferably greater than about 10%, more preferably greater than about 15%. However, a skilled person will realize that the relative intensity of the peaks may vary between different samples and different measurements on the same sample.
[1539] Compound 51 as a crystalline free base Form may further be characterized by an X-ray powder diffraction pattern substantially as depicted in
[1540] Table 2a provides peak listing and relative intensity for the XPRD of Compound 51 as a crystalline free base Form:
TABLE-US-00074 Pos. Rel. Int. Pos. Rel. Int. No. (° 2θ) (%) No. (° 2θ) (%) 1 7.411 4.6 16 18.744 63.6 2 8.056 31.4 17 19.15 48.8 3 9.304 100 18 19.57 16.4 4 9.893 18.2 19 19.912 32.2 5 11.574 28.1 20 20.503 38.2 6 11.969 6.4 21 21.881 65.4 7 12.598 55.9 22 22.485 57.1 8 13.163 37.6 23 23.693 13 9 14.804 7.9 24 24.205 5.6 10 15.723 89.6 25 24.915 15.2 11 16.195 24.4 26 25.401 19.6 12 16.762 34.5 27 26.068 5.3 13 17.076 21.2 28 26.400 14.5 14 17.694 9.5 29 28.276 8 15 18.454 33.2 30 28.499 11
Compound 51a Crystalline HCl Salt Form (Mono HCl Trihydrate Salt)
[1541] Compound 51a (Crystalline HCl salt Form —mono HCl trihydrate salt) may be characterized by an X-ray powder diffraction pattern.
[1542] X-ray powder diffraction (XRPD) analysis was carried out on a PANalytical Empyrean diffractometer. The compound was loaded onto a zero-background silicon wafer sample holder by gently pressing the powder sample onto the flat surface.
[1543] Samples were run on XRPD using the method below: [1544] Radiation: Cu K-Alpha (λ=1.5418 Å) [1545] Tube voltage/current: 45 kV/40 mA [1546] Divergence slit: ⅛° [1547] Geometry: Bragg-Brentano [1548] Scan mode: Continuous Scan [1549] Scan Range: 3-40° 2θ [1550] Step size: 0.013° 2θ [1551] Scan speed: 20.4 s/step [1552] Rotation: On [1553] Detector: PIXcel.sup.1D
[1554] One skilled in the art will recognize that diffraction patterns and peak positions are typically substantially independent of the diffractometer used and whether a specific calibration method is utilized. Typically, the peak positions may differ by about ±0.2° 2θ, or less. The intensities (and relative intensities) of each specific diffraction peak may also vary as a function of various factors, including but not limited to particle size, orientation, sample purity, etc.
[1555] The X-ray powder diffraction pattern comprises peaks at 5.2, 13.2, 14.1, 18.8 and 20.3° 2θ 0.2° 2θ. The X-ray powder diffraction pattern may further comprise at least one peak selected from 9.7, 10.0, 15.4, 15.8, 18.3, 21.3, 24.3° 2θ±0.2° 2θ.
[1556] Compound 51a may further be characterized by an X-ray powder diffraction pattern having four, five, six, seven, eight, nine or more peaks selected from those peaks identified in Table 2b.
[1557] Compound 51a may further be characterized by an X-ray powder diffraction pattern comprising those peaks identified in Table 2b, wherein the relative intensity of the peaks is greater than about 2%, preferably greater than about 5%, more preferably greater than about 10%, more preferably greater than about 15%. However, a skilled person will realize that the relative intensity of the peaks may vary between different samples and different measurements on the same sample.
[1558] Compound 51a may further be characterized by an X-ray powder diffraction pattern substantially as depicted in
[1559] Table 2b provides peak listing and relative intensity for the XPRD of Compound 51a.
TABLE-US-00075 Pos. Rel. Int. Pos. Rel. Int. No. (° 2θ) (%) No. (° 2θ) (%) 1 5.151 36 13 19.505 16.6 2 9.749 37.2 14 20.305 100 3 9.984 58.9 15 21.331 16.6 4 13.217 34 16 21.855 6.8 5 14.095 64.4 17 22.905 4.5 6 15.393 20.4 18 23.419 8.2 7 15.842 16.4 19 24.310 17.4 8 16.315 10.4 20 25.136 10.6 9 17.471 10.1 21 25.595 7.1 10 18.296 19.4 22 26.529 12.9 11 18.810 34.3 23 29.496 4.5 12 19.19 10.8 24 30.179 6.1
Dynamic Vapor Sorption (DVS)
[1560] The moisture sorption analysis (DVS) was performed using a ProUmid GmbH & Co. KG Vsorp Enhanced dynamic vapor sorption apparatus. Results are shown in
[1561] The DVS change in mass plot of crystalline HCl salt Form (Compound 51a) shows that the crystalline form is hygroscopic with the water content varying with relative humidity and dehydrates rapidly at below 10% RH (relative humidity) to complete dehydrated state at 0% RH. In the humidity range of 20-90% RH, the crystalline form adsorbs and desorbs moisture slowly and reversibly up to 2.5% by mass on average. Based on DVS, the crystalline HCl salt Form, at equilibrium, can contain around 3 equivalents of water (8.5-9.5% total moisture mass) at common ambient RH of 40% to 75%. The XRPD pattern of the fraction obtained after the DVS test was comparable to the starting material. No indication of a solid-state form change was observed.
Pharmacological Part
1) Menin/MLL Homogenous Time-Resolved Fluorescence (HTRF) Assay
[1562] To an untreated, white 384-well microtiter plate was added 40 nL 200× test compound in DMSO and 4 μL 2× terbium chelate-labeled menin (vide infra for preparation) in assay buffer (40 mM Tris HCl, pH 7.5, 50 mM NaCl. 1 mM DTT (dithiothreitol) and 0.05% Pluronic F-127). After incubation of test compound and terbium chelate-labeled menin for 30 min at ambient temperature, 4 μL 2×FITC-MBM1 peptide (FITC-β-alanine-SARWRFPARPGT-NH.sub.2) (“FITC” means fluorescein isothiocyanate) in assay buffer was added, the microtiter plate centrifuged at 1000 rpm for 1 min and the assay mixtures incubated for 15 min at ambient temperature. The relative amount of menin FITC-MBM1 complex present in an assay mixture is determined by measuring the homogenous time-resolved fluorescence (HTRF) of the terbium/FITC donor/acceptor fluorphore pair using an EnVision microplate reader (ex. 337 nm/terbium em. 490 nm/FITC em. 520 nm) at ambient temperature. The degree of fluorescence resonance energy transfer (the HTRF value) is expressed as the ratio of the fluorescence emission intensities of the FITC and terbium fluorophores (F.sup.em520 nm/F.sup.em490 nm). The final concentrations of reagents in the binding assay are 200 μM terbium chelate-labeled menin, 75 nM FITC-MBM1 peptide and 0.5% DMSO in assay buffer. Dose-response titrations of test compounds are conducted using an 11 point, four-fold serial dilution scheme, starting typically at 10 μM.
[1563] Compound potencies were determined by first calculating % inhibition at each compound concentration according to equation 1:
% inhibition=((HC−LC)−(HTRF.sup.compound−LC))/(HC−LC))*100 (Eqn 1)
[1564] Where LC and HC are the HTRF values of the assay in the presence or absence of a saturating concentration of a compound that competes with FITC-MBM1 for binding to menin, and HTRF.sup.compound is the measured HTRF value in the presence of the test compound. HC and LC HTRF values represent an average of at least 10 replicates per plate. For each test compound, % inhibition values were plotted vs. the logarithm of the test compound concentration, and the IC.sub.50 value derived from fitting these data to equation 2:
% inhibition=Bottom+(Top−Bottom)/(1+10{circumflex over ( )}((log/C.sub.50−log[cmpd])*h)) (Eqn 2)
[1565] Where Bottom and Top are the lower and upper asymptotes of the dose-response curve, respectively, IC.sub.50 is the concentration of compound that yields 50% inhibition of signal and h is the Hill coefficient.
[1566] Preparation of Terbium cryptate labeling of Menin: Menin (a.a 1-610-6xhis tag, 2.3 mg/mL in 20 mM Hepes (2-[4-(2-Hydroxyethyl)-1-piperazinyl]ethane sulfonic acid), 80 mM NaCl, 5 mM DTT (Dithiothreitol), pH 7.5) was labeled with terbium cryptate as follows. 200 μg of Menin was buffer exchanged into 1×Hepes buffer. 6.67 μM Menin was incubated with 8-fold molar excess NHS (N-hydroxysuccinimide)-terbium cryptate for 40 minutes at room temperature. Half of the labeled protein was purified away from free label by running the reaction over a NAP5 column with elution buffer (0.1M Hepes, pH 7+0.1% BSA (bovine serum albumin)). The other half was eluted with 0.1 M phosphate buffered saline (PBS), pH7. 400 μl of eluent was collected for each, aliquoted and frozen at −80° C. The final concentration of terbium-labeled Menin protein was 115 μg/mL in Hepes buffer and 85 μg/mL in PBS buffer, respectively.
TABLE-US-00076 MENIN Protein Sequence (SEQ ID NO: 1): MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAV NRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGA VDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGT KLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHG KGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLH TDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLT LYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQD YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQ GSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQ VRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPAL DKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPV LTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTL SFLKRQRKGLHHHHHH
2a) Proliferation Assay
[1567] The anti-proliferative effect of menin/MLL protein/protein interaction inhibitor test compounds was assessed in human leukemia cell lines. The cell line MOLM14 harbors a MLL translocation and expresses the MLL fusion protein MLL-AF9, respectively, as well as the wildtype protein from the second allele. OCI-AML3 cells that carry the NPM1c gene mutation were also tested. MLL rearranged cell lines (e.g. MOLM14) and NPM1c mutated cell lines exhibit stem cell-like HOXA/MEIS1 gene expression signatures. KO-52 was used as a control cell line containing two MLL (KMT2A) wildtype alleles in order to exclude compounds that display general cytotoxic effects.
[1568] MOLM14 cells were cultured in RPMI-1640 (Sigma Aldrich) supplemented with 10% heat-inactivated fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 μg/ml gentamycin (Gibco). KO-52 and OCI-AML3 cell lines were propagated in alpha-MEM (Sigma Aldrich) supplemented with 20% heat-inactivated fetal bovine serum (HyClone), 2 mM L-glutamine (Sigma Aldrich) and 50 μg/ml gentamycin (Gibco). Cells were kept at 0.3-2.5 million cells per ml during culturing and passage numbers did not exceed 20.
[1569] In order to assess the anti-proliferative effects, 200 MOLM14 cells, 200 OCI-AML3 cells or 300 KO-52 cells were seeded in 200 μl media per well in 96-well round bottom, ultra-low attachment plates (Costar, catalogue number 7007). Cell seeding numbers were chosen based on growth curves to ensure linear growth throughout the experiment. Test compounds were added at different concentrations and the DMSO content was normalized to 0.3%. Cells were incubated for 8 days at 37° C. and 5% CO.sub.2. Spheroid like growth was measured in real-time by live-cell imaging (IncuCyteZOOM, Essenbio, 4×objective) acquiring images at day 8. Confluence (%) as a measure of spheroid size was determined using an integrated analysis tool.
[1570] In order to determine the effect of the test compounds over time, the confluence in each well as a measure of spheroid size, was calculated. Confluence of the highest dose of a reference compound was used as baseline for the LC (Low control) and the confluence of DMSO treated cells was used as 0% cytotoxicity (High Control, HC).
[1571] Absolute IC.sub.50 values were calculated as percent change in confluence as follows:
[1572] LC=Low Control: cells treated with e.g. 1 μM of the cytotoxic agent staurosporin, or e.g. cells treated with a high concentration of an alternative reference compound
[1573] HC=High Control: Mean confluence (%) (DMSO treated cells)
% Effect=100−(100*(Sample−LC)/(HC−LC))
[1574] GraphPad Prism (version 7.00) was used to calculate the IC.sub.50. Dose-response equation was used for the plot of % Effect vs Log10 compound concentration with a variable slope and fixing the maximum to 100% and the minimum to 0%.
2b) MEIS1 mRNA Expression Assay
[1575] MEIS1 mRNA expression upon treatment of compound was examined by Quantigene Singleplex assay (Thermo Fisher Scientific). This technology allows for direct quantification of mRNA targets using probes hybridizing to defined target sequences of interest and the signal is detected using a Multimode plate reader Envision (PerkinElmer). The MOLM14 cell line was used for this experiment. Cells were plated in 96-well plates at 3,750 cells/well in the presence of increasing concentrations of compounds. After incubation of 48 hours with compounds, cells were lysed in lysis buffer and incubated for 45 minutes at 55° C. Cell lysates were mixed with human MEIS specific capture probe or human RPL28 (Ribosomal Protein L28) specific probe as a normalization control, as well as blocking probes. Cell lysates were then transferred to the custom assay hybridization plate (Thermo Fisher Scientific) and incubated for 18 to 22 hours at 55° C. Subsequently, plates were washed to remove unbound materials followed by sequential addition of preamplifiers, amplifiers, and label probe. Signals (═gene counts) were measured with a Multimode plate reader Envision. IC.sub.50S were calculated by dose-response modelling using appropriate software. For all non-housekeeper genes response equal counts corrected for background and relative expression. For each sample, each test gene signal (background subtracted) was divided by the normalization gene signal (RPL28: background subtracted). Fold changes were calculated by dividing the normalized values for the treated samples by the normalized values for the DMSO treated sample. Fold changes of each target gene were used for the calculation of IC.sub.50S.
TABLE-US-00077 TABLE 3 Biological data - HTRF assay, proliferation assay, and MEIS1 mRNA expressionassay spheroid HTRF-30 min MEIS1 spheroid assay_ assay_OCI- spheroid assay_KO- Compound incubation IC.sub.50 IC.sub.50 MOLM14 IC.sub.50 AML3 52 IC.sub.50 Number (μM) (μM) (μM) IC.sub.50 (μM) (μM) 1 0.000033 0.004 0.002 7.5 2 0.000049 0.003 0.001 >15 2a 0.000024 0.036 3 0.000026 0.010 0.004 1.1 4 0.000016 0.011 0.005 3.0 4a 0.000301 0.247 0.132 7.8 4b 0.000094 0.006 0.003 0.5 6 0.000288 0.049 0.034 1.5 7 0.000305 0.158 8 0.000365 0.023 0.011 2.4 8a 0.000024 0.013 8b ~0.0073 0.044 9 0.000138 0.023 0.013 5.6 9a 0.000016 0.006 0.002 0.6 9b 0.000975 0.042 10 0.000021 0.017 11 0.000034 0.006 12 0.000018 0.005 13 0.000124 0.006 14 0.000054 <0.0036 15 0.000040 <0.0008 16 0.000051 0.070 17 0.000031 0.048 18a 0.000019 0.005 18b 0.000017 0.110 19a 0.000032 <0.0033 0.003 >15 19b 0.000065 0.128 20 ~0.00019 <0.0017 21 0.000052 <0.0023 <0.0018 2.0 22 0.000024 ~0.011 23 0.000070 0.007 24 0.000057 0.071 0.013 8.5 25 0.000087 0.091 26a 0.000036 0.007 26b ~0.000036 0.029 27a 0.000012 <0.0041 27b 0.000038 0.019 27c 0.000038 0.040 27d 0.000013 0.080 28 0.000055 0.107 28b 0.000042 0.162 30 ~0.00049 >1 31 0.000052 ~0.47 32a 0.000062 0.022 0.005 5.5 32b 0.000472 >1 33a 0.000070 0.011 0.010 3.0 33b 0.000030 0.023 33c 0.000072 ~0.42 34a 0.000019 0.016 34b 0.000092 0.025 35a 0.000059 0.021 1.5 35b 0.000077 0.047 36a 0.000030 0.016 0.6 36b 0.000052 0.019 0.003 0.5 37a 0.000126 0.027 0.008 0.8 37b 0.000237 0.028 38a 0.000036 0.006 <0.0018 0.8 38b 0.000013 0.002 1.2 39a 0.000034 0.005 0.002 >15 39b 0.000052 0.035 40a 0.000841 ~0.54 40b 0.000182 ~0.68 41 0.000202 0.015 0.014 1.4 42 0.000030 0.045 0.031 2.8 43 0.000027 0.024 0.014 0.023 3.3 44 0.000060 0.043 0.071 4.7 45 0.000054 0.056 0.053 6.2 46 0.000047 0.092 47 0.000042 0.055 48 0.000060 0.020 49 0.000048 0.017 0.003 3.0 49a 0.000227 0.221 0.113 49b 0.000060 0.009 0.003 0.007 4.1 50 0.000079 0.089 0.039 2.3 51 0.000042 0.011 0.008 0.024 1.9 51a 0.000024 0.011 0.013 0.070 1.2 58 0.000135 0.183 0.176 10.4 59 0.000054 0.009 0.011 0.012 2.1 60 <0.0000095 0.007 0.013 0.013 2.7 61 0.000132 0.023 0.010 7.9 62 0.000085 0.014 63 0.000176 0.083 0.053 0.121 5.9 64 0.000284 ~0.039 65 0.000079 0.045 66 0.000037 0.046 0.018 7.7 67 ~0.000043 ~0.068 0.048 12.0 68 0.000043 0.032 69 0.000049 0.017 0.005 0.021 11.0 70 0.000114 0.048 0.040 0.068 8.5 71 0.000202 0.048 0.083 >15 72 0.000173 0.182 73 0.000057 0.101 74 0.000034 0.012 0.004 5.2 75 0.000059 0.119 0.009 2.0 76 0.000304 77 0.000191 0.136 0.090 5.8 77a 0.000105 0.206 0.117 77b 0.000070 0.132 0.081 0.128 1.9 77c 0.000546 0.669 77d 0.000208 ~0.26 0.197 >15 78 0.000299 0.327 0.111 8.4 78a 0.001217 ~0.69 78b 0.000552 0.361 78c 0.000382 0.416 0.200 78d 0.000875 0.538 79 0.000168 0.092 9.4 80 0.000116 0.099 7.2 81 0.000425 0.077 0.058 0.100 4.0 82 ~0.000035 0.011 83 0.001300 2.220 84 0.000075 0.131 0.063 0.120 4.3 85 0.000113 0.022 0.012 0.022 2.2 86 0.000042 0.021 0.010 0.023 1.3 87 0.000042 0.027 88 0.000093 0.140 0.096 89 0.000183 ~0.895 90a 0.000391 ~0.127 90b 0.000263 0.103 91 0.000155 0.094 92 0.000219 0.052 93 0.000418 ~0.360 94 0.000079 0.309 95 0.000601 ~0.914 96 0.004571 3.691 97 0.001971 1.607 98 0.000747 ~0.535 99 0.000217 ~0.792 100 0.000165 0.434 101 0.000041 0.007 0.041 0.008 3.1 102 0.003025 >1 103 0.003272 ~5.12 104 0.000147 0.254 0.275 >15 105 0.000728 >1 106 0.000039 0.104 107 0.000188 0.226 108 0.000161 0.153 109 0.000304 0.053 110 0.001802 ~1.07 111 0.000745 ~0.707 112 0.000555 0.345 113 0.000642 ~0.493 114 0.000173 0.487 115 0.000021 0.011 116a 0.000075 0.005 0.008 0.009 3.8 116b 0.000329 0.377 117a 0.000088 0.007 0.005 0.007 1.6 117b 0.000270 0.411 0.300 118 0.000139 0.117 119a 0.000906 >1 119b 0.000569 >1 120 0.000054 0.149 0.539 121 0.000049 0.013 122 0.000050 0.018 0.012 123 0.000052 0.031 0.016 124 0.000156 0.114 125 0.000027 0.016 0.011 0.012 7.0 126 0.000091 0.032 0.018 128 0.000078 0.238 0.146 7.9 128a 0.000151 0.258 0.676 7.7 128b 0.000045 0.065 0.040 128c 0.001006 ~0.4869 128d 0.000104 0.419 0.089 129 0.000291 0.277 130 0.001202 0.314 131 0.000132 0.129 132 0.001211 ~0.5733 133 0.000051 0.042 134a 0.000032 0.086 134b 0.000988 >1 134c 0.000073 0.119 134d 0.000425 >1 135 ~0.000056 0.007 136 ~0.000094 0.071 0.028 0.054 1.4 137a 0.000063 0.014 0.015 0.023 1.1 137b ~0.00034 0.043 138 0.000067 0.047 138a 0.000054 0.044 0.032 0.072 1.7 138b 0.000109 ~0.258 0.086 0.222 3.7 139 0.000119 0.444 139a 0.000122 ~0.81 139b 0.000087 0.716 140 ~0.00017 0.049 0.015 141 0.000027 0.015 142 0.000086 0.010 143 0.000064 0.005 144 0.000072 0.011 0.011 6.5 145 0.001056 ~0.7485 146 0.001220 >1 147a 0.000082 0.052 0.010 147b 0.000073 ~0.1048 148 0.000086 0.238 0.088 149 0.000037 0.023 150 0.000430 >1 1.474 151 0.003773 1.351 152 0.000053 0.197 153 0.000077 0.077 0.035 7.9 154 0.000140 0.244 0.091 155 0.000051 0.054 0.049 156 0.000042 0.187 0.042 157 0.000020 0.006 0.002 158 0.000045 0.024 0.006 159 0.000019 0.010 0.003 160 0.004021 >1 161 0.000167 0.256 0.053 162 0.000505 >1 0.424 163 0.000192 ~0.623 0.456 164a 0.000209 0.249 0.154 164b 0.000025 0.017 0.010 0.012 10.4 165a 0.000173 ~0.18 165b 0.000070 0.038 0.004 1.9 166a 0.000084 0.038 0.049 166b 0.000226 0.256 0.120 167a 0.000190 >1 0.210 167b 0.000118 0.117 0.099 168 0.000100 0.016 0.008 169 0.000061 0.071 0.016 10.0 169a 0.000061 0.015 0.017 169b 0.000195 ~0.22 0.087 170 0.000155 0.079 0.014 171 0.000581 >1 0.337 172 0.000134 0.018 0.011 173 0.000056 0.032 0.005 174 0.000048 0.034 0.007 175 0.001332 ~1.05 0.234 176 0.000200 0.306 0.046 177 0.000109 0.268 0.035 178 0.000055 0.014 0.012 2.9 179 0.000405 0.259 180a 0.000143 0.117 0.039 7.2 180b 0.007291 ~2.806 181a 0.000066 0.111 0.044 4.1 181b 0.004582 1.914 182a 0.000462 0.287 182b 0.003095 1.767 183a 0.000370 0.307 183b 0.002614 ~2.04 184 0.000060 0.026 7.4 184a 0.000041 0.023 0.013 0.026 >15 184b 0.000065 0.115 0.052 0.138 >15 185 0.000097 0.044 0.023 11.0 186a 0.000447 0.419 186b 0.000932 0.504 187 0.001016 1.937 189 0.000544 0.314 0.255 14.4 190a 0.000101 0.113 0.040 10.0 190b 0.000063 0.065 0.046 4.9 191a 0.000056 0.039 0.007 4.6 191b 0.000071 0.041 0.033 7.0 192 ~0.000268 ~0.403 193 0.000071 0.041 194 0.000072 0.066 195 0.000153 0.156 196 0.000190 0.438 197 0.000046 0.008 198a 0.000034 0.013 0.010 0.015 198b 0.000085 0.107 0.156 >15 199 0.000327 0.338 0.126 11.8 200 0.000909 ~0.864 0.679 >15 201 0.000063 0.047 0.031 0.035 202 0.000081 0.025 0.007 3.4 203 0.000069 0.043 0.012 2.9 204 0.000091 0.079 0.016 1.6 205 0.000106 0.019 0.019 2.5 205a 0.000049 0.021 0.023 7.0 205b 0.000035 0.031 0.025 3.2 206a 0.000045 0.024 0.013 6.6 206b 0.000387 ~0.524 0.148 >15 207 0.000016 0.029 0.016 14.3 208 0.000147 0.281 0.224 >15 209 0.000202 >1 0.458 12.8 210 0.000602 >1 211 0.000032 0.113 0.169 >15 212 0.000115 0.322 0.305 >15 213a 0.000567 1.149 213b 0.001629 ~2.30 214 >1 214a 0.001293 ~0.605 214b 0.011692 ~7.28 215 0.000291 0.299 216 0.000187 0.100 217 0.000039 0.021 218 0.000094 0.048 219 0.000039 0.032 220 0.000932 >1 221 0.000311 0.109 222 0.000103 0.259 223 0.000239 0.279 224 0.008656 ~3.88 224a 0.030697 >1 224b 0.002766 >1 225 0.000637 0.340 226 0.000255 0.269 227 0.000655 0.551 228 0.000061 0.008 0.010 0.011 5.8 229 0.000235 0.093 230a 0.000053 0.077 230b 0.005446 >1 231a 0.000311 0.052 231b 0.006942 >1 232a 0.000624 ~0.448 232b 0.004044 >1 233a 0.000171 0.247 233b 0.002238 >1 234 ~0.000068 0.018 235 0.000097 0.014 236 0.000086 ~0.0989 237 0.000149 0.052 238 0.001935 >1 239 0.000305 0.138 240a 0.000407 0.291 240b 0.000151 0.038 241 0.000084 0.173 242 0.000811 >1 243 0.000097 0.037 244 0.000101 0.051 245 0.000185 0.065 246 0.000057 0.016 247 0.000179 0.116 248 0.000255 0.011 249 0.000023 0.007 250 0.000076 0.030 251 0.000066 0.083 252a 0.000341 0.069 252b 0.000250 0.315 253a 0.001474 ~0.540 253b 0.001726 >1 254 0.000071 0.019 255 0.000102 0.010 256 0.000073 0.020 257 0.000031 0.007 258 0.000021 0.011 259 0.000031 0.138 260 0.000042 ~0.0276 261 0.000213 0.217 262 0.000018 0.015 0.015 2.9 263 0.000258 0.175 264 0.000034 0.025 0.020 13.5 265 0.000097 0.046 266 0.000349 0.431 267 0.00024 0.166 268 0.000149 0.037 0.088 >15 269 0.001699 0.018 270 0.000311 0.177 271 0.000368 0.288 272 0.000310 ~0.27 273 0.001080 >1 274 0.002422 >1 275 0.000945 >1 276 0.000532 ~0.462 277 0.000481 ~0.502 278 0.000323 0.342 279 0.000025 0.017 0.012 5.1 280 0.000077 0.051 281 0.000058 0.013 0.010 4.2 282 0.003272 >1 283 0.000610 0.440 284 0.004185 ~2.36 285 0.001485 ~1.33 286 0.000046 0.059 287 0.000034 0.026 288 0.000059 0.043 289 0.000055 0.031 290 0.000393 0.170 291 0.000594 0.468 292a 0.000132 292b 0.000562 ~0.586 293a 0.000459 0.148 293b 0.000152 0.259 294a 0.000237 0.365 294b 0.000077 0.153 295 0.000171 0.338 296 0.000339 0.549 297 0.000477 >1 298 0.000083 0.178 299 0.000151 ~0.281 300 0.000116 0.055 301 0.000191 0.144 302 0.000050 0.078 303 0.000179 ~0.077 304 0.002803 >1 305 0.000146 ~0.297 306 0.000468 0.159 307 0.000044 0.048 308 0.060201 >1 309a 0.001300 309b 0.000111 >1 310 0.000119 0.351 311 0.000031 0.018 0.017 5.2 311a 0.000037 0.014 0.018 7.7 311b 0.000077 0.026 0.035 >15 312 0.000058 0.055 0.033 >15 313 0.000155 0.552 0.179 313a 0.000111 ~0.299 313b 0.000713 ~0.713 314 0.000055 0.019 0.006 315 0.000071 0.037 0.010 2.4 316 0.000055 0.029 0.012 8.9 317 0.000291 0.065 318 0.000220 1.377 319 0.000293 0.240 0.139 >15 320 0.000078 0.023 0.019 6.9 320a 0.000189 0.024 320b 0.000104 0.062 321 0.000257 0.413 0.232 322 0.000152 ~0.547 0.323 323 0.000080 ~0.146 0.142 324 0.000267 0.642 0.553 325 0.000337 1.336 1.049 326 0.000038 0.023 0.016 327 0.000819 ~0.616 328 0.000101 ~0.154 0.050 0.052 329 0.000152 0.013 330 0.000130 0.010 331 0.000117 0.029 332 0.000130 0.196 333 0.000251 ~0.394 334 0.000224 0.012 335 0.000193 0.018 336 0.000128 0.033 337 0.000092 0.024 338 0.000185 0.037 339 0.000193 0.068 340 0.000034 >1 341 0.000037 0.020 342 0.000188 0.107 343 0.000045 0.013 344 ~0.000058 0.014 345 0.000204 0.036 346 0.000116 0.011 347 0.000045 0.144 348 0.000059 0.033 349 0.006685 >1 350 0.000583 ~1.00 351a 0.000040 0.012 351b 0.000255 0.182 352a 0.000102 0.013 0.007 0.011 >15 352b 0.000247 0.266 0.140 0.263 >15 353a 0.000094 0.012 0.006 0.011 >15 353b 0.000238 0.139 0.236 354 0.000040 0.018 357 0.000035 0.015 0.008 3.0 358 0.000223 0.386 359 0.000166 0.358 0.079 360 0.000127 0.107 361 0.000149 362a 0.000149 0.184 362b 0.000067 0.019 0.012 363a 0.000228 0.359 363b 0.000093 ~0.1745 364a 0.000098 0.225 364b 0.000292 ~0.6699 365a 0.000102 0.035 365b 0.000081 0.011 0.008 0.011 366 0.000067 ~0.3194 367 0.000201 >1 503 0.010457 504 0.023939 >1 505 0.003110 507 0.006605 508 0.003680 509 0.004525 510 0.002946 522 0.010590 523a 0.000376 >1 523b 0.000124 0.062 524b 0.008624 2.120 524a 0.019002 2.557 528 0.000514 533 0.000808 534 0.000556