Stemness-suppressing composition comprising OCT4 function-inhibiting peptide
11717556 · 2023-08-08
Assignee
Inventors
- Hyonchol JANG (Seoul, KR)
- Byung Il LEE (Goyang-si, KR)
- Hong-Duk Youn (Suwon-si, KR)
- Bomin Song (Goyang-si, KR)
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61K45/00
HUMAN NECESSITIES
A61K35/28
HUMAN NECESSITIES
G01N2500/02
PHYSICS
International classification
A61K38/16
HUMAN NECESSITIES
A61K35/28
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention relates to a stemness-suppressing composition comprising an OCT4 function-inhibiting peptide and, more particularly, to a composition comprising a peptide as an effective ingredient for suppressing the stemness of various stem cells such as general stem cells, cancer stem cells, and the like, wherein the peptide inhibits the function of OCT4 by inducing the phosphorylation of OCT4. OCT4 function-inhibiting peptides of the present invention are expected to find applications in various fields through the suppressive activity thereof against stemness of stem cells.
Claims
1. A method of treating cancer, the method comprising: administering to an individual in need thereof an effective amount of a peptide consisting of one amino acid sequence selected from the group consisting of SEQ ID NOS: 5, 7, 9, 11, and 13.
2. The method of claim 1, wherein the peptide suppresses the binding between octamer-binding transcription factor 4 (OCT4) and protein phosphatase 1 (PP1).
3. The method of claim 1, further comprising administering an anticancer agent.
4. The method of claim 1, wherein the method suppresses the proliferation of cancer, survival of cancer, metastasis of cancer, recurrence of cancer, or resistance of cancer to anticancer agents.
5. The method of claim 1, wherein the peptide is linked to a cell permeable peptide.
6. The method of claim 1, wherein the peptide is encoded by a polynucleotide comprising one base sequence selected from the group consisting of SEQ ID NOS: 4, 6, 8, 10, and 12.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
MODES OF THE INVENTION
(23) The main cause of cancer death is cancer metastasis and treatment resistance, and the fact that the fundamental cause thereof is cancer cells having stemness has been rigorously proved recently. Therefore, it is expected that deaths caused by cancer can be substantially reduced through anti-cancer strategies which reduce the stemness of cancer cells.
(24) The pathways by which cancer cells acquire stemness may be broadly summarized into two, one is the case where normal stem cells are transformed into cancer cells, and the other is the case where cancer cells acquire stemness through dedifferentiation. In patients with cancer, particularly, the key factors of embryonic stem cells play an important role in maintaining the stemness of cancer cells, and it was reported that the more malignant the cancer becomes, the more the expression of the embryonic stem cell-related gene group is increased rather than normal tissue stem cell-related genes. Three transcription factors, Oct4, Sox2, and Nanog, are central in a network that maintains the stemness of embryonic stem cells, and among them, OCT4 (gene Pou5f1) is known to play an important role in maintaining the stemness of cancer.
(25) In the present invention, it was revealed that protein phosphatase 1 (PP1) induces the dephosphorylation of serine 236 (corresponding to serine 229 in a mouse) of human octamer-binding transcription factor 4 (OCT4) in human cells, and a peptide sequence inhibiting the functions of OCT4 and PP1 was identified. PP1 is a phosphatase having various substrates, and generally, PP1 inhibition also affects the functions of many proteins other than OCT4 to possibly cause various side effects, but the peptide of the present invention decreases stemness by specifically inhibiting the binding of PP1 and OCT4. It is expected that the peptide of the present invention may be used for reducing cancer and normal stemness by inducing the phosphorylation of OCT4, and particularly, suppressing the recurrence of cancer in a patient receiving anticancer treatment.
(26) The OCT4 function-inhibiting peptide of the present invention inhibits the function of OCT4 by inhibiting the binding of OCT4 and PP1 to maintain the phosphorylation of serine 236 of human OCT4, thereby exhibiting the same level of effect as 100% deficiency of OCT4. For this reason, normal stem cells lose their stemness and differentiate, and cancer cells lose their stemness, thereby making long-term survival impossible and preventing recurrence after anticancer treatment. This is because the phosphorylation of serine 236 of OCT4 is maintained by a peptide which specifically inhibits the binding of OCT4 and a protein phosphatase PP1, and thus OCT4 fails to bind to DNA, resulting in a loss of transcriptional activity.
(27) As used herein, the “stem cell” refers to a general concept of undifferentiated cells having the ability to differentiate into various types of tissue cells, that is, undifferentiated cells having stemness. These stem cells are roughly divided into embryonic stem cells which may be produced using embryos, adult stem cells, germ cells (gametes), cancer stem cells, and the like, the embryonic stem cells refer to a stage of a cell mass before foiling a specific organ and after fertilization, and recently, embryonic stem cells are also produced from normal cells through dedifferentiation. Therefore, the stem cells are not limited thereto as long as the stem cells are cells capable of differentiating into all cells and tissues constituting the body. Adult stem cells are extracted from umbilical cord blood, bone marrow, blood and the like, and refer to primitive cells just before differentiation into cells of specific organs such as bone, liver and blood. Germ cells are cells that transmit genetic information to the next generation through reproduction, and although human beings have sperm and ova, germ cells are not limited thereto. Cancer stem cells refers to cancer cells in a comprehensive sense, which have self-renewal or differentiation capabilities which are a unique ability of stem cells. Cancer stem cells generally may have resistance to anticancer agents by proliferating at a slow rate different from that of general cancer cells under normal tumor growth conditions (referring to a state where there is no cellular stress because the nutrients (glucose) necessary for cell growth are sufficient and the growth condition of the tumor microenviroment is abundant) or maintaining a dormant state, and for example, the expression of transcriptional regulatory factors such as PGC-la may be controlled unlike normal tumor cells, so that the functions of major metabolic regulators may differ from those of general cancer cells. Cancer stem cells comprehensively refer to cells with the ability to invade and metastasize, which have acquired resistance to cell apoptosis in a nutrient-deficient state through the regulation of a cell signal transduction system, which is mechanically linked with the different metabolic regulation abilities. However, cancer stem cells are not limited thereto as long as cancer stem cells are cells capable of differentiating into general cancer cells.
(28) As used herein, the “prevention” refers to all actions that suppress a disease such as cancer or delay the onset of the disease by administering the composition according to the present invention.
(29) As used herein, the “treatment” refers to all actions in which symptoms of a disease such as cancer are ameliorated or beneficially altered by administering the composition according to the present invention.
(30) As used herein, the “individual” refers to a subject to which the composition of the present invention may be administered, and the subject is not limited.
(31) In the present invention, the pharmaceutical composition may be in the form of a capsule, a tablet, a granule, an injection, an ointment, a powder, or a beverage, and the pharmaceutical composition may be characterized in that it is intended for humans. However, the pharmaceutical composition is not limited thereto and may be formulated into the form of an oral dosage form such as powder, granules, a capsule, a tablet, and an aqueous suspension, an external preparation, a suppository, and a sterile injectable solution. The pharmaceutical composition of the present invention may include a pharmaceutically acceptable carrier. As the pharmaceutically acceptable carrier, a binder, a lubricant, a disintegrant, an excipient, a solubilizing agent, a dispersing agent, a stabilizer, a suspending agent, a colorant, a flavoring agent, and the like may be used when orally administered, in the case of injection, a buffering agent, a preservative, an analgesic, a solubilizer, an isotonic agent, a stabilizer, and the like may be mixed and used, and in the case of topical administration, a base, an excipient, lubricant, a preservative, and the like may be used. The formulation of the pharmaceutical composition of the present invention may be variously prepared by mixing the pharmaceutical composition of the present invention with the pharmaceutically acceptable carrier as described above. For example, the formulation may be prepared in the form of a tablet, a troche, a capsule, an elixir, a suspension, a syrup, a wafer, and the like when orally administered, and in the case of an injection, the injection may be formulated into unit dosage ampoules or in multiple dosage forms. The pharmaceutical composition of the present invention may be formulated into other solutions, suspensions, tablets, capsules, sustained-release preparations, and the like.
(32) Meanwhile, as an example of suitable carriers, excipients and diluents for formulation, it is possible to use lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methylcellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, mineral oil, or the like. Further, the pharmaceutical composition of the present invention may further include a filler, an anticoagulant, a lubricant, a wetting agent, a flavoring agent, an emulsifying agent, an antiseptic, and the like.
(33) The route of administration of the pharmaceutical composition according to the present invention includes, but is not limited to, oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual or rectal. Oral or parenteral administration is preferred. As used herein, the term “parenteral” includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques. The pharmaceutical composition of the present invention may also be administered in the form of a suppository for rectal administration.
(34) The pharmaceutical composition of the present invention varies depending on various factors including the activity of the specific compound used, age, body weight, general health, sex, diet, time of administration, route of administration, rate of excretion, drug combination and the severity of the particular disease to be prevented or treated, and the dosage of the pharmaceutical composition varies depending on the condition of the patient, the body weight, the degree of disease, the form of drug, the route of administration and duration, but may be appropriately selected by a person skilled in the art, and may be 0.0001 to 50 mg/kg or 0.001 to 50 mg/kg daily. The administration may be carried out once daily, and may be divided into several times. The dosage is not intended to limit the scope of the present invention in any way. The pharmaceutical composition according to the present invention may be formulated into pills, dragees, capsules, solutions, gels, syrups, slurries, and suspensions.
(35) Hereinafter, the following Examples are suggested to aid in understanding the present invention. However, the following Examples are provided only to more easily understand the present invention, and the contents of the present invention are not limited by the following Examples.
EXAMPLES
Example 1: Confirmation of Link Between OCT4 Phosphorylation and Stemness
(36) 1.1. Construction of Cell Line Expressing Exogenous OCT4
(37) In order to confirm the link between the phosphorylation of an octamer-binding transcription factor 4 (OCT4) protein and stemness, first, a cell line expressing OCT4 substituted with 236D as an OCT4 S236 phosphorylation mimetic mutant was constructed. For construction of cells, a lentivirus expressing short hairpin RNA (hRNA, SEQ ID NO: 1) and a puromycin resistance gene in a doxycycline-dependent manner was constructed, and primarily, NCCIT(ATCC® CRL-2073™) and NTERA-2 (ATCC® CRL-1973™), which are cancer stem cell lines, were transfected with the lentivirus. Then, a plasmid recombinant for expressing OCT4 wild type and blasticidine resistance genes, or OCT4 substituted with 236D which is a phosphorylation mimetic of OCT4 and blasticidine resistance genes in a pCAG-Flag-B/S vector was secondarily transfected into the transfected cell line using Lipofectamine 3000 (Thermo Fisher). Then, the cell line which was normally transfected and secondarily transfected was isolated by treating the medium with puromycin and blasticidine, and a cell line having the inhibited expression of endogenous OCT4 and substituted with an exogenous OCT4 protein was constructed by treating the isolated cell line with doxycycline. The constructed cell line was confirmed by western blotting. The cell line treated with doxycyline and cultured for 4 days to 8 days was washed using phosphate buffered saline (PBS), and after cells were lysed using a lysis buffer (20 mM Tris-Cl(pH 7.4), 150 mM NaCl, 1 mM EDTA, 1% (v/v) Triton X-100 and protease inhibitors), the cell lysis was confirmed by SDS-PAGE and western blotting using an OCT4 antibody (SantaCruz) and an Flag antibody (Cell Signaling). As a control, an ACTB antibody (Abcam) was used. The results are illustrated in
(38) As illustrated in
(39) Further, it was confirmed whether the exogenous OCT4 protein was expressed using immunofluorescence staining. For confirmation, after the cell line treated with doxycycline and cultured for 4 days to 8 days was washed using phosphate buffered saline, cells were fixed using a 4% formaldehyde solution, and then again treated with phosphate buffered saline, and treated with 0.5% Triton X-100 to enhance the permeability of the cell membrane. Then, the cells were blocked using a 1% bovine serum albumin (BSA) solution and treated with an OCT4 antibody to allow reaction at room temperature for 2 hours. Then, after the unbound antibody was removed with phosphate buffered saline, the cells were treated with a fluorescence-bound secondary antibody (Thermo Fisher Scientific) and reacted at room temperature for 1 hour, the unbound antibody was removed using phosphate buffered saline, and the nuclei were stained using 4′,6-diamidino-2-phenylindole (DAPI, Calbiochem). Then, after a mounting solution was added onto the cells, it was confirmed whether a protein was expressed using a confocal microscope. The results are illustrated in
(40) As illustrated in
(41) 1.2. Confirmation of Link Between OCT4 Phosphorylation and Stemness
(42) In order to confirm the link between the OCT4 protein and stemness, after the cell line expressing the exogenous OCT4 constructed by the method in Example 1.1 was separated into single cells through trypsin treatment, 1,000 cells per well were aliquoted into 6-well plates and cultured under conditions of 37° C. and 5% CO.sub.2 for a week or more, and then staining was performed using an alkaline phosphatase assay kit (Medsource Ozone Biomedicals) and observed using a microscope. The results are illustrated in
(43) As illustrated in
(44) In addition, it was confirmed whether tumorspheres were formed. In order to form tumorspheres, 10,000 cells per well were aliquoted into 96-well Ultra Low Attachment plates (Corning) using a DMEM/F12 (Hyclone) medium supplemented with 1 mL of B27 (Invitrogen), 20 ng/mL epidermal growth factor (EGF, Sigma), 20 ng/ml basic fibroblast growth factor-2 (bFGF2, Sigma), and 4 ug/ml heparin (Sigma), and cultured under conditions of 37° C. and 5% CO.sub.2 for two days, and then the same amount of medium was added thereto. Then, after 3 days, the cells were subcultured at a ratio of 1/10, and then cultured again for 7 days, the whole image of the 96-well was photographed by Cytation3 (BioTek), and spheroids having a diameter of 10 μm or more were counted. The results are illustrated in
(45) As illustrated in
(46) Further, after the total RNA from cells obtained by treating NCCIT cells expressing the exogenous OCT4 produced by the method in Example 1.1 with doxycycline and culturing the treated NCCIT cells and cells obtained by culturing the NCCIT cells without treatment was purified using an RNeasy purification kit (Qiagen), whole RNA-Seq was performed by commissioning Macrogen. The results are illustrated in
(47) As illustrated in
(48) Through the results, it could be confirmed that OCT4 plays an important role in maintaining stemness, and particularly when the phosphorylation of S236 was mimicked by substituting amino acid 236 of OCT4 with D, stemness was remarkably inhibited, and through this, the OCT4 S236 phosphorylation plays an important role in stemness.
Example 2: Confirmation of Link Between OCT4 Phosphorylation and Tumor Growth in Animal Model
(49) 2.1. Confirmation of Link Between OCT4 Phosphorylation and Tumor Growth
(50) 1×10.sup.7 NTERA2 cells expressing the exogenous OCT4 constructed by the method in Example 1.1 were xenografted into BALB/c-nu mice, the mice were divided into two groups when the tumor size became about 50 to 100 mm.sup.3, and the results of measuring the tumor size while administering doxycycline to one group and not administering doxycycline to the other group at 2- to 3-day intervals for 5 weeks are illustrated in
(51) As illustrated in
(52) Further, after about 5 weeks, the tumor was detached from the mice, the tumor weight was measured and shown in a graph, and actual tumor images are illustrated in
(53) As illustrated in
(54) 2.2. Confirmation of Link Between OCT4 Phosphorylation and Differentiation of Tumor Tissues
(55) After the tumor detached in Example 2.1 was fixed in formalin, paraffin blocks were prepared, and the results of staining with a growth marker Ki67 antibody using immunohistochemical staining are illustrated in
(56) As illustrated in
(57) Further, the morphologies of the tumor tissue were enlarged and are illustrated in
(58) As illustrated in
Example 3: Confirmation of Link Between PP1 and OCT4 Phosphorylation
(59) 3.1. Confirmation of Link Between PP1 and OCT4 Phosphorylation
(60) In order to confirm the link between protein phosphatase 1 (PP1) and OCT4, NCCIT and NTERA-2 cell lines were treated with okadaic acid known as an inhibitor of PP1, and western blotting and immunofluorescence staining were performed in the same manner as in Example 1.1. As the OCT4 S236 phosphorylation antibody, an antibody constructed by commissioning GenScript was used (ref. eLIFE2016). The results are illustrated in
(61) As illustrated in
(62) 3.2. Construction of Cell Line for Regulating Inhibition of PP1 Expression
(63) In addition, in order to construct a cell line for regulating the inhibition of PP1 expression, a cell line capable of regulating the expression of PP1 through doxycycline was constructed by constructing a lentivirus expressing shRNA of SEQ ID NO: 2 or 3 in a doxycycline-dependent manner and transfecting an NCCIT cell line with the lentivirus. Then, western blotting and immunofluorescence staining were performed in the same manner as in Example 2.1. The results are illustrated in
(64) As illustrated in
(65) 3.3. Confirmation of Effects of Increase in OCT4 Phosphorylation Caused by PP1 Inhibition on Stemness
(66) In order to confirm effects of an increase in OCT4 phosphorylation caused by PP1 inhibition on stemness, alkaline phosphatase staining was performed and it was confirmed whether tumorspheres were formed in the same manner as in Example 1.2. The results are illustrated in
(67) As illustrated in
(68) Through the result, it could be confirmed that when PP1 was suppressed, the phosphorylation of OCT4 was increased, thereby inhibiting stemness.
Example 4: Structural Analysis of OCT4
(69) 4.1. Prediction of Human OCT4 Structure
(70) In order to predict the structure of human octamer-binding transcription factor 4 (OCT4), the structure of a site predicted to be involved in binding to PP1 was predicted using a mouse OCT4 X-ray crystal structure (PDBID:3L1P), whose partial structure is currently known, as a control. The results are illustrated in
(71) As illustrated in
Example 5: Construction of Peptide for Inhibiting Function of OCT4
(72) Through the structural analysis of Example 4, base sequences of Helix 1-3 of SEQ ID NO: 4, Helix-1 of SEQ ID NO: 6, Helix-2 of SEQ ID NO: 8, and Helix-3 of SEQ ID NO: 10 were constructed in order to construct a peptide for inhibiting the function of OCT4 that is capable of inhibiting the function of OCT4 by reducing the binding between OCT4 and PP1. Then, a recombinant vector was constructed by inserting the constructed base sequences into a pCAG-F-puro vector (Addgene), respectively.
Example 6: Confirmation of Activity of Peptide for Inhibiting Function of OCT4
(73) 6.1. Confirmation of Stemness Inhibition Activity of Peptide for Inhibiting Function of OCT4
(74) After an NCCIT cell line was transformed by inserting the vector constructed by the method in Example 5 into the NCCIT cell line using Lipofectamine 3000, and then cultured for 36 hours to 48 hours, western blotting was performed in the same manner as in Example 2.1. The quantification of western blotting was analyzed using ImageJ. The results are illustrated in
(75) As illustrated in
(76) Furthermore, after NCCIT and NTERA-2 cell lines were transformed by inserting the vector constructed by the method in Example 5 into the NCCIT and NTERA-2 cell lines using Lipofectamine 3000, and then cultured for 36 hours to 48 hours, immunofluorescence staining was performed in the same manner as in Example 2.1, and the results are illustrated in
(77) In order to confirm whether stemness is reduced by an OCT4-PP1 binding inhibitory peptide, mouse embryonic stem cells (mESCs), NCCIT, and NTERA-2 cell lines were each transformed by the vector constructed by the method in Example 5 using Lipofectamine 3000, and then cultured for 2 days, treated with puromycin, and further cultured for 2 days to isolate only transformed cell lines into which a vector was inserted. Then, an alkaline phosphatase analysis was performed in the same manner as in Example 1.2 and a clonogenic assay of cancer cells was performed. The results are illustrated in
(78) As illustrated in
(79) Peptides in which FITC was bound to Helix-1, Helix-2, and Helix-3 in Example 4 were synthesized.
(80) The peptides were uniformly aliquoted at a final concentration of 20 nM into a fluorescence polarization reaction buffer solution (10 mM HEPES pH7.5, 50 mM NaCl, 1 mM DTT, 1 mM EDTA, and 0.0025% Tween 20), a purified PP1 protein was added thereto, and then the resulting mixture was reacted for 30 minutes, and the results of measuring fluorescence polarization using TECAN Infinite F200 Pro are illustrated in
(81) As illustrated in
(82) The binding powers of Helix 3-1 (SEQ ID NO: 14), Helix 3-2 (SEQ ID NO: 15), Helix 3-3 (SEQ ID NO: 13), and Helix 3 were compared by narrowing the sequence involved in binding to PP1 in the Helix-3 sequence (SEQ ID NO: 11) consisting of 19 amino acids. As a result, finally, the results of showing that Helix 3-3 (SEQ ID NO: 13) consisting of 12 amino acids has the same binding power as that of Helix-3 are illustrated in
(83) Further, a cell permeable peptide (11R-GGG-VVRVWFCNRRQK: SEQ ID NO: 19) to which the sequence of Helix-3-3 was linked was constructed, and cells were treated with the cell permeable peptide for 2 days or more by adding the peptide at a concentration of 10 uM to a cell culture solution. The results of confirming an increase in phosphorylation of OCT4 after treatment by immunofluorescence staining are illustrated in
(84) In addition, an alkaline phosphatase analysis was performed in the same manner as in Example 1.2 and a clonogenic assay of cancer cells was performed. The results are illustrated in
(85) As illustrated in
(86) Through the results, it could be confirmed not only that the peptides for inhibiting the function of OCT4 of the present invention effectively suppressed the binding between OCT4 and PP1 to maintain the phosphorylation of serine 236 of human OCT4, prevented OCT4 from binding to DNA so that transcriptional activity was lost by inhibiting the function of OCT4, and could be effectively used in the suppression of cancer proliferation, suppression of cancer metastasis, suppression of cancer recurrence, suppression of occurrence of resistance of cancer to anticancer agents, and the like by finally reducing the stemness of cancer stem cells, but also that the peptides for inhibiting the function of OCT4 of the present invention can shorten the time and can enhance efficiency in the differentiation of embryonic stem cells into specific cells because it is possible to reduce stemness even in general stem cells, and the peptides for inhibiting the function of OCT4 of the present invention can find application in various fields by suppressing the stemness of stem cells because it is possible to effectively suppress side effects of oncogenesis caused by the remaining undifferentiated embryonic stem cells after cell therapy using embryonic stem cells.
(87) The above-described description of the present invention is provided for illustrative purposes, and those skilled in the art to which the present invention pertains will understand that the present invention can be easily modified into other specific forms without changing the technical spirit or essential features of the present invention. Therefore, it should be understood that the above-described embodiments are only exemplary in all aspects and are not restrictive.
INDUSTRIAL APPLICABILITY
(88) Since the peptides for suppressing the function of OCT4 according to the present invention can effectively reduce the stemness of various stem cells, the peptides can be effectively used for suppressing the proliferation of cancer, the recurrence of cancer, the metastasis of cancer, the occurrence of resistance of cancer to anticancer agents, and the like, and can also reduce the stemness of general stem cells, so that it is possible to shorten the time and enhance efficiency in the differentiation of embryonic stem cells into specific cells. Further, in cell therapy using embryonic stem cells, when the composition of the present invention is used, it is possible to completely remove undifferentiated embryonic stem cells remaining after treatment, and accordingly, it is possible to effectively suppress side effects of the occurrence of cancer, so that the stability of cell therapy using embryonic stem cells can be remarkably enhanced. Therefore, the value thereof is excellent in terms of industrial availability.
(89) TABLE-US-00001 [Sequence Listing Free Text] SEQ ID NO: 1: shRNA of OCT4 5′-TCATTCACTAAGGAAGGAATT-3′ SEQ ID NO: 2: shRNA #1 of PP1 5′-GCGAATTATGCGACCAACTGA-3′ SEQ ID NO: 3: shRNA #2 of PP1 5′-ACATTTGGTGCAGAAGTGGTTCT-3′ SEQ ID NO: 4: DNA sequence of Helix 1-3 AACCGAGTGAGAGGCAACCTGGAGAATTTGTTCCTGCAGTGCCCG AAACCCACACTGCAGCAGATCAGCCACATCGCCCAGCAGCTTGGGCTCGA GAAGGATGTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAG CGATCA SEQ ID NO: 5: Amino acid sequence of Helix 1-3 NRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKG KRS SEQ ID NO: 6: DNA sequence of Helix 1 AACCGAGTGAGAGGCAACCTGGAGAATTTG SEQ ID NO: 7: Amino acid sequence of Helix 1 NRVRGNLENL SEQ ID NO: 8: DNA sequence of Helix 2 CTGCAGCAGATCAGCCACATCGCCCAGCAGCTTGGG SEQ ID NO: 9: Amino acid sequence of Helix 2 LQQISHIAQQLG SEQ ID NO: 10: DNA sequence of Helix 3 AAGGATGTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGC AAGCGATCA SEQ ID NO: 11: Amino acid sequence of Helix 3 KDVVRVWFCNRRQKGKRSS SEQ ID NO: 12: DNA sequence of Helix 3-3 GTGGTCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAG SEQ ID NO: 13: Amino acid sequence of Helix 3-3 VVRVWFCNRRQK SEQ ID NO: 14: Amino acid sequence of Helix 3-1 KDVVRVWFCN SEQ ID NO: 15: Amino acid sequence of Helix 3-2 CNRRQKGKRSS
(90) TABLE-US-00002 SEQ ID NO: 16: Amino acid sequence of Mouse OCT4 IENRVRWSLE TMFLKCPKPS LQQITHIANQ LGLEKDVVRV WFCNRRQKGK RSSIE SEQ ID NO: 17: Ammo acid sequence of Human OCT4 IENRVRGNLE NLFLQCPKPT LQQISHIAQQ LGLEKDVVRV WFCNRRQKGK RSSSD SEQ ID NO: 18: Amino acid sequence of Cell penetrating peptide CPP Scramble. RRRRRRRRRR RGGGDRQLQL STLQRML SEQ ID NO: 19: Amino acid sequence of Cell penetrating peptide CPP H3-3 RRRRRRRRRR RGGGVVRVWF CNRRQK