ANTHRACYCLINE DERIVATIVES
20230241072 · 2023-08-03
Inventors
Cpc classification
A61K47/6889
HUMAN NECESSITIES
C07K2317/569
CHEMISTRY; METALLURGY
A61K47/10
HUMAN NECESSITIES
A61K47/6851
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/64
CHEMISTRY; METALLURGY
A61K31/5377
HUMAN NECESSITIES
A61K47/6809
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
A61K47/6855
HUMAN NECESSITIES
International classification
A61K31/5377
HUMAN NECESSITIES
A61K47/68
HUMAN NECESSITIES
A61K47/10
HUMAN NECESSITIES
Abstract
The present application relates to anthracycline derivatives and their use in forming conjugates with target-binding molecules, including but not limited to antibodies. Conjugates of target-binding molecules and anthracycline derivatives are also provided. Also provided are medical uses of and pharmaceutical compositions comprising the conjugates.
Claims
1. An anthracycline (PNU) derivative of formula (I): ##STR00019## wherein [X] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof; [L1] and [L2] are optional linkers selected from the group consisting of valine (Val), citrulline (Cit), alanine (Ala), asparagine (Asn), a peptide, —(CH.sub.2).sub.n—, —(CH.sub.2CH.sub.2O).sub.n—, p-aminobenzyloxycarbonyl (PAB), Val-Cit-PAB, Val-Ala-PAB, Ala-Ala-Asn-PAB, any amino acid except glycine, and combinations thereof, wherein the anthracycline (PNU) derivative of formula (I) comprises [L1], [L2] or [L1] and [L2].
2. (canceled)
3. The anthracycline derivative of claim 1, wherein [X] is selected from the group comprising polyethylene glycol, ##STR00020## wherein represents the point of attachment to the rest of the molecule and wherein [R] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof.
4. The anthracycline derivative of claim 1, wherein [X] is polyethylene glycol.
5. The anthracycline derivative of claim 1, wherein [L2] is p-aminobenzyloxycarbonyl (PAB) or alanine.
6. The anthracycline derivative of claim 1, wherein the PNU derivative has a structure selected from: ##STR00021##
7. An anthracycline (PNU) derivative of formula (IV): ##STR00022## wherein [X] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof; and wherein [Z] is a reactive group suitable for use in a conjugation reaction.
8. The anthracycline derivative of claim 7, wherein [Z] is selected from the group consisting of a maleimide, an alkyl halide, a sulphydryl group, an activated disulphide, an amino group, an alkyne group, an azido group, an aminoxy group, an aldehyde group and a ketone group.
9. The anthracycline derivative of claim 7, wherein [Z] is selected from the group consisting of polyGly and a primary amine.
10. The anthracycline derivative of claim 7, wherein [X] is selected from the group comprising polyethylene glycol, ##STR00023## wherein represents the point of attachment to the rest of the molecule and wherein [R] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof.
11. The anthracycline derivative of claim 7, wherein [X] is polyethylene glycol.
12. A target-binding molecule-drug conjugate, comprising a specific antigen binding protein and an anthracycline (PNU) derivative, wherein the target-binding molecule-drug conjugate has the structure of formula (II): ##STR00024## wherein [X] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof; [L1] and [L2] are optional linkers selected from the group consisting of valine (Val), citrulline (Cit), alanine (Ala), asparagine (Asn), a peptide, —(CH.sub.2).sub.n—, —(CH.sub.2CH.sub.2O).sub.n—, p-aminobenzyloxycarbonyl (PAB), Val-Cit-PAB, Val-Ala-PAB, Ala-Ala-Asn-PAB, any amino acid except glycine, and combinations thereof; and Y is a target-binding molecule, wherein the target-binding molecule-drug conjugate of formula (II) comprises [L1], [L2] or [L1] and [L2].
13. (canceled)
14. The target-binding molecule-drug conjugate of claim 12, wherein [X] is selected from the group comprising polyethylene glycol, ##STR00025## wherein represents the point of attachment to the rest of the molecule and wherein [R] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof.
15. The target-binding molecule-drug conjugate of claim 12, wherein [X] is polyethylene glycol.
16. The target-binding molecule-drug conjugate of claim 12, wherein [L2] is p-aminobenzyloxycarbonyl (PAB) or alanine.
17. The target-binding molecule-drug conjugate of claim 12, wherein the PNU derivative has a structure selected from: ##STR00026##
18. A target-binding molecule-drug conjugate, comprising a specific antigen binding protein and an anthracycline (PNU) derivative, wherein the target-binding molecule-drug conjugate has the structure of formula (V): ##STR00027## wherein [X] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof; [Z] is a linker derived from a reactive group used to conjugate the anthracycline (PNU) derivative and the target-binding molecule; and Y is a target binding molecule.
19. The anthracycline derivative of claim 18, wherein [Z] is selected from the group consisting of a disulphide bond, an amide bond, an oxime bond, a hydrazone bond, a thioether bond, a 1, 2,3 triazole and polyGly.
20. The target-binding molecule-drug conjugate of claim 18, wherein [X] is selected from the group comprising polyethylene glycol, ##STR00028## wherein represents the point of attachment to the rest of the molecule and wherein [R] is an optional spacer selected from the group comprising substituted or unsubstituted alkyl groups, substituted or unsubstituted heteroalkyl groups, substituted or unsubstituted aryl groups, substituted or unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof.
21. The target-binding molecule-drug conjugate of claim 18, wherein [X] is polyethylene glycol.
22. The target-binding molecule-drug conjugate of claim 12, wherein the target-binding molecule is a protein and anthracycline (PNU) derivative is conjugated to a thiol-containing amino acid residue in the amino acid sequence of the protein or wherein the PNU derivative is conjugated via a thiol moiety incorporated by chemical modification at the N-terminus or C-terminus of the amino acid sequence of the protein.
23. The target-binding molecule-drug conjugate according to claim 12, wherein the target-binding molecule is a binding protein selected from the group comprising an immunoglobulin or antibody, an immunoglobulin Fc region, an immunoglobulin Fab region, a Fab′, a Fv, a Fv-Fc, a single chain Fv (scFv), scFv-Fc, (scFv).sub.2, a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein.
24. The target-binding molecule-drug conjugate according to claim 12, where the target-binding molecule binds to receptor tyrosine kinase-like orphan receptor 1 (ROR1).
25. The target-binding molecule-drug conjugate of claim 12, wherein the target-binding molecule is a specific antigen binding protein comprising an amino acid sequence represented by the formula (III):
FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4 (III) wherein FW1 is a framework region CDR1 is a CDR sequence FW2 is a framework region HV2 is a hypervariable sequence FW3a is a framework region HV4 is a hypervariable sequence FW3b is a framework region CDR3 is a CDR sequence FW4 is a framework region.
26. The target-binding molecule-drug conjugate according to claim 25, wherein the specific antigen binding protein binds receptor tyrosine kinase-like orphan receptor 1 (ROR1), does not bind to receptor tyrosine kinase-like orphan receptor 2 (ROR2), binds to both human ROR1 and murine ROR1 (mROR1), or binds to deglycosylated ROR1.
27-29. (canceled)
30. The target-binding molecule-drug conjugate according to claim 26, wherein the ROR1-specific antigen binding protein does not bind to a linear peptide sequence selected from: TABLE-US-00021 (SEQ ID NO: 34) YMESLHMQGEIENQI (SEQ ID NO: 35) CQPWNSQYPHTHTFTALRFP (SEQ ID NO: 36) RSTIYGSRLRIRNLDTTDTGYFQ (SEQ ID NO: 37) QCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYE
31. The target-binding molecule-drug conjugate according to claim 26, wherein FW1 is a framework region of from 20 to 28 amino acids CDR1 is a CDR sequence selected from DTSYGLYS (SEQ ID NO: 1), GAKYGLAA (SEQ ID NO: 2), GAKYGLFA (SEQ ID NO: 3), GANYGLAA (SEQ ID NO: 4), or GANYGLAS (SEQ ID NO: 5) FW2 is a framework region of from 6 to 14 amino acids HV2 is a hypervariable sequence selected from TTDWERMSIG (SEQ ID NO: 6), SSNQERISIS (SEQ ID NO: 7), or SSNKEQISIS (SEQ ID NO: 8) FW3a is a framework region of from 6 to 10 amino acids HV4 is a hypervariable sequence selected from NKRAK (SEQ ID NO: 9), NKRTM (SEQ ID NO: 10), NKGAK (SEQ ID NO: 11), or NKGTK (SEQ ID NO: 12) FW3b is a framework region of from 17 to 24 amino acids CDR3 is a CDR sequence selected from QSGMAISTGSGHGYNWY (SEQ ID NO: 13), QSGMAIDIGSGHGYNWY (SEQ ID NO: 14), YPWAMWGQWY (SEQ ID NO: 15), VFMPQHWHPAAHWY (SEQ ID NO: 16), REARHPWLRQWY (SEQ ID NO: 17), or YPWGAGAPWLVQWY (SEQ ID NO: 18) FW4 is a framework region of from 7 to 14 amino acids or a functional variant thereof with at least 45% sequence identity thereto,
32. The target-binding molecule-drug conjugate according to claim 26, wherein FW1 is selected from: ASVNQTPRTATKETGESLTINCVLT (SEQ ID NO: 19), AKVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 20), TRVDQTPRTATKETGESLTINCVVT (SEQ ID NO: 21), TRVDQTPRTATKETGESLTINCVLT (SEQ ID NO: 22), ASVNQTPRTATKETGESLTINCVVT (SEQ ID NO: 23), TRVDQSPSSLSASVGDRVTITCVLT (SEQ ID NO: 24) or ASVTQSPRSASKETGESLTITCRVT (SEQ ID NO: 56), FW2 is selected from: TSWFRKNPG (SEQ ID NO: 25), or TYWYRKNPG (SEQ ID NO: 26); FW3a is selected from: GRYVESV (SEQ ID NO: 27), or GRYSESV (SEQ ID NO: 28), FW3b is selected from: SFSLRIKDLTVADSATYYCKA (SEQ ID NO: 29), SFTLTISSLQPEDSATYYCRA (SEQ ID NO: 30), SFTLTISSLQPEDFATYYCKA (SEQ ID NO: 31) or SFSLRISSLTVEDSATYYCKA (SEQ ID NO: 57), and FW4 is selected from: DGAGTVLTVN (SEQ ID NO: 32), DGAGTKVEIK (SEQ ID NO: 33) or DGQGTKLEVK (SEQ ID NO: 58); or functional variants thereof with a sequence identity of at least 45%.
33. The target-binding molecule-drug conjugate according to claim 26, wherein the ROR1-specific antigen binding molecule comprises an amino acid sequence selected from: TABLE-US-00022 (SEQ ID NO: 39) ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHG YNWYDGAGTVLTVN; (SEQ ID NO: 40) AKVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAIDIGSGHG YNWYDGAGTVLTVN; (SEQ ID NO: 41) TRVDQTPRTATKETGESLTINCVVTGAKYGLAATYWYRKNPGSSNQERI SISGRYVESVNKRTMSFSLRIKDLTVADSATYYCKAYPWAMWGQWYDGA GTVLTVN; (SEQ ID NO: 42) TRVDQTPRTATKETGESLTINCVVTGAKYGLFATYWYRKNPGSSNQERI SISGRYVESVNKRTMSFSLRIKDLTVADSATYYCKAVFMPQHWHPAAHW YDGAGTVLTVN; (SEQ ID NO: 43) TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFSLRIKDLTVADSATYYCKAREARHPWLRQWYD GAGTVLTVN; (SEQ ID NO: 44) ASVNQTPRTATKETGESLTINCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYVESVNKRTMSFSLRIKDLTVADSATYYCKAYPWGAGAPWLVQW YDGAGTVLTVN;, (SEQ ID NO: 45) TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAYPWGAGAPWLVQW YDGAGTKVEIK; (SEQ ID NO: 46) TRVDQSPSSLSASVGDRVTITCVLTGANYGLASTYWYRKNPGSSNQERI SISGRYSESVNKRTMSFTLTISSLQPEDSATYYCRAYPWGAGAPWLVQW YDGAGTKVEIK; (SEQ ID NO: 47) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFTLTISSLQPEDFATYYCKAREARHPWLRQWYD GAGTKVEIK; (SEQ ID NO: 48) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAREARHPWLRQWYD GAGTKVEIK; (SEQ ID NO: 49) TRVDQSPSSLSASVGDRVTITCVLTDTSYGLYSTYWYRKNPGTTDWERM SIGGRYSESVNKGAKSFTLTISSLQPEDSATYYCRAREARHPWLRQWYD GAGTKVEIK; (SEQ ID NO: 59) ASVTQSPRSASKETGESLTITCRVTGANYGLAATYWYRKNPGSSNQERI SISGRYSESVNKRTMSFSLRISSLTVEDSATYYCKAYPWGAGAPWLVQW YDGQGTKLEVK; or a functional variant thereof with a sequence identity of at least 45%.
34. The target-binding molecule-drug conjugate of claim 26, wherein the ROR1-specific antigen binding protein is humanized or de-immunized.
35-38. (canceled)
39. A method of treatment of a disease in a patient in need of treatment comprising administration to said patient of a therapeutically effective dosage of a target-binding molecule-drug conjugate according to claim 24.
40. The method of claim 39, wherein the disease is cancer.
41. The target-binding molecule-drug conjugate according to claim 12, wherein the target-binding molecule is an antibody, an antibody that binds HER-2, trastuzumab or a derivative thereof.
42-43. (canceled)
44. A pharmaceutical composition comprising a target-binding molecule-drug conjugate according to claim 24, and at least one other pharmaceutically acceptable ingredient.
Description
DESCRIPTION OF FIGURES
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
DETAILED DESCRIPTION
[0097] A highly interesting class of DNA intercalating toxins for use as payloads for drug conjugates are anthracyclines, because of their proven clinical validation as chemotherapeutic drugs in cancer therapy. The anthracycline derivative PNU-159682 has been described as a metabolite of nemorubicin (Quintieri et al. (2005) Clin. Cancer Res. 11, 1608-1617) and has been reported to exhibit extremely high potency for in vitro cell killing in the pico- to femtomolar range with one ovarian (A2780) and one breast cancer (MCF7) cell line (WO2012/073217 A1).
[0098] Stability of chemically-conjugated protein drug conjugates is an important consideration, since unintended release of a highly potent anthracycline toxin, like PNU-159682, in the circulation of a patient prior to targeting of the tumour cells would lead to off target effects and undesirable side effects. Some example molecules released from PNU conjugates are given in
[0099] Potent toxins that can be linked to targeting proteins with high stability are therefore required in order to avoid, or at least reduce, unwanted side effects. Alternatively, linker payloads are designed such that extracellular cleavage releases derivatives of the payload with attenuated potency. However, sufficient potency needs to be retained in order to avoid any reduction in side effect being negated due to the need to administer higher doses to achieve efficacy.
[0100] Ease of conjugation is an important factor in producing easily manufacturable products. The payloads of the first aspect of the present invention use a maleimide group, which can react to any available thiol group on a conjugation partner using straightforward and standard conditions. Furthermore, the use of maleimide/thiol chemistry for conjugation allows for site-specific conjugation to introduced thiol groups, for example on the side-chain of an engineered cysteine residue in a protein sequence. In some cases described herein, a cysteine may be introduced via the introduction of his myc tag containing an engineered cysteine (example sequences include, but are not limited to, QACKAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 52) or QACGAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 53)) at the C- or N-terminal of a protein.
[0101] Antibody/protein drug conjugates generated using non-selective labelling methods, such as through reaction with amino functionalities within proteins, deliver products containing multiple different species with differing drug to antibody ratios. This impacts the properties of the conjugate including potency and PK properties which impacts in vivo efficacy and toxicities. Therefore, thiol reactive payloads are of great importance, as these can be reacted in high yield, in a simple process, with naturally occurring cysteine residues in proteins or with a cysteine residue engineered into a specific site at any point within the sequence of proteins using molecular biology/recombinant protein expression or chemical synthesis or through chemical modification of expressed, synthetic or natural proteins.
[0102] The present invention provides anthracycline (PNU) derivatives suitable for use in drug conjugates, including but not limited to protein-drug conjugates (PDCs). Specifically, derivatives of PNU159682 are provided, which lack the C14 carbon and attached hydroxyl functionality, and in which an ethylenediamino (EDA) group forms part of a linker region between the C13 carbonyl of PNU159682 and a maleimide group. A maleimide group is present in the anthracycline (PNU) derivatives of the first aspect of the invention and may also be present in the anthracycline (PNU) derivatives of the second aspect of the invention. Such payloads are able to react with a free thiol group on another molecule. Where the free thiol is on a protein, a protein-drug conjugate (PDC) may be formed.
[0103] Surprisingly, derivatives of PNU159682 functionalised with an ethylenediamino (EDA) group and linked to a thiol group via a maleimide group show higher stability compared to non-EDA payloads or liberated payload derivatives with slightly less potency. More stable payloads may be advantageous because of reduced off-target effects, which in turn may lead to reduced side effects and increased patient compliance.
[0104] The invention further provides a target-binding molecule—drug conjugate, comprising an anthracycline derivative conjugate according to the above disclosure and a target-binding molecule.
[0105] According to another embodiment of the target-binding molecule-drug conjugate, the target-binding molecule is a protein and the anthracycline (PNU) derivative is conjugated, optionally by means of one or more linkers, to a thiol group introduced into the amino acid sequence of the protein. The introduced thiol may be introduced at the amino or carboxy terminus of the protein, or to the amino or carboxy terminus of a domain or subunit thereof. In another embodiment the conjugation is to a thiol group in a sequence introduced at the at the amino or carboxy terminus of the protein, or to the amino or carboxy terminus of a domain or subunit thereof.
[0106] The target-binding molecule may be a protein such as a specific antigen binding protein may be a VNAR domain derived from the Novel or New antigen receptor (IgNAR) found in the sera of cartilaginous fish (Greenberg A. S., et al., Nature, 1995. 374(6518): p. 168-173, Dooley, H., et al, Mol. Immunol, 2003. 40(1): p. 25-33; Müller, M. R., et al., mAbs, 2012. 4(6): p. 673-685)).
[0107] The specific antigen binding protein may therefore comprise an amino acid sequence represented by the formula (III):
FW1-CDR1-FW2-HV2-FW3a-HV4-FW3b-CDR3-FW4 (III)
wherein [0108] FW1 is a framework region [0109] CDR1 is a CDR sequence [0110] FW2 is a framework region [0111] HV2 is a hypervariable sequence [0112] FW3a is a framework region [0113] HV4 is a hypervariable sequence [0114] FW3b is a framework region [0115] CDR3 is a CDR sequence [0116] FW4 is a framework region.
[0117] Framework region FW1 is preferably from 20 to 28 amino acids in length, more preferably from 22 to 26 amino acids in length, still more preferably from 23 to 25 amino acids in length. In certain preferred embodiments, FW1 is 26 amino acids in length. In other preferred embodiments, FW1 is amino acids in length. In still other preferred embodiments, FW1 is 24 amino acids in length.
[0118] CDR region CDR1 is preferably from 7 to 11 amino acids in length, more preferably from 8 to 10 amino acids in length. In certain preferred embodiments, CDR1 is 9 amino acids in length. In other preferred embodiments, CDR1 is 8 amino acids in length.
[0119] Framework region FW2 is preferably from 6 to 14 amino acids in length, more preferably from 8 to 12 amino acids in length. In certain preferred embodiments, FW2 is 12 amino acids in length. In other preferred embodiments, FW2 is 10 amino acids in length. In other preferred embodiments, FW2 is 9 amino acids in length. In other preferred embodiments, FW2 is 8 amino acids in length.
[0120] Hypervariable sequence HV2 is preferably from 4 to 11 amino acids in length, more preferably from to 10 amino acids in length. In certain preferred embodiments, HV2 is 10 amino acids in length. In certain preferred embodiments, HV2 is 9 amino acids in length. In other preferred embodiments, HV2 is 6 amino acids in length.
[0121] Framework region FW3a is preferably from 6 to 10 amino acids in length, more preferably from 7 to 9 amino acids in length. In certain preferred embodiments, FW3a is 8 amino acids in length. In certain preferred embodiments, FW3a is 7 amino acids in length.
[0122] Hypervariable sequence HV4 is preferably from 3 to 7 amino acids in length, more preferably from 4 to 6 amino acids in length. In certain preferred embodiments, HV4 is 5 amino acids in length. In other preferred embodiments, HV4 is 4 amino acids in length.
[0123] Framework region FW3b is preferably from 17 to 24 amino acids in length, more preferably from 18 to 23 amino acids in length, still more preferably from 19 to 22 amino acids in length. In certain preferred embodiments, FW3b is 21 amino acids in length. In other preferred embodiments, FW3b is amino acids in length.
[0124] CDR region CDR3 is preferably from 8 to 21 amino acids in length, more preferably from 9 to 20 amino acids in length, still more preferably from 10 to 19 amino acids in length. In certain preferred embodiments, CDR3 is 17 amino acids in length. In other preferred embodiments, CDR3 is 14 amino acids in length. In still other preferred embodiments, CDR3 is 12 amino acids in length. In yet other preferred embodiments, CDR3 is 10 amino acids in length.
[0125] Framework region FW4 is preferably from 7 to 14 amino acids in length, more preferably from 8 to 13 amino acids in length, still more preferably from 9 to 12 amino acids in length. In certain preferred embodiments, FW4 is 12 amino acids in length. In other preferred embodiments, FW4 is 11 amino acids in length. In still other preferred embodiments, FW4 is 10 amino acids in length. In yet other preferred embodiments, FW4 is 9 amino acids in length.
[0126] All possible combinations and permutations of the framework regions, complementarity determining regions and hypervariable regions listed above are explicitly contemplated herein.
[0127] Preferred VNAR domains for use in the present invention include B1, P3A1, D3, BA11, and E9, the sequences of which are set out below. B1, P3A1, D3 and E9 bind to ROR1 (data shown in co-pending International patent application no. PCT/EP2018/086823, published as WO 2019/122447, the content of which is incorporated herein by reference) PCT. BA11 is a humanised VNAR that binds with high affinity to human serum albumin (Kovalenko et al, J. Biol. Chem., 2013 JBC). In addition, the non-binding VNAR domain 2V is also described below.
TABLE-US-00004 B1 is (SEQ ID NO: 44) ASVNQTPRTATKETGESLTINCVVTGANYGLAATYWYRKNPGSSNQERI SISGRYVESVNKRTMSFSLRIKDLTVADSATYYCKAYPWGAGAPWLVQW YDGAGTVLTVN 2V is (SEQ ID NO: 54) TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFSLRIKDLTVADSATYYCKAQSLAISTRSYWYD GAGTVLTVN P3A1 is (SEQ ID NO: 43) TRVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKGAKSFSLRIKDLTVADSATYYCKAREARHPWLRQWYD GAGTVLTVN D3 is (SEQ ID NO: 39) ASVNQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAISTGSGHG YNWYDGAGTVLTVN BA11 is (SEQ ID NO: 55) TRVDQSPSSLSASVGDRVTITCVLTDTSYPLYSTYWYRKNPGSSNKEQI SISGRYSESVNKGTKSFTLTISSLQPEDSATYYCRAMSTNIWTGDGAGT KVEIK E9 is (SEQ ID NO: 40) AKVDQTPRTATKETGESLTINCVLTDTSYGLYSTSWFRKNPGTTDWERM SIGGRYVESVNKRAKSFSLRIKDLTVADSATYYCKAQSGMAIDIGSGHG YNWYDGAGTVLTVN
[0128] VNAR domains for use in the present invention include the VNARs identified in SEQ ID Nos: 40-49 and 59. Further preferred VNARs include the humanised VNARs identified in SEQ ID Nos: 45-49 and 59. A particularly preferred humanised VNAR is B1V15, having the amino acid sequence
TABLE-US-00005 (SEQ ID NO: 59) ASVTQSPRSASKETGESLTITCRVTGANYGLAATYWYRKNPGSSNQERI SISGRYSESVNKRTMSFSLRISSLTVEDSATYYCKAYPWGAGAPWLVQW YDGQGTKLEVK.
[0129] Sequence identity referenced in relation to the molecules of the invention may be judged at the level of individual CDRs, HVs or FWs, or it may be judged over the length of the entire molecule. The CDR, HV and FW sequences described may also be longer or shorter, whether that be by addition or deletion of amino acids at the N- or C-terminal ends of the sequence or by insertion or deletion of amino acids with a sequence.
[0130] Any part of the specific binding protein may be engineered to enable conjugation in a PDC of the invention. In a preferred example, where an immunoglobulin Fc region is used, it may be engineered to include a cysteine residue as a conjugation site. Preferred introduced cysteine residues include, but are not limited to S252C and S473C (Kabat numbering), which correspond to S239C and S442C in EU numbering, respectively.
[0131] The target-binding molecule-drug conjugate may be any target-binding molecule-drug conjugate disclosed herein. For example, the target-binding molecule-drug conjugate may be selected from the group consisting of: [0132] B1-hFc-vc-PAB-EDA-PNU [0133] B1-hFc-va-EDA-PNU [0134] B1-hFc-na-EDA-PNU
[0135] B1-hFc-vc-PAB-EDA-PNU and B1-hFc-va-EDA-PNU are shown herein to have particular efficacy for use in the treatment of mesothelioma and TNBC.
[0136] Preferably, target-binding molecule-drug conjugate comprises a PEG4 spacer. For example, the target-binding molecule-drug conjugate may be selected from the group consisting of: [0137] B1-hFc-PEG4-vc-PAB-EDA-PNU [0138] B1-hFc-PEG4-va-EDA-PNU [0139] B1-hFc-PEG4-na-EDA-PNU
[0140] Preferably the hFc comprises an introduced cysteine residue at 5239C (EU numbering). Accordingly, for example, the target-binding molecule-drug conjugate may be selected from the group consisting of: [0141] B1-hFc(S239C)-vc-PAB-EDA-PNU [0142] B1-hFc(S239C)-va-EDA-PNU [0143] B1-hFc(S239C)-na-EDA-PNU
[0144] The target-binding molecule-drug conjugate may be selected from the group consisting of: [0145] B1-hFc(S239C)-PEG4-vc-PAB-EDA-PNU [0146] B1-hFc(S239C)-PEG4-va-EDA-PNU [0147] B1-hFc(S239C)-PEG4-na-EDA-PNU
[0148] In one embodiment of the target-binding molecule-drug conjugate the target-binding molecule is an antibody. In another embodiment of the target-binding molecule-drug conjugate the target-binding molecule binds HER-2. Preferably, the target-binding molecule is an antibody specific for HER-2.
[0149] Preferably, target-binding molecule-drug conjugate comprises a PEG4 spacer. For example, the target-binding molecule-drug conjugate may be selected from the group consisting of: [0150] Tras-PEG4-vc-PAB-EDA-PNU [0151] Tras-PEG4-va-EDA-PNU
[0152] The target-binding molecule-drug conjugate may be selected from the group consisting of: [0153] Tras(S442C)-PEG4-vc-PAB-EDA-PNU [0154] Tras(5442C)-PEG4-va-EDA-PNU
[0155] Any of the features described in respect of any of the above-mentioned aspects of the invention may be combined mutatis mutandis with the other aspects of the invention.
Definitions
[0156] As used herein, an alkyl group is a straight chain or branched, substituted or unsubstituted group (preferably unsubstituted) containing from 1 to 40 carbon atoms. An alkyl group may optionally be substituted at any position. The term “alkenyl,” as used herein, denotes a group derived from the removal of a single hydrogen atom from a straight- or branched-chain aliphatic moiety having at least one carbon-carbon double bond. The term “alkynyl,” as used herein, refers to a group derived from the removal of a single hydrogen atom from a straight- or branched-chain aliphatic moiety having at least one carbon-carbon triple bond.
[0157] The term ‘alkyl’, ‘aryl’, ‘heteroaryl’ etc also include multivalent species, for example alkylene, arylene, ‘heteroarylene’ etc. Examples of alkylene groups include ethylene (—CH.sub.2—CH.sub.2—), and propylene (—CH.sub.2—CH.sub.2—CH.sub.2—). An exemplary arylene group is phenylene (—C.sub.6H.sub.4—), and an exemplary heteroarylene group is pyridinylene (—C.sub.5H.sub.3N—).
[0158] Aromatic rings are cyclic aromatic groups that may have 0, 1, 2 or more, preferably 0, 1 or 2 ring heteroatoms. Aromatic rings may be optionally substituted and/or may be fused to one or more aromatic or non-aromatic rings (preferably aromatic), which may contain 0, 1, 2, or more ring heteroatoms, to form a polycyclic ring system.
[0159] Aromatic rings include both aryl and heteroaryl groups. Aryl and heteroaryl groups may be mononuclear, i.e. having only one aromatic ring (like for example phenyl or phenylene), or polynuclear, i.e. having two or more aromatic rings which may be fused (like for example napthyl or naphthylene), individually covalently linked (like for example biphenyl), and/or a combination of both fused and individually linked aromatic rings. Preferably the aryl or heteroaryl group is an aromatic group which is substantially conjugated over substantially the whole group. Aryl groups may contain from 5 to 40 ring carbon atoms, from 5 to 25 carbon atoms, from 5 to 20 carbon atoms, or from 5 to 12 carbon atoms. Heteroaryl groups may be from 5 to 40 membered, from 5 to 25 membered, from 5 to 20 membered or from 5 to 12 membered rings, containing 1 or more ring heteroatoms selected from N, O, S and P. An aryl or heteroaryl may be fused to one or more aromatic or non-aromatic rings (preferably an aromatic ring) to form a polycyclic ring system.
[0160] Aryl and heteroaryl preferably denote a mono-, bi- or tricyclic aromatic or heteroaromatic group with up to 25 ring atoms that may also comprise condensed rings and is optionally substituted. Preferred aryl groups include, without limitation, benzene, biphenylene, triphenylene, [1,1′:3′,1″ ]terphenyl-2′-ylene, naphthalene, anthracene, binaphthylene, phenanthrene, pyrene, dihydropyrene, chrysene, perylene, tetracene, pentacene, benzopyrene, fluorene, indene, indenofluorene, spirobifluorene, etc.
[0161] Preferred heteroaryl groups include, without limitation, 5-membered rings like pyrrole, pyrazole, silole, imidazole, 1,2,3-triazole, 1,2,4-triazole, tetrazole, furan, thiophene, selenophene, oxazole, isoxazole, 1,2-thiazole, 1,3-thiazole, 1,2,3-oxadiazole, 1,2,4-oxadiazole, 1,2,5-oxadiazole, 1,3,4-oxadiazole, 1,2,3-thiadiazole, 1,2,4-thiadiazole, 1,2,5-thiadiazole, 1,3,4-thiadiazole, 6-membered rings like pyridine, pyridazine, pyrimidine, pyrazine, 1,3,5-triazine, 1,2,4-triazine, 1,2,3-triazine, 1,2,4,5-tetrazine, 1,2,3,4-tetrazine, 1,2,3,5-tetrazine, and fused systems like carbazole, indole, isoindole, indolizine, indazole, benzimidazole, benzotriazole, purine, naphthimidazole, phenanthrimidazole, pyridimidazole, pyrazinimidazole, quinoxalinimidazole, benzoxazole, naphthoxazole, anthroxazole, phenanthroxazole, isoxazole, benzothiazole, benzofuran, isobenzofuran, dibenzofuran, quinoline, isoquinoline, pteridine, benzo-5,6-quinoline, benzo-6,7-quinoline, benzo-7,8-quinoline, benzoisoquinoline, acridine, phenothiazine, phenoxazine, benzopyridazine, benzopyrimidine, quinoxaline, phenazine, naphthyridine, azacarbazole, benzocarboline, phenanthridine, phenanthroline, thieno[2,3b]thiophene, thieno[3,2b]thiophene, dithienothiophene, dithienopyridine, isobenzothiophene, dibenzothiophene, benzothiadiazothiophene, 2,5-dihydropyrrolo[3,4-c]pyrrol-1,4-dione (diketopyrrolopyrrole, DPP), 2-oxo-1H-indol-3-ylidene, [3,3′-bipyrrolo[2,3-b]pyridinylidene]-2,2′(1H,1′H)-dione (pyridine isoindigo) and (3E)-3-(2-oxo-1H-indol-3-ylidene)-1H-indol-2-one (isoindigo), or combinations thereof. The heteroaryl groups may be substituted with alkyl, alkoxy, thioalkyl, fluoro, fluoroalkyl or further aryl or heteroaryl substituents. Preferably a heteroaryl group is thiophene.
[0162] Particularly preferred heteroatoms are selected from O, S, N, P and Si. Typically, hydrogen will complete the valency of a heteroatom included in the molecules of the invention, e.g. for N there may be —NH— or —NH.sub.2 where one or two other groups are involved.
[0163] As used herein, the term “optionally substituted” means that one or more of the hydrogen atoms in the optionally substituted moiety is replaced by a suitable substituent. Unless otherwise indicated, an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position. Combinations of substituents envisioned by this invention are preferably those that result in the formation of stable compounds. The term “stable”, as used herein, refers to compounds that are chemically feasible and can exist for long enough at room temperature (i.e. 16-25° C.) to allow for their detection, isolation and/or use in chemical synthesis.
[0164] Any of the above groups (for example, those referred to herein as “optionally substituted”, including alkyl, aryl and heteroaryl groups) may optionally comprise one or more substituents, preferably selected from silyl, sulfo, sulfonyl, formyl, amino, imino, nitrilo, mercapto, cyano, nitro, halogen, —NCO, —NCS, —OCN, —SCN, —C(═O)NR.sup.0R.sup.00, —C(═O)X.sup.0, —C(═O)R.sup.0, —NR.sup.0R.sup.00, C.sub.1-12alkyl, C.sub.1-12alkenyl, C.sub.1-12alkynyl, C.sub.6-12aryl, C.sub.3-12cycloalkyl, heterocycloalkyl having 4 to 12 ring atoms, heteroaryl having 5 to 12 ring atoms, C.sub.1-12 alkoxy, hydroxy, C.sub.1-12 alkylcarbonyl, C.sub.1-12 alkoxy-carbonyl, C.sub.1-12 alkylcarbonyloxy or C.sub.1-12 alkoxycarbonyloxy wherein one or more H atoms are optionally replaced by F or Cl and/or combinations thereof; wherein X.sup.0 is halogen and R.sup.0 and R.sup.00 are, independently, H or optionally substituted C.sub.1-12alkyl. The optional substituents may comprise all chemically possible combinations in the same group and/or a plurality of the aforementioned groups (for example amino and sulfonyl if directly attached to each other represent a sulfamoyl radical). In one embodiment, the substituent is not acyl. As used herein acyl refers to an acyl group which is a moiety derived by the removal of one or more hydroxyl groups from an oxoacid, such as a carboxylic acid. It contains a double-bonded oxygen atom and an alkyl group.
[0165] In some embodiments the groups may be unsubstituted. For example, in respect of the first aspect of the invention, the anthracycline (PNU) derivative may be of formula (I):
##STR00012##
wherein [X] is an optional spacer selected from the group comprising unsubstituted alkyl groups, unsubstituted heteroalkyl groups, unsubstituted aryl groups, unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof;
[L1] and [L2] are optional linkers selected from the group consisting of valine (Val), citrulline (Cit), alanine (Ala), asparagine (Asn), a peptide, —(CH.sub.2).sub.n—, —(CH.sub.2CH.sub.2O).sub.n—, p-aminobenzyloxycarbonyl (PAB), Val-Cit-PAB, Val-Ala-PAB, Ala-Ala-Asn-PAB, any amino acid except glycine, and combinations thereof.
[0166] In embodiments wherein the groups are unsubstituted, [X] is preferably selected from the group comprising polyethylene glycol and
##STR00013##
wherein represents the point of attachment to the rest of the molecule and wherein [R] is an optional spacer selected from the group comprising unsubstituted alkyl groups, unsubstituted heteroalkyl groups, unsubstituted aryl groups, unsubstituted heteroaryl groups, one or more heteroatoms, polyethylene glycol, or a combination thereof.
[0167] In general, the term PAB is intended to mean p-aminobenzyloxycarbonyl. Occasionally in the literature, the term PAB may be used to indicated p-aminobenzyl. In the present specification, PAB is intended to indicate p-aminobenzyloxycarbonyl.
[0168] The term “protein” means, in general terms, a plurality of amino acid residues joined together by peptide bonds. It is used interchangeably and means the same as peptide, oligopeptide, oligomer or polypeptide, and includes glycoproteins and derivatives thereof. The term “protein” is also intended to include fragments, analogues, variants and derivatives of a protein wherein the fragment, analogue, variant or derivative retains essentially the same biological activity or function as a reference protein. Examples of protein analogues and derivatives include peptide nucleic acids, and DARPins (Designed Ankyrin Repeat Proteins).
[0169] The term “target-binding molecule” refers to any molecule that binds to a given target. In this context, “target” and “antigen” may be used interchangeably. Examples of target-binding molecules include natural or recombinant proteins including immunoglobulins or antibodies, immunoglobulin Fc regions, immunoglobulin Fab regions, Fab, Fab′, Fv, Fv-Fc, single chain Fv (scFv), scFv-Fc, (scFv).sub.2, diabodies, triabodies, tetrabodies, bispecific t-cell engagers (BiTEs), inteins, intein fusions, VNAR domains, single domain antibodies (sdAb), VH domains, scaffold proteins (affibodies, centyrins, darpins etc.) and nucleic acids including aptamers or small molecules or natural products that have been developed to bind to the target or naturally bind to the target.
[0170] An antigen specific binding protein may comprise any protein which binds to a given antigen. Preferred examples include an immunoglobulin or antibody, an immunoglobulin Fc region, an immunoglobulin Fab region, a Fab′, a Fv, a Fv-Fc, a single chain Fv (scFv), scFv-Fc, (scFv).sub.2, a diabody, a triabody, a tetrabody, a bispecific t-cell engager (BiTE), an intein, an intein fusion, a VNAR domain, a single domain antibody (sdAb), a VH domain, or a scaffold protein (affibodies, centyrins, darpins etc.). Particularly preferred examples include VNAR domains that comprise an amino acid sequence derived from a synthetic library of VNAR molecules, or from libraries derived from the immunization of a cartilaginous fish. The terms VNAR, IgNAR and NAR may be used interchangeably also.
[0171] Amino acids are represented herein as either a single letter code or as the three letter code or both. Chemical modification of proteins and biomolecules to introduce thiols is well established. Methods include reaction of amine groups with 2-iminothiolane (Traut's reagent), modification of amine groups with NHS-ester containing heterobifunctional agents such as N-succinimidyl S-acetylthiolate (SATA) or N-succinimidyl-4-(2-pyridyldithio)butanoate (SPDB), followed by treatment with hydroxylamine and reducing agents respectively and cleavage of engineered intein-fusion proteins with cysteamine to generate C-terminal thiol proteins and peptides.
[0172] The term “affinity purification” means the purification of a molecule based on a specific attraction or binding of the molecule to a chemical or binding partner to form a combination or complex which allows the molecule to be separated from impurities while remaining bound or attracted to the partner moiety.
[0173] The term “Complementarity Determining Regions” or CDRs (i.e., CDR1 and CDR3) refers to the amino acid residues of a VNAR domain the presence of which are typically involved in antigen binding. Each VNAR typically has two CDR regions identified as CDR1 and CDR3. Additionally, each VNAR domain comprises amino acids from a “hypervariable loop” (HV), which may also be involved in antigen binding. In some instances, a complementarity determining region can include amino acids from both a CDR region and a hypervariable loop. In other instances, antigen binding may only involve residues from a single CDR or HV. According to the generally accepted nomenclature for VNAR molecules, a CDR2 region is not present.
[0174] “Framework regions” (FW) are those VNAR residues other than the CDR residues. Each VNAR typically has five framework regions identified as FW1, FW2, FW3a, FW3b and FW4.
[0175] The boundaries between FW, CDR and HV regions in VNARs are not intended to be fixed and accordingly some variation in the lengths and compositions of these regions is to be expected. This will be understood by those skilled in the art, particularly with reference to work that has been carried out in analyzing these regions. (Anderson et al., PLoS ONE (2016) 11 (8); Lui et al., Mol Immun (2014) 59, 194-199; Zielonka et al., Mar Biotechnol (2015). 17, (4) 386-392; Fennell et al., J Mol Biol (2010) 400. 155-170; Kovalenko et al., J Biol Chem (2013) 288. 17408-17419; Dooley et al., (2006) PNAS 103 (6). 1846-1851). The molecules of the present invention, although defined by reference to FW, CDR and HV regions herein, are not limited to these strict definitions. Variation in line with the understanding in the art as the structure of the VNAR domain is therefore expressly contemplated herein.
[0176] A “codon set” refers to a set of different nucleotide triplet sequences used to encode desired variant amino acids. A set of oligonucleotides can be synthesized, for example, by solid phase synthesis, including sequences that represent all possible combinations of nucleotide triplets provided by the codon set and that will encode the desired group of amino acids. A standard form of codon designation is that of the IUB code, which is known in the art and described herein.
[0177] A codon set is typically represented by 3 capital letters in italics, e.g. NNK, NNS, XYZ, DVK etc. A “non-random codon set” therefore refers to a codon set that encodes select amino acids that fulfill partially, preferably completely, the criteria for amino acid selection as described herein. Synthesis of oligonucleotides with selected nucleotide “degeneracy” at certain positions is well known in that art, for example the TRIM approach (Knappek et al.; J. Mol. Biol. (1999), 296, 57-86); Garrard & Henner, Gene (1993), 128, 103). Such sets of oligonucleotides having certain codon sets can be synthesized using commercial nucleic acid synthesizers (available from, for example, Applied Biosystems, Foster City, Calif.), or can be obtained commercially (for example, from Life Technologies, Rockville, Md.). A set of oligonucleotides synthesized having a particular codon set will typically include a plurality of oligonucleotides with different sequences, the differences established by the codon set within the overall sequence. Oligonucleotides used according to the present invention have sequences that allow for hybridization to a VNAR nucleic acid template and also may where convenient include restriction enzyme sites.
[0178] “Cell”, “cell line”, and “cell culture” are used interchangeably (unless the context indicates otherwise) and such designations include all progeny of a cell or cell line. Thus, for example, terms like “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that all progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included.
[0179] The “detection limit” for a chemical entity in a particular assay is the minimum concentration of that entity which can be detected above the background level for that assay. For example, in the phage ELISA, the “detection limit” for a particular phage displaying a particular antigen binding fragment is the phage concentration at which the particular phage produces an ELISA signal above that produced by a control phage not displaying the antigen binding fragment.
[0180] A “fusion protein” and a “fusion polypeptide” refer to a polypeptide having two portions covalently linked together, where each of the portions is a polypeptide having a different property. The property may be a biological property, such as activity in vitro or in vivo. The property may also be a simple chemical or physical property, such as binding to a target antigen, catalysis of a reaction, etc. The two portions may be linked directly by a single peptide bond or through a peptide linker containing one or more amino acid residues. Generally, the two portions and the linker will be in reading frame with each other. Preferably, the two portions of the polypeptide are obtained from heterologous or different polypeptides.
[0181] The term “fusion protein” in this text means, in general terms, one or more proteins joined together by chemical means, including hydrogen bonds or salt bridges, or by peptide bonds through protein synthesis or both. Typically fusion proteins will be prepared by DNA recombination techniques and may be referred to herein as recombinant fusion proteins.
[0182] “Identity” describes the relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. Identity also means the degree of sequence relatedness (homology) between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. While there exist a number of methods to measure identity between two polypeptide or two polynucleotide sequences, methods commonly employed to determine identity are codified in computer programs. Preferred computer programs to determine identity between two sequences include, but are not limited to, GCG program package (Devereux, et al., Nucleic acids Research, 12, 387 (1984), BLASTP, BLASTN, and FASTA (Atschul et al., J. Molec. Biol. (1990) 215, 403).
[0183] Preferably, the amino acid sequence of the protein has at least 45% identity, using the default parameters of the BLAST computer program (Atschul et al., J. Mol. Biol. (1990) 215, 403-410) provided by HGMP (Human Genome Mapping Project), at the amino acid level, to the amino acid sequences disclosed herein.
[0184] More preferably, the protein sequence may have at least 45%, 46%, 47%, 48%, 49%, 50%, 55%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 90% and still more preferably 95% (still more preferably at least 96%, 97%, 98% or 99%) identity, at the nucleic acid or amino acid level, to the amino acid sequences as shown herein.
[0185] The protein may also comprise a sequence which has at least 45%, 46%, 47%, 48%, 49%, 50%, 50%, 55%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity with a sequence disclosed herein, using the default parameters of the BLAST computer program provided by HGMP, thereto
[0186] A “mutation” is a deletion, insertion, or substitution of a nucleotide(s) relative to a reference nucleotide sequence, such as a wild type sequence.
[0187] “Natural” or “naturally occurring” VNARs, refers to VNARs identified from a non-synthetic source, for example, from a tissue source obtained ex vivo, or from the serum of an animal of the Elasmobranchii subclass. These VNARs can include VNARs generated in any type of immune response, either natural or otherwise induced. Natural VNARs include the amino acid sequences, and the nucleotide sequences that constitute or encode these antibodies. As used herein, natural VNARs are different than “synthetic VNARs”, synthetic VNARs referring to VNAR sequences that have been changed from a source or template sequence, for example, by the replacement, deletion, or addition, of an amino acid, or more than one amino acid, at a certain position with a different amino acid, the different amino acid providing an antibody sequence different from the source antibody sequence.
[0188] A fragment, analogue, variant or derivative of the protein may be at least 25 preferably 30 or 40, or up to 50 or 100, or 60 to 120 amino acids long, depending on the length of the original protein sequence from which it is derived. A length of 90 to 120, 100 to 110 amino acids may be convenient in some instances.
[0189] The fragment, derivative, variant or analogue of the protein may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably, a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the additional amino acids are fused to the mature polypeptide, such as a leader or auxiliary sequence which is employed for purification of the polypeptide. Such fragments, derivatives, variants and analogues are deemed to be within the scope of those skilled in the art from the teachings herein.
[0190] “Oligonucleotides” are short-length, single- or double-stranded polydeoxynucleotides that are chemically synthesized by known methods (such as phosphotriester, phosphite, or phosphoramidite chemistry, using solid-phase techniques). Further methods include the polymerase chain reaction (PCR) used if the entire nucleic acid sequence of the gene is known, or the sequence of the nucleic acid complementary to the coding strand is available. Alternatively, if the target amino acid sequence is known, one may infer potential nucleic acid sequences using known and preferred coding residues for each amino acid residue. The oligonucleotides can be purified on polyacrylamide gels or molecular sizing columns or by precipitation. DNA is “purified” when the DNA is separated from non-nucleic acid impurities (which may be polar, non-polar, ionic, etc.).
[0191] A “variant” or “mutant” of a starting or reference polypeptide (for example, a source VNAR or a CDR thereof), such as a fusion protein (polypeptide) or a heterologous polypeptide (heterologous to a phage), is a polypeptide that (1) has an amino acid sequence different from that of the starting or reference polypeptide and (2) was derived from the starting or reference polypeptide through either natural or artificial mutagenesis. Such variants include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequence of the polypeptide of interest. For example, a fusion polypeptide of the invention generated using an oligonucleotide comprising a nonrandom codon set that encodes a sequence with a variant amino acid (with respect to the amino acid found at the corresponding position in a source VNAR or antigen binding fragment) would be a variant polypeptide with respect to a source VNAR or antigen binding fragment. Thus, a variant CDR refers to a CDR comprising a variant sequence with respect to a starting or reference polypeptide sequence (such as that of a source VNAR or antigen binding fragment). A variant amino acid, in this context, refers to an amino acid different from the amino acid at the corresponding position in a starting or reference polypeptide sequence (such as that of a source VNAR or antigen binding fragment). Any combination of deletion, insertion, and substitution may be made to arrive at the final variant or mutant construct, provided that the final construct possesses the desired functional characteristics. The amino acid changes also may alter post-translational processes of the polypeptide, such as changing the number or position of glycosylation sites.
[0192] A “wild-type” or “reference” sequence or the sequence of a “wild-type” or “reference” protein/polypeptide, such as a coat protein, or a CDR of a source VNAR, may be the reference sequence from which variant polypeptides are derived through the introduction of mutations. In general, the “wild-type” sequence for a given protein is the sequence that is most common in nature. Similarly, a “wild-type” gene sequence is the sequence for that gene which is most commonly found in nature. Mutations may be introduced into a “wild-type” gene (and thus the protein it encodes) either through natural processes or through man induced means. The products of such processes are “variant” or “mutant” forms of the original “wild-type” protein or gene.
[0193] The term “conjugation” as used herein may refer to any method of chemically linking two or more chemical moieties. Typically, conjugation will be via covalent bond. In the context of the present invention, at least one of the chemical moieties will be a target-binding molecule and another or the molecules will be the PNU derivative of the invention. In some cases the conjugation will involve two or more target-binging molecules in addition to a PNU derivative of the invention, in which case conjugation may be directly between the target-binding molecules with the PNU derivative conjugated to one of the target-binding molecules.
[0194] The phrase “selected from the group comprising” may be substituted with the phrase “selected from the group consisting of” and vice versa, wherever they occur herein.
[0195] The present invention will be further understood by reference to the following examples.
EXAMPLES
Example 1: Characterisation of PNU Derivative
[0196] The PNU derivatives of the invention were prepared accordingly to standard synthesis methods. Mass spectrometry was used to verify that the correct molecules had been produced (table 1).
TABLE-US-00006 TABLE 1 Characterisation of PNU derivatives by mass spectrometry Exp. Obs. mass, mass, Name Structure Da Da MA-PEG4- vc-PAB- EDA- PNU159682
[0197] The potency of the EDA-PNU159682 derivative (
TABLE-US-00007 TABLE 2 EDA PNU159682 derivative free payload IC50s over 96 h IC50 (pM) EDA -PNU159682 Cell line Tissue PNU159682 derivative PA-1 Ovarian 4.4 19 PA-1 32.35 Ovarian ROR1 −/− 1.4 4.2 PC-9 Lung 47 96 NCI-N87 Stomach 122 190 DU145 Prostate 22 790 MDA-231 Breast 11 29 MHH-ES1 Ewings sarcoma 3.4 17 A427 Lung 9.8 31 Panc-1 Pancreatic 26 54 A549 Lung 13 15 ACHN Kidney 9.7 175 Hs746T Stomach 49 28 Mino MCL 37 57 697 BCL 8 24 JeKo-1 MCL 44 330 MDA-468 Breast 21 59 PA-1 31-J-06 Ovarian ROR1 −/− 2.2 12 Kasumi-2 BCL 2.4 21
Example 2: VNAR-hFc PNU Conjugates
[0198] A number of VNAR-hFc-PNU conjugates were prepared in order to investigate the PNU derivatives of the invention. Two VNARs were specific for ROR1 (B1 and P3A1). In addition, a non-binding VNAR (2V) was used as a control molecule.
[0199] VNARs were genetically fused to engineered hIgG1 Fc domains via standard [G.sub.4S].sub.3 that contained a cysteine substitution in the hIgG1 Fc sequence, S239C (EU numbering). The VNAR Fc fusion proteins were expressed as secreted protein in CHO K1 cells and purified from the media using MabSelect™ SuRe™ (Evitria, Switzerland). Purified proteins were analysed by SEC (AdvanceBio, Agilent), SDS PAGE and mass spectrometry to confirm sequence and protein integrity. Binding kinetics were determined using a Pioneer Surface Plasmon Resonance (SPR) instrument (SensiQ/Pall ForteBio), or the Biolayer Interferometry (BLI) Octet K2 system (ForteBio). ROR1-hFc or ROR2-hFc fusion proteins (extracelluar domains) were immobilised in sodium acetate pH5 buffer to COOH.sub.2 chips or AR2G sensors using amine coupling. VNARs and VNAR-Fc molecules were tested at various concentrations and the Ka (M.sup.−1 s.sup.−1), Kd (s.sup.−1) and KD (nM) values were determined using QDat software (SensiQ/Pall ForteBio) or Octet Data Analysis High Throughput software (ForteBio) for Biolayer Interferometry. ROR1 2A2 mAb (Biolegend) and ROR2 mAb (R&D Systems) were included as controls for positive/negative binding to ROR1 and ROR2. 2V is a control VNAR sequence, derived from a naïve VNAR library, so is representative of this protein class but has no known target. Tables 3 and 3b summarise the surface plasmon resonance data for the affinity of these molecules for human ROR1 & human ROR2.
TABLE-US-00008 TABLE 3 SPR data for binding of VNAR-Fc fusions to human ROR1 and human ROR2 hROR1 Molecule Ka (M.sup.−1s.sup.−1) Kd (s.sup.−1) KD (nM) hROR2 B1 hFc 3.08E+06 9.53E−05 0.032 No binding P3A1 hFc 1.07E+07 5.64E−04 0.084 No binding D3 hFc 1.21E+06 2.88E−03 2.6 No binding E9 hFc 7.07E+05 3.64E−03 5.3 No binding D3-D3 hFc 4.96E+06 9.88E−04 0.25 No binding hFc - P3A1 2.38E+06 7.76E−04 0.35 No binding hFc - D3 1.10E+06 2.35E−03 2.37 No binding hFc - D3-D3 2.35E+06 1.01E−03 0.49 No binding 2V hFc No binding No binding No binding No binding 2V-2V hFc No binding No binding No binding No binding
[0200] The same process was repeated for P3A1 hFc(442), resulting in comparable binding data. For this derivative the VNAR was genetically fused to engineered hIgG1 Fc domains that contained a cysteine substitution in the hIgG1 Fc sequence, S442C (EU numbering). Surface plasmon resonance data for the affinity of this molecule for human ROR1 & human ROR2 is shown in Table 3b.
TABLE-US-00009 TABLE 3b SPR data for binding of VNAR-Fc fusions to human ROR1 and human ROR2 hROR1 Molecule Ka (M.sup.−1s.sup.−1) Kd (s.sup.−1) KD (nM) hROR2 B1V15 hFc 1.79E+5 1.3E−04 0.726 No binding P3A1 2.70+05 2.0E−04 0.741 No binding hFc(442)
[0201] Using a partial reduction, refolding and labelling method adapted from the literature [Junutula et al, 2008 Nat Biotech, Jeffrey et al, 2013 Bioconj Chem], these proteins were site specific labelled with the maleimide PNU derivatives (
TABLE-US-00010 TABLE 4 Summary of characteristics of VNAR-PNU conjugates Deglycosylated, reduced Conjugate HMW mass, Da DAR by Yield aggregate Protein Payload Expected Observed MS % % B1 hFc MA-PEG4-vc-PAB-EDA-PNU159682 40,262.2 40,263.3 2.1 46 <1 MA-PEG4-va-EDA-PNU159682 40,026.9 40,027.6 2.0 50 <1 MA-PEG4-na-EDA-PNU159682 40,041.9 40,043.2 2.0 59 <1 MA-PEG4-EDA-PNU159682 39,856.7 39,857.6 2.0 53 <1 MA-PEG4-vc-PAB-DMAE-PNU159682 40,419.2 40,421.9 2.2 16 0.4 P3A1 hFc MA-PEG4-vc-PAB-EDA-PNU159682 40,400.3 40,402.6 2.2 60 <1 MA-PEG4-va-EDA-PNU159682 40,165.0 40167.4 2.1 55 <1 MA-PEG4-vc-PAB-DMAE-PNU159682 40,557.4 40559.6 2.0 70 <1 2V hFc MA-PEG4-vc-PAB-EDA-PNU159682 40,177.0 40,180.6 2.1 70 <1 MA-PEG4-va-EDA-PNU159682 39,941.7 39,942.4 2.0 69 <1 MA-PEG4-na-EDA-PNU159682 39,956.7 39,957.5 2.0 65 <1 MA-PEG4-vc-PAB-DMAE-PNU159682 40,334.1 40,337.0 2.4 55 0
[0202] The same process was repeated for the P3A1 hFc(442)-va-EDA-PNU conjugate. Table 4b summaries the conjugate prepared.
TABLE-US-00011 Deglycosylated, reduced Conjugate HMW mass, Da DAR Yield aggregate Protein Payload Expected Observed by MS % % P3A1 MA-PEG4-va-EDA-PNU159682 40,163.8 40,164.9 1.4 14 <1 hFc(442)
In Vitro Cell Viability Assays for Cancer Cells Treated with Anti ROR1 VNAR Drug Conjugates
[0203] Cells were seeded into white, clear bottom 96 well plates (Costar) and incubated at 37° C., 5% CO.sub.2 for 24 hours. On the following day, dilution series were set up for each test agent at ×10 working stocks. The dose response ×10 stock was: 10000, 5000, 1000, 500, 100, 50, 10, 5, 1, 0.5 nM etc. 10 μL of the ×10 stock solutions were added to the cell plates (90 μl per well) using a multichannel pipette. This resulted in a 1:10 dilution into the well and dose responses ranging from 1000 nM (column 1) to 0.05 nM (column 10) or continued to 0.5 fM, if required, for the most sensitive cells lines. 100d of vehicle control (PBS) was added to the control wells (columns 11 and 12). Plates were incubated at 37′C, 5% CO.sub.2 for 72-96 hours. Promega Cell litre Glo reagent was used as per the manufacturer's instructions to assess cell viability. Briefly, assay plates were removed from incubator and allowed to equilibrate to room temperature before adding 1000d of room temperature Cell litre Glo reagent to each 100 μl assay well. Plates were placed on a plate shaker for 2 minutes at 600 rpm. Plates were allowed to sit for a further 10 minutes at room temperature prior to measuring luminescence read-out using a Clariostar plate-reader (BMG). Data was analysed by calculating the average for untreated (vehicle only) control wells and determining the % of control for each treated well. % of control data was then plotted against Log [Treatment] concentration and the IC50 value derived using non-linear regression fitting in GraphPad Prism software.
[0204] The following cell lines were used: [0205] Kasumi-2—human B cell leukaemia precursor; [0206] PA-1—human ovarian cancer cell line; [0207] PA-1 ROR1 ko—human ovarian cancer cell line with ROR1 knock-out; [0208] 697—human B cell leukaemia precursor, and [0209] MHH-ES1—human Ewing's sarcoma cell line.
TABLE-US-00012 TABLE 5 In vitro cell killing data for VNAR-hFc-PNU conjugates IC50(nM) 96 h PA-1 ROR1 Molecule Protein Payload DAR Kasumi-2 PA-1 ko 697 MHH-ES1 P3A1hFc-PEG4-vc-PAB-EDA-PNU P3A1-hFc PEG4-vc-PAB-EDA-PNU159682 2.2 3.2 0.1 11 52 24 P3A1hFc-PEG4-va-EDA-PNU P3A1-hFc PEG4-va-EDA-PNU159682 2.1 2.3 0.15 11.3 61 18 B1hFc-PEG4-vc-PAB-EDA-PNU B1-hFc PEG4-vc-PAB-EDA-PNU159682 2 7 0.1 4.7 40 3 B1hFc-PEG4-va-EDA-PNU B1-hFc PEG4-va-EDA-PNU159682 2 0.093 0.0016 10.3 68 4.6 B1hFc-PEG4-na-EDA-PNU B1-hFc PEG4-na-EDA-PNU159682 2 0.016 0.0064 9.2 7.7 1.1 B1hFc-PEG4-EDA-PNU B1-hFc PEG4-EDA-PNU159682 2 0.014 0.18 34 15 4.5 2VhFc-PEG4-vc-PAB-EDA-PNU 2V-hFc PEG4-vc-PAB-EDA-PNU159682 2 58 7.3 14 63 26 2VhFc-PEG4-va-EDA-PNU 2V-hFc PEG4-va-EDA-PNU159682 2 98 54 48 256 152 2VhFc-PEG4-na-EDA-PNU 2V-hFc PEG4-na-EDA-PNU159682 2 45 47.5 35 108 50 2VhFc-PEG4-vc-PAB-DMAE-PNU 2V-hFc PEG4-vc-PAB-DMAE-PNU159682 2 11 3.13 4.5 40 4.7 P3A1hFc(442)-PEG4-va-EDA-PNU P3A1-hFc PEG4-va-EDA-PNU159682 1.4 9.1 0.025 18.3 37.5
TABLE-US-00013 TABLE 6 Comparison of ROR1-specific conjugates to non-binding 2V-hFc conjugate ROR1 targeting/2V non-targeting window PA-1 MHH- Molecule Kasumi-2 PA-1 31-J-06 697 ES1 P3A1hFc-PEG4-vc-PAB- 18 73 1.3 1.2 1.1 EDA-PNU P3A1hFc-PEG4-va- 43 360 4 4 8.4 EDA-PNU B1hFc-PEG4-vc-PAB- 8 73 3 1.6 9 EDA-PNU B1hFc-PEG4-va-EDA- 1043 33750 5 3.8 33 PNU
[0210] Tables 5 and 6 and
TABLE-US-00014 TABLE 7 Potency of non-binding VNAR(2V)-hFc - PNU159682 conjugates 2V is a control VNAR sequence, derived from a naïve VNAR library, so has no known target and doesn't bind to cancer cell-lines by flow cytometry. 2V-hFc-PNU conjugates were generated and assessed for non-selective cell-killing using a panel of cancer cell-lines as previously described. IC50(nM)96 h PA-1 MHH- Molecule Payload DAR Kasumi-2 PA-1 ROR1 ko 697 ES1 ACHN 2VhFc-PEG4-vc-PAB-EDA-PNU PEG4-vc-PAB-EDA-PNU159682 2 58 7.3 14 63 26 93 2VhFc-PEG4-va-EDA-PNU PEG4-va-EDA-PNU159682 2 98 54 48 256 152 483 2VhFc-PEG4-na-EDA-PNU PEG4-na-EDA-PNU159682 2 45 47.5 35 108 50 380 2VhFc-PEG4-vc-PAB-DMAE-PNU PEG4-vc-PAB-DMAE-PNU159682 2 11 3.13 4.5 40 4.7 32
[0211] The data in table 7 demonstrate that the PNU conjugates of the invention consistently have higher IC50 values than the prior art PEG4-vc-PAB-DMAE-PNU159682. The linker-payloads of the invention therefore give rise to more stable conjugates and/or less potent by-products and these protein drug conjugates should be less toxic to normal tissues.
Example 3: Trastuzumab Conjugates
[0212] Trastuzumab mutants were produced in which a single serine residue in the Fc portion (position 442) is changed to a cysteine residue. This produces trastuzumab molecules with a unique thiol at position 442 of the heavy chain within the Fc portion for conjugation. Such mutants may be referred to as trastuzumab S442C or tras(S442C)
[0213] Two of the novel PNU payloads were conjugated to this molecule via the engineered cysteine using methods as described above to give the corresponding conjugates in good overall yield. Table 8 below outlines the properties of these conjugates.
TABLE-US-00015 TABLE 8 Analysis of tras(S442C)-PNU conjugates. HC deglycosylated reduced mass, Da DAR by Yield HMW agg Payload Expected Observed MS % % MA-PEG4-vc-PAB- 50575 50578.1 1.02 27 8.2 EDA-PNU159682 MA-PEG4-va-EDA- 50339.7 50342.6 1.02 45 4.6 PNU159682
[0214] Furthermore, potency of the tras(S442C)-PNU conjugates in killing HER2 positive cells lines was investigated.
Example 4: VNAR-PNU Conjugates
[0215] Multimeric and bi-paratopic VNAR constructs were generated with a C-terminal his myc tag containing an engineered cysteine for site specific labelling. Proteins were treated with 2 mM TCEP and purified by (MAC.
[0216] Binding kinetics for binding of the multimeric VNAR proteins to ROR1-hFc or ROR2-hFc fusion proteins (extracelluar domains) were determined using a Pioneer Surface Plasmon Resonance (SPR) instrument (SensiQ/Pall ForteBio) or the Biolayer Interferometry (BLI) Octet K2 system (ForteBio) as previously described.
TABLE-US-00016 TABLE 9 SPR data for binding of multimeric VNARs to human ROR1 and human ROR2 hROR1 Molecule Ka (M.sup.−1s.sup.−1) Kd (s.sup.−1) KD (nM) hROR2 BA11-B1-D3 1.44E+05 <1.0E−07 <0.05 No (WbG4S) binding P3A1-BA11-D3 1.28E+05 3.23E−04 2.53 No (WbG4SGM) binding P3A1-BA11-D3 2.50+05 2.25−04 0.90 No ([G4S]5) binding 2V-BA11-2V No binding No binding No binding No (WbG4SGM) binding
[0217] Conjugations were performed using 4 equivalents of PNU, room temperature for 1 hour and purified by SEC. Final conjugates analysed by analytical HIC, analytical SEC, and LC-MS.
TABLE-US-00017 TABLE 10 Characterisation of multimeric and bi-paratopic conjugates. Conjugate HMW Mass, Da DAR Yield Aggregates Protein Payload Expected Observed HIC UV % % BA11-B1-D3 MA-PEG4-vc-PAB-EDA-PNU159682 43,026 43,046.2 1 0.60 23 4.8 (WbG4S) MA-PEG4-va-EDA-PNU159682 42,791 42,793.2 1 1.03 34 4.1 P3A1-BA11-D3 MA-PEG4-vc-PAB-EDA-PNU159682 41,821 41,821.1 0.88 0.61 34 2.1 (WbG4SGM) MA-PEG4-va-EDA-PNU159682 41,586 41,585.7 0.9 0.80 49 3.8 P3A1-BA11-D3 MA-PEG4-vc-PAB-EDA-PNU159682 42,982 42,980.6 1 0.66 22 15.1 ([G4S]5) MA-PEG4-va-EDA-PNU159682 42,747 42,744.1 1 0.60 32 9 2V-BA11-2V MA-PEG4-vc-PAB-EDA-PNU159682 42,601 42,602.4 0.9-1 0.62 40 6.3 (WbG4SGM) MA-PEG4-va-EDA-PNU159682 42,366 42,367.2 0.89-1 0.73 45 6.6
[0218] The linkers between the VNAR domains are (G.sub.4S).sub.5 [denoted by([G4S]5]; PGVQPSPGGGGS [denoted by (WbG4S)] (SEQ ID NO: 50); PGVQPAPGGGGS [denoted by (WbG4SGM)] (SEQ ID NO: 51).
[0219] Payloads were conjugated to the unique free thiol introduced at the C-terminal region of the protein through incorporation of a C-terminal his myc tag containing an engineered cysteine (sequence either QACKAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 52) or QACGAHHHHHHGAEFEQKLISEEDL (SEQ ID NO: 53)).
[0220] Binding of the multimeric conjugates to the surface of ROR1.sup.hi A549 lung adenocarcinoma cells was assessed by flow cytometry. Adherent human cancer cells were detached from tissue culture flasks by incubating with 0.1% EDTA/PBS solution at 37° C. for .sup.˜10 minutes or until cells detached easily. Cells were re-suspended in 5 ml ice-cold PBS/2% FCS in 15 ml tubes and centrifuged at 1500 rpm for 5 mins at 4′C. Supernatant was removed and the cell pellet re-suspended in 1-2 ml of PBS/2% FCS. A cell count was performed using a Z1 Coulter Particle Counter (Beckman Coulter) and 5×10{circumflex over ( )}5 cells were aliquoted per test sample into a 96 well plate. Cells were incubated with 100 μl of the VNAR (His6Myc tagged) or corresponding VNAR conjugates at the indicated concentrations, plus controls for 1 hour on ice. The sample plate was centrifuged at 2000 rpm for 5 mins. The supernatant was removed and a wash performed by re-suspending the cell pellets in 0.25 mL of ice-cold PBS/2% FCS using a multichannel pipette. Samples were again centrifuged at 2000 rpm for 5 min at 4° C. Supernatant was removed and two further washes performed as described. After the final wash and centrifugation step, excess liquid was removed by blotting the plate on tissue paper. 100 μl of anti-×6His tag Ab (Abcam) was added per cell pellet as appropriate to bind to the VNAR (His6Myc tagged) or corresponding VNAR conjugates and incubated on ice for 30 mins. Wash steps were performed as described previously. PE-anti-mouse antibody (JIR) was used to detect binding of the VNAR (His6Myc tagged) and corresponding VNAR conjugates by incubating with the appropriate samples for 30 min on ice in the dark. Wash steps were performed as described previously. Cell pellets were re-suspended in 0.3 ml of ice-cold PBS/2% FCS and left on ice in the dark prior to analysis on a Merck-Millipore Guava EasyCyte HT flow cytometer.
[0221]
Example 5: Cathepsin B Treatment of Protein-PNU Conjugates
[0222] Cathepsin B treatment of VNAR-hFc-vc-PAB-EDA-PNU conjugates and the corresponding conjugates of the multimeric proteins liberated free EDA-PNU159682 derivative in a quantitative fashion. Whereas, VNAR-hFc-va-EDA-PNU conjugates and the corresponding conjugates of the multimeric proteins were completely stable to Cathepsin B treatment.
TABLE-US-00018 TABLE 11 Payload release after treatment with Cat B Conc of Theoretical Average protein conc of Conc EDA Conjugate and DAR payload (uM) Released (uM) B1hFc(S239C)-vc-PAB- 10 uM 21.0 21.3 EDA-PNU DAR 2.1 B1hFc(S239C)-va-EDA- 10 uM 20.0 <LLOQ PNU DAR 2.0 2VhFc(S239C)-vc_PAB- 5 uM 10.5 11.8 EDA-PNU DAR 2.1 P3A1hFc(S239C)-vc-PAB- 10 uM 22.0 20.1 EDA-PNU DAR 2.2 P3A1hFc(S239C)-va-EDA- 10 uM 21.0 0.36 (1.7%) PNU DAR 2.1
[0223] Only the vc-PAB-EDA-PNU releases payload on treatment with CatB as expected for the conditions used in this in vitro assay. The release is quantitative—as the conjugates have a drug to antibody ratio of 2, then twice the concentration of payload released versus the concentration of conjugate is expected after CatB treatment. This expectation matches the data shown in Table 11 for vc-PAB-EDA-PNU conjugates.
Example 6: Plasma Stability of Protein-PNU Conjugates
[0224] Different P3A1-hFc-PNU conjugates were incubated at 37° C. in mouse plasma at a final concentration of 4 μM of protein. Samples were analysed by LC-MS as a function of time and the amount of released PNU159682 and EDA-PNU159682 derivative was quantified by reference to calibration standards.
TABLE-US-00019 TABLE 12 Stability of protein-PNU conjugates after incubation in mouse plasma Concentration (nM) of free PNU payload detected by LC-MS Conjugate 4 h 24 h 48 h 72 h 96 h 120 h P3A1hFc-vc-PAB-DMAE-PNU159682 13 68 121 145 170 217 P3A1-hFc-vc-PAB-EDA-PNU159682 21 84 108 107 101 114 P3A1-hFc-va-EDA-PNU159682 3 4 1 2 5 3
[0225] As shown in Table 12, conjugates with the va-EDA-PNU159682 payload showed excellent mouse plasma stability with little to none PNU derivatives released with time. For both the vc-PAB-DMAE-PNU and vc-PAB-EDA-PNU conjugates liberation of some free payload could be detected as a function of time, with 217 nM PNU159682 and 114 nM of EDA-PNU159682 derivative detected after 120 h respectively. Note, in a parallel study, we calculated the mouse plasma half-lives of the free PNU159682 and EDA-PNU159682 derivatives to be 33 h and 116 h respectively. Indicating that the absolute amount of free PNU payload released for the vc-PAB-DMAE-PNU conjugate is underestimated with respect to the vc-PAB-EDA-PNU conjugate.
[0226] Different conjugates were incubated at 37° C. for 168 h in human plasma at a final concentration of 4 μM or 2 μM of protein. Samples were analysed by LC-MS as a function of time up to and including 168 h and the amount of released PNU159682 and EDA-PNU159682 derivative was quantified by reference to calibration standards.
TABLE-US-00020 TABLE 13 Stability of protein-PNU conjugates after incubation in human plasma Maximum theoretical Concentration PDC payload release of PDC(uM) DAR (uM) Observed EDA payload release P3A1-hFc(S239c)-vc- 4 2.2 8.8 EDA-PNU not detected above LLOQ PAB-EDA-PNU LLOQ = 0.156 uM (1.8% of maximal payload release) P3A1-hFc(S239c)-va- 4 2.1 8.4 no EDA-PNU detected at any time points EDA-PNU LLOQ = 0.156 uM (1.9% of maximal payload release) B1h-Fc(S239C)- 4 2.1 8.4 EDA-PNU not detected above LLOQ vcPAB-EDA-PNU LLOQ = 0.1 uM (1.2% of maximal payload release) B1-hFc(S239C)-va- 4 2.0 8.0 EDA-PNU not detected above LLOQ EDA-PNU LLOQ = 0.156 uM (1.95% of maximal payload release) P3A1-hFc(442)-va- 2 1.4 2.8 No EDA-PNU detected at any time points EDA-PNU LLOQ = 0.1 uM (3.57% of maximal payload release)
[0227] As shown in Table 13, conjugates showed excellent human plasma stability with no detectable amounts of PNU derivatives released over the timecourse of the experiment. The half-life of EDA-PNU in human plasma is 172.25h (average of 4 different experiments).
Example 7: In Viva Efficacy of Protein-Drug Conjugates in a Patient-Derived Xenograft Model of Pleural Mesothelioma
[0228] An efficacy study in the ROR1+PXF-1118 patient-derived pleural mesothelioma xenograft model was performed by Charles River Laboratories (Freiburg).
[0229] Tumour fragments obtained from xenografts in serial passage in nude mice were implanted subcutaneously into female NMRI nu/nu mice (CrI:NMRI-Foxn1.sup.nu). Mice were monitored until the tumour implants reached the study volume recruitment criteria of 50-250 mm.sup.3, preferably 150-200 mm.sup.3 in a sufficient number of animals. Mice were randomised to treatment groups such that there was no statistical difference between tumour volumes in each group. Randomisation was designated as Day 0 of the experiment. Mice were treated with vehicle or with the protein-drug conjugates B1-hFc-vc-PAB-EDA-PNU or B1-hFc-va-EDA-PNU at 0.3 mg/kg by i.v. injection on days 1, 4, 7, 10, 18. All mice received single-dose priming with mouse IgG, administered intravenously (i.v.) at 29 mg/kg 20 hours ahead of the first PDC dose.
[0230] The absolute tumour volumes (ATVs) were determined by two-dimensional measurement with a digital caliper on the day of randomisation and then three times a week. Tumour volumes were calculated according to the formula:
Tumour volume=(L×W.sup.2)×0.5
where L=largest diameter and W=width (perpendicular diameter) of the tumour (in mm).
[0231] Animals were routinely weighed three times a week, and on days when doses were administered. Mice were observed and documented daily for changes in physical appearance, behaviour and adverse clinical signs and general welfare in line with local and best veterinary practice guidelines.
[0232]
Example 8: In Vivo Efficacy of Protein-Drug Conjugates in Patient-Derived Xenograft Model of Triple Negative Breast Cancer (TNBC)
[0233] An efficacy study in the ROR1+HBCx-28 patient-derived TNBC xenograft model was performed by XenTech (Paris).
[0234] Outbred athymic (nu/nu) female mice (HSD: Athymic Nude-Foxn1.sup.nu) were implanted subcutaneously with tumours of the same in vivo passage. Mice were monitored until the tumour implants reached the study volume recruitment criteria of 60-200 mm.sup.3, preferably 75-196 mm.sup.3 in a sufficient number of animals. Mice were randomised to treatment groups such that there was no statistical difference between tumour volumes in each group. Randomisation was designated as Day 0 of the experiment. Mice were treated with vehicle or with the protein-drug conjugates B1-hFc-vc-PAB-EDA-PNU or B1-hFc-va-EDA-PNU at 0.3 mg/kg by i.v. injection on days 2, 5, 8, 12, 15 with all mice pre-primed with mouse IgG 20h before first PDC dose. Tumour volume was evaluated by measuring perpendicular tumour diameters, with a caliper, three times a week during the experimental period until D55, then measured and weighed twice a week until the end of the experiment (i.e. Day 103). Absolute tumour volume (ATV) was calculated using the formula TV (mm.sup.3)=[length (mm)×width (mm).sup.2]×0.5, where the length and the width are the longest and the shortest perpendicular diameters of the tumour measured perpendicularly, respectively. All animals were weighed at the same time as tumour size measurement. Mice were observed and documented daily for changes in physical appearance, behaviour, adverse clinical signs and general welfare in line with local welfare and best veterinary practice guidelines.
[0235]