USE OF INTEGRIN INHIBITORS FOR TREATMENT OR PREVENTION OF A NEUROLOGICAL IMMUNITY DISORDER AND/OR NERVOUS SYSTEM INJURY
20220119532 · 2022-04-21
Inventors
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/2842
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
Abstract
Methods of treating, preventing, inhibiting, delaying the onset of, or ameliorating a neurological immunity disorder can include administering an effective amount of a compound comprising an antibody or antigen binding fragment of an antibody to a subject in need of treatment, prevention, inhibition, delay of onset, or amelioration of a neurological immunity disorder and/or nervous system injury. The antibody or the antigen binding fragment of an antibody binds specifically to CD49a.
Claims
1. A method of reducing neuron death, comprising contacting a neural tissue with an effective amount of a compound that inhibits integrin signaling, wherein the compound decreases CD49a function.
2. The method of claim 1, wherein the compound reduces neuron death by at least about 10%.
3.-4. (canceled)
5. The method of claim 1, wherein the compound is an antibody or antigen binding fragment thereof that specifically binds to CD49a.
6.-7. (canceled)
8. The method of claim 1, wherein the neural tissue is in a subject, further comprising administering the compound to the subject.
9.-10. (canceled)
11. The method of claim 8, wherein the method reduces neuron death in the subject, and wherein the subject has a central nervous system (CNS) injury.
12. (canceled)
13. The method of claim 8, wherein the method is used in a treatment of multiple sclerosis (MS) disease or autism spectrum disorder (ASD).
14. A method of selectively increasing the number of myeloid cells in a neural tissue, comprising contacting the neural tissue with effective amount of a compound that inhibits integrin signaling, wherein the compound decreases CD49a function.
15.-24. (canceled)
25. The method of claim 14, wherein the method has neuroprotective effect in a subject that has a central nervous system (CNS) injury.
26. (canceled)
27. The method of claim 14, wherein the method is used in a treatment of multiple sclerosis (MS) disease or autism spectrum disorder (ASD).
28. A method of selectively modulating gene expression profile in an immune cell within a neural tissue, comprising contacting the neural tissue with an effective amount of a compound that inhibits integrin signaling, wherein the compound decreases CD49a function.
29.-31. (canceled)
32. The method of claim 28, wherein the method increases the expression of a gene that enhances the migration of myeloid cells or neuroprotection.
33. The method of claim 32, wherein the method increases the expression of a gene selected from the group consisting of Cxcl2, Ccl3, Ccl4, Cxcl16, Ccr2, Spp1, Arg1, Trem2, and Tgfbi.
34. The method of claim 33, wherein the method increases the expression of the gene by at least about 10%.
35. The method of claim 28, wherein the method decreases the expression of a gene selected from the group consisting of Ccl24, Ccl7, Ccl12, and Ccl8.
36.-37. (canceled)
38. The method of claim 28, wherein the compound is an antibody or antigen binding fragment thereof that specifically binds to CD49a.
39.-40. (canceled)
41. The method of claim 28, wherein the neural tissue is in a subject, further comprising administering the compound to the subject.
42. The method of claim 41, wherein the administration of the compound is selected from the group consisting of intracerebroventricular administration, intra cisterna magna administration, dermal application to the scalp skin of the subject, subcutaneous administration, intravenous administration, intramuscular administration, intra-articular administration, intra-synovial administration, intrasternal administration, intrathecal administration, intrahepatic administration, intralesional administration, intracranial administration, intraocular administration, intraperitoneal administration, trans dermal administration, buccal administration, sublingual administration, topical administration, local injection, and surgical implantation.
43. (canceled)
44. The method of claim 41, wherein the method reduces neuron death in a subject that has a central nervous system (CNS) injury.
45. (canceled)
46. The method of claim 41, wherein the method is used in a treatment of multiple sclerosis (MS) disease or autism spectrum disorder (ASD).
47.-48. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0037]
[0038]
[0039]
[0040] (AQP4≥green). Greater levels of CD45 staining (infiltrating immune cells) were observed in the brain parenchyma CD49a-treated mice compared to the IgG-treated control mice at 48 hours, and even greater levels of CD45 staining were observed in the CD49a-treated mice at 72 hours.
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
DETAILED DESCRIPTION
[0056] Some embodiments provide methods of treating or preventing a neurological immunity disorder in an animal subject, comprising administering to the subject a therapeutically effective amount of a compound that inhibits integrin signaling. Some embodiments provide methods of treating or preventing a neurological immunity disorder in an animal subject, comprising administering to the subject a therapeutically effective amount of a compound that decreases CD49a function. Some embodiments provide method of treating a neurological immunity disorder in an animal subject, comprising administering to the subject a therapeutically effective amount of an antibody or antigen binding fragment which binds CD49a, for example a human or humanized antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the antibody or antigen binding fragment thereof does not bind specifically to any of CD49b, CD49c, CD49d, CD49e, and/or CD49f, including combinations of two or more of these. In some embodiments, the compound blocks integrin signaling. It is noted that wherever a method of treating a disease or disorder with a composition is described herein, the corresponding use of the composition for the treatment of the disease or disorder is also expressly contemplated. For example, wherever a method of treating a neurological immunity disorder with an antibody or antigen binding fragment that binds to CD49a is described herein, an antibody or antigen binding fragment that binds to CD49a for use in treating the neurological immunity disorder is also expressly contemplated.
[0057] It is to be understood that the embodiments described herein are not limited to specific analytical or synthetic methods as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this disclosure belongs, in view of the present disclosure.
[0058] “Neurological immunity disorders” is used herein according to its customary and ordinary meaning as would be understood by one of ordinary skill in the art in view of the specification, and encompasses neurological disorders with an immune component, for example, MS, Central Nervous System (CNS) injury, AD, and ASD. In some embodiments, the neurological immunity disorder comprises, consists essentially of, or consists of AD.
[0059] The terms “treatment,” “treating,” and the like have their customary and ordinary meaning as understood by one of skill in the art in view of this disclosure. They generally refer to obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease. “Treatment” as used herein has is customary and ordinary meaning as understood by one of skill in the art in view of this disclosure, and encompasses any treatment of a disease or symptom in a mammal, and includes any one or more of the following: (a) preventing the disease or a symptom from occurring in a subject which may be predisposed to acquiring the disease or symptom but has not yet been diagnosed as having it; (b) inhibiting the disease or a symptom, e.g., arresting or slowing its development; (c) relieving the disease, e.g., causing regression of the disease; (d) ameliorating one or more symptoms of the disease; (e) delaying the onset of the disease; and (e) reducing the likelihood of occurrence of the disease . The therapeutic agent (such as an anti-CD49a antibody or binding fragment thereof) may be administered before, during or after the onset of disease or injury. The treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues. The subject therapy will desirably be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
[0060] As used herein, the term “integrin” has its customary and ordinary meaning as understood by one of skill in the art in view of this disclosure. It refers to proteins that are transmembrane receptors that function to facilitate cell-cell and cell-extracellular matrix interactions. Examples of integrins and integrin subunits expressed in the meninges include CD49a, LFA1, itga11, CD49e, itga8, CD51, CD49f, and itga9.
[0061] As used herein, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictates otherwise. Thus, for example, reference to “a reagent” is reference to one or more reagents and includes equivalents thereof known to those skilled in the art. Additionally, the term “comprises” is intended to include embodiments where the method, apparatus, composition, etc., consists essentially of and/or consists of the listed steps, components, etc. Similarly, the term “consists essentially of” is intended to include embodiments where the method, apparatus, composition, etc., consists of the listed steps, components, etc. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only,” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.
[0062] As used herein, the term “about” is used herein to provide literal support for the exact number that it precedes, as well as a number that differs from the given number without having a substantial effect in the context. If more numerical precision is desired, “about” refers to values that differ by less than±10%. In some embodiments, the term “about” indicates that the number differs from the given number by less than ±9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1%.
[0063] It is appreciated that certain features described herein, which are, for clarity, described separately and/or in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of embodiments herein, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. All combinations of the embodiments described herein are specifically embraced by the present disclosure and are disclosed herein just as if each and every combination was individually and explicitly disclosed. In addition, all sub-combinations of the various embodiments and elements thereof are also specifically embraced by the present disclosure and are disclosed herein just as if each and every such sub-combination was individually and explicitly disclosed herein.
[0064] In some embodiments, a method of treating, preventing, inhibiting, reducing the likelihood of, and/or delaying the onset of a neurological immunity disorder (such as AD) and/or a nervous system injury (such as CNS injury) in an animal subject is described. The method can comprise administering to the subject a therapeutically effective amount of a compound that inhibits integrin signaling. The compound can comprise, consist essentially of, or consist of an inhibitor of CD49a, for example an antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the antibody or antigen binding fragment thereof that binds specifically to CD49a is a monoclonal antibody. In some embodiments, the neurological immunity disorder is selected from the group autism spectrum disorder (ASD), multiple sclerosis (MS), Alzheimer's disease (AD), and nervous system injury (such as central nervous system (CNS) injury). In some embodiments, the method comprises treating or preventing the neurological immunity disorder, for example, ASD, MS, AD, and/or CNS injury. In some embodiments, the animal subject is a human. In some embodiments, the compound is formulated for administration to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is administered to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is not administered outside the CNS. In some embodiments, the is method for treating, preventing, inhibiting, reducing the likelihood of, and/or delaying the onset of AD and/or a nervous system injury in the animal subject. In some embodiments, the method is for treating, preventing, inhibiting, reducing the likelihood of, and/or delaying the onset of AD in the animal subject. In some embodiments, the method is for treating, preventing, inhibiting, reducing the likelihood of, and/or delaying the onset of nervous system injury (such as CNS injury) in the animal subject. Example nervous system injuries can comprise, consist essentially of, or consist of a traumatic injury (such as nerve crush) and/or injury by a chemical agent such as a drug or toxin. In some embodiments, the nervous system injury comprises, consists essentially of or consists of a traumatic injury (such as nerve crush).
[0065] In some embodiments, the method treats prevents, inhibits, reduces the likelihood of, and/or delays the onset of a neurological immunity disorder in a human subject. In some embodiments, the method comprises administering to the subject a therapeutically effective amount of a compound that inhibits CD49a signaling. In some embodiments, the compound comprises, consists essentially of, or consists of an antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the compound comprises, consists essentially of, or consists of a monoclonal antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the neurological immunity disorder is selected from the group consisting of ASD, MS, AD, and CNS injury. In some embodiments, the method comprises treating or preventing the neurological immunity disorder. In some embodiments, the compound is formulated for administration to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is administered to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is not administered outside the CNS.
[0066] In some embodiments, the method treats, prevents, inhibits, reduces the likelihood of, and/or delays the onset of ASD in a human subject. In some embodiments, the method comprises administering to the subject a therapeutically effective amount of a compound that inhibits CD49a signaling. In some embodiments, the compound comprises, consists essentially of, or consists of an antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the compound comprises, consists essentially of, or consists of a monoclonal antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the antibody, e.g., monoclonal antibody or antigen binding fragment thereof does not specifically bind to any of CD49b, CD49c, CD49d, Cd49e, and/or CD49f. In some embodiments, the method comprises treating or preventing the ASD. In some embodiments, the compound is formulated for administration to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is administered to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is not administered outside the CNS.
[0067] In some embodiments, the method treats, prevents, inhibits, reduces the likelihood of, and/or delays the onset of MS in a human subject. In some embodiments, the method comprises administering to the subject a therapeutically effective amount of a compound that inhibits CD49a signaling. In some embodiments, the compound comprises, consists essentially of, or consists of an antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the compound comprises, consists essentially of, or consists of a monoclonal antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the antibody, e.g., monoclonal antibody or antigen binding fragment thereof does not bind to any of CD49b, CD49c, CD49d, Cd49e, and/or CD49f. In some embodiments, the method comprises treating or preventing the MS. As shown in Example 4, 5, and 7 and
[0068] In some embodiments, the method treats, prevents, inhibits, reduces the likelihood of, and/or delays the onset of AD in a human subject. The method can comprise administering to the subject a therapeutically effective amount of a compound that inhibits CD49a signaling. The compound can comprise, consist essentially of, or consist of an antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the compound comprises, consists essentially of, or consists of a monoclonal antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the antibody, e.g., monoclonal antibody or antigen binding fragment thereof does not bind to any of CD49b, CD49c, CD49d, Cd49e, and/or CD49f. In some embodiments, the method comprises treating or preventing the AD. In some embodiments, the compound is formulated for administration to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is administered to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is not administered outside the CNS.
[0069] In some embodiments, the method treats, prevents, inhibits, and/or delays the onset of nervous system injury, for example CNS injury in a human subject. The method can comprise administering to the subject a therapeutically effective amount of a compound that inhibits CD49a signaling. The compound can comprise, consist essentially of, or consist of an antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the compound comprises, consists essentially of, or consists of a monoclonal antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the antibody, e.g., monoclonal antibody or antigen binding fragment thereof does not bind to any of CD49b, CD49c, CD49d, Cd49e, and/or CD49f. In some embodiments, the method comprises treating or preventing the nervous system injury (such as
[0070] CNS injury). In some embodiments, the compound is formulated for administration to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is administered to the CNS of the subject, for example intracerebroventricular administration. In some embodiments, the compound is not administered outside the CNS.
[0071] In the method or use of some embodiments, the compound that inhibits integrin signaling is administered after the onset of the neurological immunity disorder (such as AD) and/or nervous system injury (such as CNS injury), for example at least about 8 days after the onset of the neurological immunity disorder, for example at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 days, including any ranges between any two of the listed values, for example, including but not limited to the following ranges which are provided for exemplary purposes only: 5-28 days, 5-21 days, 5-14 days, 5-7 days, 7-28 days, 7-21 days, 7-14 days, 10-28 days, 10-21 days, or 10-14 days. In the method or use of some embodiments, the administration of the compound after the onset of the neurological immunity disorder and/or nervous system injury reduces clinical symptoms of the neurological immunity disorder (such as AD) and/or nervous system injury, which can be measured, for example, by a clinical score. In the method or use of some embodiments, the compound that inhibits integrin signaling comprises, consists essentially of, or consists of an antibody or antigen binding fragment thereof that binds specifically to CD49a. In the method or use of some embodiments, the compound that inhibits integrin signaling comprises, consists essentially of, or consists of a CD49a inhibiting (or blocking) antibody.
[0072] In the method or use of some embodiments, the method further comprises identifying a subject in need of said treatment. In further embodiments, the subject in need of said treatment is susceptible to or suffering form a neurological immunity disorder selected from the group consisting of autism spectrum disorder (ASD), multiple sclerosis (MS), Alzheimer's disease (AD), and central nervous system (CNS) injury. Identification of such subjects may be made using techniques known to a person of ordinary skill in the art. In some embodiments, the subject in need of said treatment is susceptible to or suffering from AD and/or nervous system injury (such as CNS injury). In some embodiments, the subject in need of said treatment is susceptible to or suffering from nervous system injury (such as CNS injury). In some embodiments, the subject in need of said treatment is susceptible to or suffering from AD.
[0073] The term “subject” is used herein according to its customary and ordinary meaning as would be understood by one of ordinary skill in the art in view of the specification. It refers to an animal, for example a mammal, such as a human. In the method or use of some embodiments, the animal subject is a human.
[0074] In the method or use of some embodiments, inhibiting (or blocking) integrin signaling includes decreasing function of an integrin and/or decreasing function of an integrin subunit such as CD49a. In the method or use of some embodiments, the compound that inhibits integrin signaling decreases the function of a protein selected from the list consisting of CD49a, LFA1, itga11, CD49e, itga8, CD51, CD49f, and itga9. In the method or use of some embodiments, the compound that inhibits integrin signaling decreases CD49a function. In the method or use of some embodiments, the compound binds specifically to CD49a.
[0075] In the method or use of some embodiments, the compound that inhibits integrin signaling is an antibody or an antigen binding fragment which binds to an integrin or an integrin subunit. In some embodiments, the antibody or the antigen binding fragment binds a protein selected from the list consisting of CD49a, LFA1, itga11, CD49e, itga8, CD51, CD49f, and itga9. In some embodiments, the antibody or the antigen binding fragment binds to CD49a. In some embodiments, the antibody or the antigen binding fragment specifically binds a protein selected from the list consisting of CD49a, LFA1, itgal 1, CD49e, itga8, CD51, CD49f, and itga9. In some embodiments, the antibody or the antigen binding fragment specifically binds CD49a. In some embodiments, the antibody or the antigen binding fragments is a monoclonal antibody, for example a humanized antibody or human antibody.
[0076] An antibody (interchangeably used in plural form) is used herein according to its customary and ordinary meaning as would be understood by one of ordinary skill in the art in view of the specification. It refers to an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, which is typically located in the variable region of the immunoglobulin molecule. As used herein, the term “antibody”, e.g., anti-CD49a antibody, encompasses not only intact (e.g., full-length) polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof (such as Fab, Fab′, F(ab′)2, Fv), single chain (scFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, nanobodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies. An antibody, e.g., anti-CD49a antibody in accordance with methods, uses, compositions, and pharmaceutical compositions of some embodiments herein, includes an antibody of any class, such as IgD, IgE, IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class. Depending on the antibody amino acid sequence of the constant domain of its heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
[0077] The base structure of an antibody is a tetramer, which includes two heavy chains and two light chains. Each chain comprises a constant region, and a variable region. Generally, the variable region, heavy chain variable region (V.sub.H) and a light chain variable region (V.sub.L), is responsible for binding specificity of the antibody. In a typical antibody, each variable region comprises three complementarity determining regions (CDRs) flanked by four framework (FR) regions. As such, an typical antibody variable region has six CDRs (three heavy chain CDRs, three light chain CDRs), some or all of which are generally involved in binding interactions by the antibody. Each V.sub.H and V.sub.L comprises three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The framework regions and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat defmition, the Chothia definition, the AbM defmition, and/or the contact defmition, all of which are well known in the art. See, e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17:132-143 (2004). See also hgmp.mrc.ac.uk and bioinforg.uk/abs).
[0078] The anti-CD49a antibody suitable for methods, uses, compositions, and pharmaceutical compositions of embodiments described herein may be a full-length antibody, which contains two heavy chains and two light chains, each including a variable domain and a constant domain. Alternatively, the anti-CD49a antibody can be an antigen-binding fragment of a full-length antibody. Examples of binding fragments encompassed within the term “antigen-binding fragment” of a full length antibody include (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; (ii) a F(ab′).sub.2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V.sub.H and C.sub.H1 domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V.sub.H domain; and (vi) an isolated complementarity determining region (CDR) that retains functionality. Furthermore, although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules known as single chain Fv (scFv). See e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883.
[0079] Anti-CD49a antibodies and methods for producing them are known in the art. For example, US20160017043 provides antibody sequences for anti-CD49a antibodies, which publication is incorporated by reference in its entirety herein, including the drawings and the sequence listing therein. In some embodiments, the anti-CD49a antibody comprises a V.sub.L domain of the V.sub.L domain shown in
[0080] In some embodiments, the anti-CD49a antibody comprises a V.sub.L domain that has at least 80%, at least 85%, at least 90% (e.g., 91%, 92%, 93%, 94%), at least 95% (e.g., 96%, 97%, 98%, 99%, 100%) sequence identity with the V.sub.L domain shown in
[0081] US20160017043 and a V.sub.H domain that has at least 80%, at least 85%, at least 90% (e.g., 91%, 92%, 93%, 94%), at least 95% (e.g., 96%, 97%, 98%, 99%, 100%) sequence identity with the V.sub.H domain shown in
[0082] A number of approaches are available for producing suitable antibodies that specifically bind to CD49a in accordance with methods, uses, compositions, and pharmaceutical compositions of embodiments herein. For example, in some embodiments, a host organism is immunized with an antigen comprising, consisting essentially of, or consisting of CD49a. By way of example, a sequence of CD49a (which may also be referred to as Integrin alpha-1 or VLA-1) is available as Uniprot accession no. P56199 (SEQ ID NO: 1 MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYE NEEGKWVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKEN MTFGSTLVTNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQ LDIVIVLDGSNSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYS STEEVLVAAKKIVQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGES HDNHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSD ELALVTIVKTLGERIFALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYD WNGTVVMQKASQIIIPRNTTFNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPR YNHTGQVIIYRMEDGNIKILQTLS GEQIGSYFGSILTTTDIDKDSNTDILLVGAPMYMG TEKEEQGKVYVYALNQTRFEYQMSLEPIKQTCCSSRQHNSCTTENKNEPCGARFGTA IAAVKDLNLDGFNDIVIGAPLEDDHGGAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKF FGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVKVTMNFEPNKVNIQKKNC HMEGKETVCINATVCFDVKLKSKEDTIYEADLQYRVTLDSLRQISRSFFSGTQERKVQ RNITVRKSECTKHSFYMLDKHDFQDSVRITLDFNLTDPENGPVLDDSLPNSVHEYIPF AKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFNVSLTVKNTKDSAYNTRTIVHY SPNLVFS GIEAIQKDSCESNHNITCKVGYPFLRRGEMVTFKILFQFNTSYLMENVTIYL SATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYHISIAANETVPEVINSTEDIG NEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSI NSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSL NLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRVPLWVILLSAFAGLLLLMLLIL ALWKIGFFKRPLKKKMEK). By way of example, a polypeptide comprising, consisting essentially of, or consisting of the amino acid sequence of SEQ ID NO: 1 sequence can be used to immunize a host in order to produce antibodies that bind specifically to CD49a in accordance with some embodiments. The host organism can be a non-human mammal such as a mouse, rat, guinea pig, rabbit, donkey, goat, or sheep. Isolated antibody-producing cells can be obtained from the host organism, and the cells (or antibody-encoding nucleic acids thereof) can be screened for antibodies that binds specifically to CD49a. In some embodiments, antibody-producing cells are immortalized using hybridoma technology, and the resultant hybridomas are screened for antibodies that bind specifically to CD49a. In some embodiments, antibody-encoding nucleic acids are isolated from antibody-producing cells, and screened for antibodies that bind specifically to CD49a. An example protocol for screening human B cell nucleic acids is described in Huse et al., Science 246:1275-1281 (1989), which is hereby incorporated by reference in its entirety. In some embodiments, nucleic acids of interest are identified using phage display technology (See, e.g., Dower et al., WO 91/17271 and McCafferty et al., WO 92/01047, each of which is hereby incorporated by reference in its entirety). Phage display technology can also be used to mutagenize variable regions (or portions thereof such as CDRs) of antibodies previously shown to have affmity for CD49a. Variant antibodies can then be screened by phage display for antibodies having desired affmity to CD49a. In some embodiments, the antibody that specifically binds to CD49a is formatted as an antigen binding fragment. Example antigen binding fragments suitable for methods, uses, compositions, and pharmaceutical compositions of some embodiments can comprise, consist essentially of, or consist of a construct selected from the group consisting of Fab, Fab′, Fab′-SH, F(ab′).sub.2, and Fv fragments; minibodies; diabodies; and single-chain fragments such as single-chain Fv (scFv) molecules. Bispecific or multispecific antibodies or antigen binding fragments are also contemplated in accordance with methods, uses, compositions, and pharmaceutical compositions of some embodiments.
[0083] In some embodiments, for example if human monoclonal antibodies are of interest, the host comprises genetic modifications to produce or facilitate the production of human immunoglobulins. For example, XenoMouseTM mice were engineered with fragments of the human heavy chain locus and kappa light chain locus, respectively, which contained core variable and constant region sequences (described in detail Green et al. Nature Genetics 7:13-21 (1994), which is hereby incorporated by reference in its entirety). For example, mice have been engineered to produce antibodies comprising a human variable regions and mouse constant regions. The human heavy chain and light chain variable regions can then be reformatted onto a human constant region to provide a fully human antibody (described in detail in U.S. Pat. No. 6,787,637, which is hereby incorporated by reference in its entirety), For example, in a “minilocus” approach, an exogenous Ig locus is mimicked through the inclusion of pieces (individual genes) from the Ig locus. Thus, one or more VH genes, one or more DH genes, one or more JH genes, a mu constant region, and a second constant region (preferably a gamma constant region) are formed into a construct for insertion into an animal such as a mouse (See, e.g,. U.S. Pat. No. 5,545,807, which is hereby incorporated by reference in its entirety). Another approach, includes reconstituting SCID mice with human lymphatic cells, e.g., B and/or T cells. The mice are then immunized with an antigen and can generate an immune response against the antigen (See, e.g., U.S. Pat. No. 5,476,996, which is hereby incorporated by reference in its entirety).
[0084] In some embodiments, a host monoclonal antibody is formatted as a chimer antibody or is humanized, so that the antibody comprises at least some human sequences. By way of example, By way of example, an approach for producing humanized antibodies can comprise
[0085] CDR grafting. For example, an antigen can be delivered to a non-human host (for example a mouse), so that the host produces antibody against the antigen. In some embodiments, monoclonal antibody is generated using hybridoma technology. In some embodiments, V gene utilization in a single antibody producing cell of the host is determined. The CDR's of the host antibody can be grafted onto a human framework. The V genes utilized in the non-human antibody can be compared to a database of human V genes, and the human V genes with the highest homology can be selected, and incorporated into a human variable region framework. See, e.g., Queen, U.S. Pat. No. 5,585,089, which is hereby incorporated by reference in its entirety.
[0086] Isolated oligonucleotides encoding a antibody of interest can be expressed in an expression system, such as a cellular expression system or a cell-free system in order to produce an antibody that binds specifically to CD49a in accordance with methods, uses, compositions, and pharmaceutical compositions of embodiments herein. Exemplary cellular expression systems include yeast (e.g., mammalian cells such as CHO cells or BHK cells, E. coli, insect cells, Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing the nucleotide sequences encoding antibodies; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing sequences encoding antibodies; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing nucleotide sequences encoding antibodies; mammalian cell systems (e.g., COS, CHO, BHK, 293, 3T3) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses.
[0087] In the method or use of some embodiments, the CD49a inhibiting (or blocking) antibody is administered after the onset of the neurological immunity disorder. In the method or use of some embodiments, the administration of the CD49a inhibiting (or blocking) antibody after the onset of the neurological immunity disorder reduces clinical symptoms of the neurological immunity disorder, which can be measured, for example, by a clinical score.
[0088] In some aspects, the present invention is based upon, at least in part, the surprising discovery that an inhibitor of an integrin, e.g., anti-CD49a antibody, confers neuroprotective effect to a neuron. Accordingly, the present invention provides methods of reducing neuron death in a neural tissue. In certain embodiments, the methods of the present invention reduces neuron death by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or about 99%. It is intended that values and ranges intermediate to the recited values are also intended to be part of this invention.
[0089] In some other aspects, the present invention provides methods of selectively increasing the number of myeloid cells in a neural tissue. In certain embodiments, the methods of the present invention selectively increase myeloid cells in the neural tissue by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 99%, about one fold, about two folds, about four folds, or about ten folds. It is intended that values and ranges intermediate to the recited values are also intended to be part of this invention. In still other aspects, the present invention provides methods of modulating gene expression profile in an immune cell within a neural tissue. In certain embodiments, the methods of the present invention increase the expression of certain genes by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 99%, about one (1) fold, about two (2) fold, about four (4) fold, about ten (10) fold, about twenty (20) fold, about fifty (50) fold, or about one hundred (100) fold. In certain embodiments, the upregulated genes encode cytokines that act as chemoattractant for myeloid cells. In some other embodiments, the upregulated genes encode proteins that have neuroprotective effects. In some embodiments, the genes are selected from the group consisting of Cxcl2, Ccl3, Cc14, Cxcl16, Ccr2, Spp1, Arg1, Trem2, and Tgfbi. In some other embodiments, the methods of the present invention decrease the expression of certain genes by at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or about 99%.
Compositions and Pharmaceutical Compositions
[0090] According to some embodiments, a composition or pharmaceutical composition comprises a compound or therapeutic agent and a pharmaceutically acceptable carrier, adjuvant, or vehicle. In some embodiments, the compound or therapeutic agent of the composition or pharmaceutical composition comprises an agent or compound that inhibits (or blocks) integrin signaling. In some embodiments, the compound or therapeutic agent of the composition or pharmaceutical composition comprises an agent or compound that decreases or inhibits CD49a function. In some embodiments, the compound or therapeutic agent of the composition or pharmaceutical composition comprises an antibody or antigen binding fragment which binds CD49a. In some embodiments, the compound or therapeutic agent of the composition or pharmaceutical composition comprises, consists essentially of, or consists of an antibody or antigen binding fragment thereof that binds specifically to CD49a. The antibody or antigen binding fragment thereof that binds specifically to CD49a can be as described herein. In some embodiments the compound or therapeutic agent of the composition or pharmaceutical composition comprises, consists essentially of, or consists of a monoclonal antibody or antigen binding fragment thereof that binds specifically to CD49a. In some embodiments, the composition or pharmaceutical composition is for use in treating, preventing, inhibiting or ameliorating the relevant disease, disorder, or condition in a subject in need thereof, e.g., neurological immunity disorder or a symptom thereof, such as autism spectrum disorder (ASD), multiple sclerosis (MS), Alzheimer's disease (AD), and/or central nervous system (CNS) injury. In some embodiments, the composition or pharmaceutical composition is for use in treating, preventing, inhibiting or ameliorating AD and/or nervous system injury (such as CNS injury). It is contemplated that a composition or pharmaceutical composition comprising, consisting essentially of, or consisting of compound that decreases or inhibits CD49a (for example, and anti-CD49a antibody as described herein) can be used in any method of treating, preventing, inhibiting or ameliorating the relevant disease, disorder, or condition in a subject in need thereof, e.g., neurological immunity disorder or a symptom thereof, such as autism spectrum disorder (ASD), multiple sclerosis (MS), Alzheimer's disease (AD), and/or central nervous system (CNS) injury as described herein. The amount of therapeutic agent in the composition or pharmaceutical composition of some embodiments is an amount effective to treat, prevent, inhibit or ameliorate the relevant disease, disorder, or condition in a subject in need thereof, e.g., neurological immunity disorder or a symptom thereof, such as autism spectrum disorder (ASD), multiple sclerosis (MS), Alzheimer's disease (AD), and/or central nervous system (CNS) injury. The amount of therapeutic agent in the composition or pharmaceutical composition of some embodiments is an amount effective to treat, prevent, inhibit or ameliorate AD and/or nervous system injury (for example, AD, nervous system injury, or AD or nervous system injury). In some embodiments, a composition or pharmaceutical composition is formulated for administration to a subject in need of such composition. In some embodiments, the composition or pharmaceutical composition is formulated for oral administration to a subject. In some embodiments, the composition or pharmaceutical composition is formulated for injection into a subject. In some embodiments, the composition or pharmaceutical composition is formulated for topical application to the skin of the subject. In some embodiments, the subject is an animal, for example a mammal, such as a human.
[0091] The term “pharmaceutically acceptable carrier,” “adjuvant,” or “vehicle” is used herein according to its customary and ordinary meaning as would be understood by one of ordinary skill in the art in view of the specification. It refers to a non- toxic carrier, adjuvant, or vehicle that does not destroy the pharmacological activity of the compound or therapeutic with which it is formulated. Pharmaceutically acceptable carriers, adjuvants or vehicles that may be used in the compositions and pharmaceutical compositions of some embodiments herein include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.
[0092] In some embodiments, the composition or pharmaceutical composition comprising an anti-CD49a antibody comprises a buffer, such as an acetate, histidine, succinate, or phosphate buffer. The buffer can be at a concentration of about 10 mM to about 50 mM, for example, about 20 mM to about 40 mM, such as about 30 mM. For example, the composition can contain a histidine buffer at a concentration of about 10 mM to about 50 mM, for example, about 20 mM to about 40 mM, such as about 30 mM. In one embodiment, the composition contains an acetate buffer at a concentration of about 10 mM to about 50 mM, for example, about 20 mM to about 40 mM, such as about 30 mM.
[0093] In some embodiments, the composition or pharmaceutical composition comprises an excipient, such as sorbitol, sodium chloride (NaCl), sucrose, trehalose, or mannitol. The composition can include an excipient at a concentration of about 100 mM to about 300 mM, for example, 110 mM to about 270 mM, about 120 mM to about 230 mM, or about 130 mM to about 210 mM, about 170 mM to about 200 mM, or about 180 mM to about 200 mM. For example, the composition can contain sorbitol at a concentration of about 180 mM to about 300 mM, for example, about 200 mM to about 300 mM, about 200 mM to about 240 mM, about 230 mM to about 270 mM, or about 240 mM to about 260 mM. In another example, the composition can contain NaC1 at a concentration of about 100 mM to about 200 mM, for example, about 110 mM to about 190 mM, about 120 mM to about 180 mM, or about 130 mM to about 170 mM. In another example, the composition can contain sucrose at a concentration of about 200 mM to about 240 mM, about 230 mM to about 270 mM, or about 240 mM to about 260 mM. In another example, the composition can contain trehalose at a concentration of about 200 mM to about 240 mM, about 230 mM to about 270 mM, or about 240 mM to about 260 mM. In yet another example, the composition can contain mannitol at a concentration of about 200 mM to about 240 mM, about 230 mM to about 270 mM, or about 240 mM to about 260 mM.
[0094] In some embodiments, the aqueous composition or pharmaceutical composition comprises a surfactant, e.g., a substance that lowers surface tension of a liquid, such as a polysorbate, for example, polysorbate 80 or polysorbate 20. In some embodiments, the concentration of surfactant is at a concentration of about 0.001% to about 0.5%, about 0.001% to about 0.1%, for example, about 0.005% to about 0.05%, such as about 0.01%. Compositions or pharmaceutical compositions of some embodiments herein may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term “parenteral” is used herein according to its customary and ordinary meaning as would be understood by one of ordinary skill in the art in view of the specification. It includes subcutaneous, intravenous, intramuscular, intra- articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques. The compositions may be administered orally, intraperitoneally or intravenously. Sterile injectable forms of the compositions or pharmaceutical compositions of some embodiments herein may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non- toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. In some embodiments, the composition or pharmaceutical composition is administered by an oral, intravenous, subcutaneous, intranasal, inhalation, intramuscular, intraocular, intraperitoneal, intratracheal, transdermal, buccal, sublingual, rectal, topical, local injection, or surgical implantation route. In some embodiments, the administration route is oral. In some embodiments, the administration is via injection. In some embodiments, the administration is via local injection. In some embodiments, the administration of the compound is into the cerebrospinal fluid (CSF) of said subject. In some embodiments, the administration of the compound is via intracerebroventricular injection. In some embodiments, the administration is transdermal, e.g., via application of an ointment containing the therapeutic to the head (scalp skin) of said subject.
[0095] To aid in delivery of the composition or pharmaceutical composition, any bland fixed oil may be employed including synthetic mono- or di-glycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically- acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions. Other commonly used surfactants, such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
[0096] Compositions or pharmaceutical compositions of some embodiments may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers commonly used include lactose and corn starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried cornstarch. When aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
[0097] In some embodiments, compositions or pharmaceutically acceptable compositions may be administered in the form of suppositories for rectal administration. These can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug. Such materials include cocoa butter, beeswax and polyethylene glycols.
[0098] Compositions or pharmaceutical compositions of some embodiments may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, such as the skin (e.g., scalp skin), or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs. Topical application for the lower intestinal tract can be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically-transdermal patches may also be used.
[0099] For topical applications, provided compositions or pharmaceutical compositions of some embodiments may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers. Carriers for topical administration of a therapeutic include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water. Alternatively, provided pharmaceutically acceptable compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers. Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
[0100] Provided compositions or pharmaceutical compositions of some embodiments may be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride. Alternatively, the pharmaceutically acceptable compositions may be formulated in an ointment such as petrolatum.
[0101] Compositions or pharmaceutical compositions of some embodiments may also be administered by nasal aerosol or inhalation. Such compositions are prepared according to techniques well- known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
[0102] In some embodiments, compositions or pharmaceutical compositions are formulated for oral administration. Such formulations may be administered with or without food. In some embodiments, pharmaceutically acceptable compositions are administered without food. In some embodiments, compositions or pharmaceutical compositions of are administered with food.
[0103] The amount of therapeutic that may be combined with the carrier materials to produce a composition or pharmaceutical composition in a single dosage form will vary depending upon the host treated, the particular mode of administration, and other factors known to one of ordinary skill. Preferably, provided compositions should be formulated so that a dosage of between 0.01-100 mg/kg body weight/day of the therapeutic agent can be administered to a patient receiving these compositions.
[0104] It should also be understood that a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the activity of the specific therapeutic employed, the age, body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, and the judgment of the treating physician and the severity of the particular disease being treated. The amount of a therapeutic in the composition will also depend upon the particular therapeutic in the composition.
[0105] Compositions or pharmaceutical compositions of some embodiment comprising a therapeutic and a pharmaceutically acceptable excipient, diluent, or carrier, are useful for treating a variety of diseases, disorders or conditions. Such diseases, disorders, or conditions include those described herein. In the method or use of some embodiments, the therapeutically effective amount of the compound is about 0.0002 mg/kg to about 2.0 mg/kg. In further embodiments, said therapeutically effective amount of the compound is about 0.00020 mg/kg, about 0.00030 mg/kg, about 0.00045 mg/kg, about 0.00060 mg/kg, about 0.00085 mg/kg, about 0.001 mg/kg, about 0.0015 mg/kg, about 0.002 mg/kg, about 0.0025 mg/kg, about 0.003 mg/kg, about 0.0035 mg/kg, about 0.004 mg/kg, about 0.0045 mg/kg, about 0.0050 mg/kg, about 0.0055 mg/kg, about 0.006 mg/kg, about 0.0065 mg/kg, about 0.007 mg/kg, about 0.0075 mg/kg, about 0.008 mg/kg, about 0.0085 mg/kg, about 0.009 mg/kg, about 0.0095 mg/kg, about 0.01 mg/kg, about 0.015 mg/kg, about 0.02 mg/kg, about 0.025 mg/kg, about 0.03 mg/kg, about 0.035 mg/kg, about 0.040 mg/kg, about 0.045 mg/kg, about 0.05 mg/kg, about 0.055 mg/kg, about 0.06 mg/kg, about 0.065 mg/kg, about 0.07 mg/kg, about 0.075 mg/kg, about 0.08 mg/kg, about 0.085 mg/kg, about 0.09 mg/kg, about 0.095 mg/kg, about 0.1 mg/kg, about 0.15 mg/kg, about 0.2 mg/kg, about 0.25 mg/kg, about 0.3 mg/kg, about 0.35 mg/kg, about 0.4 mg/kg, about 0.45 mg/kg, about 0.5 mg/kg, about 0.55 mg/kg, about 0.6 mg/kg, about 0.65 mg/kg, about 0.7 mg/kg, about 0.75 mg/kg, about 0.8 mg/kg, about 0.85 mg/kg, about 0.9 mg/kg, about 0.95 mg/kg, about 1.0 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, or about 2.0 mg/kg.
[0106] In the method or use of some embodiments, said therapeutically effective amount of the compound is less than about 0.00020 mg/kg, about 0.00030 mg/kg, about 0.00045 mg/kg, about 0.00060 mg/kg, about 0.00085 mg/kg, about 0.001 mg/kg, about 0.0015 mg/kg, about 0.002 mg/kg, about 0.0025 mg/kg, about 0.003 mg/kg, about 0.0035 mg/kg, about 0.004 mg/kg, about 0.0045 mg/kg, about 0.0050 mg/kg, about 0.0055 mg/kg, about 0.006 mg/kg, about 0.0065 mg/kg, about 0.007 mg/kg, about 0.0075 mg/kg, about 0.008 mg/kg, about 0.0085 mg/kg, about 0.009 mg/kg, about 0.0095 mg/kg, about 0.01 mg/kg, about 0.015 mg/kg, about 0.02 mg/kg, about 0.025 mg/kg, about 0.03 mg/kg, about 0.035 mg/kg, about 0.040 mg/kg, about 0.045 mg/kg, about 0.05 mg/kg, about 0.055 mg/kg, about 0.06 mg/kg, about 0.065 mg/kg, about 0.07 mg/kg, about 0.075 mg/kg, about 0.08 mg/kg, about 0.085 mg/kg, about 0.09 mg/kg, about 0.095 mg/kg, about 0.1 mg/kg, about 0.15 mg/kg, about 0.2 mg/kg, about 0.25 mg/kg, about 0.3 mg/kg, about 0.35 mg/kg, about 0.4 mg/kg, about 0.45 mg/kg, about 0.5 mg/kg, about 0.55 mg/kg, about 0.6 mg/kg, about 0.65 mg/kg, about 0.7 mg/kg, about 0.75 mg/kg, about 0.8 mg/kg, about 0.85 mg/kg, about 0.9 mg/kg, about 0.95 mg/kg, about 1.0 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, or about 2.0 mg/kg.
[0107] In the method or use of some embodiments, said therapeutically effective amount of the compound is more than about 0.00020 mg/kg, about 0.00030 mg/kg, about 0.00045 mg/kg, about 0.00060 mg/kg, about 0.00085 mg/kg, about 0.001 mg/kg, about 0.0015 mg/kg, about 0.002 mg/kg, about 0.0025 mg/kg, about 0.003 mg/kg, about 0.0035 mg/kg, about 0.004 mg/kg, about 0.0045 mg/kg, about 0.0050 mg/kg, about 0.0055 mg/kg, about 0.006 mg/kg, about 0.0065 mg/kg, about 0.007 mg/kg, about 0.0075 mg/kg, about 0.008 mg/kg, about 0.0085 mg/kg, about 0.009 mg/kg, about 0.0095 mg/kg, about 0.01 mg/kg, about 0.015 mg/kg, about 0.02 mg/kg, about 0.025 mg/kg, about 0.03 mg/kg, about 0.035 mg/kg, about 0.040 mg/kg, about 0.045 mg/kg, about 0.05 mg/kg, about 0.055 mg/kg, about 0.06 mg/kg, about 0.065 mg/kg, about 0.07 mg/kg, about 0.075 mg/kg, about 0.08 mg/kg, about 0.085 mg/kg, about 0.09 mg/kg, about 0.095 mg/kg, about 0.1 mg/kg, about 0.15 mg/kg, about 0.2 mg/kg, about 0.25 mg/kg, about 0.3 mg/kg, about 0.35 mg/kg, about 0.4 mg/kg, about 0.45 mg/kg, about 0.5 mg/kg, about 0.55 mg/kg, about 0.6 mg/kg, about 0.65 mg/kg, about 0.7 mg/kg, about 0.75 mg/kg, about 0.8 mg/kg, about 0.85 mg/kg, about 0.9 mg/kg, about 0.95 mg/kg, about 1.0 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, about 1.9 mg/kg, or about 2.0 mg/kg.
[0108] Methods, uses, and compositions of some embodiments include an aqueous pharmaceutical composition, such as a stable aqueous pharmaceutical composition, containing an anti-CD49a antibody at a concentration of about 100 mg/mL to about 225mg/mL, for example, about 110 mg/mL, about 120 mg/mL, about 130 mg/mL, about 140 mg/mL, about 150 mg/mL, about 160 mg/mL, about 170 mg/mL, about 180 mg/mL, about 190 mg/mL, about 200 mg/mL, about 205 mg/mL, about 210 mg/mL, about 215 mg/mL, about 220 mg/mL or about 225 mg/mL.
[0109] In the method or use of some embodiments, the compound is administered into the cerebrospinal fluid (CSF) of the subject. In the method or use of some embodiments, an ointment comprises said compound and the ointment is administered via application of the ointment to the scalp skin of the subject. In the method or use of some embodiments, an ointment comprises said compound and the ointment is administered via application of the ointment to the head of the subject.
[0110] In the method or use of some embodiments , the administration of said compound results in accumulation of immune cells in the brain meninges. In the method or use of some embodiments, the administration of said compound results in elevated T cells and/or natural killer T (NKT) cells in the brain parenchyma.
[0111] A compound referred to herein as one that “blocks” integrin signaling may also be referred to herein as a compound that “inhibits” integrin signaling. It will be understood that use of the term “inhibit” or “block” is not intended to necessitate absolute inhibition (or blockage), and as such inhibition or (blockage) as used herein also includes a decrease, reduction or impairment of the relevant target or function. For example, an antibody or antigen binding fragment thereof that binds specifically to CD49a may be referred to herein as a “CD49a-specific” antibody, “anti-CD49a” antibody, CD49a “inhibiting” antibody, and/or CD49a “blocking” antibody. In the method or use of some embodiments, the compound that inhibits integrin signaling comprises, consists essentially of, or consists of Tysabri (natalizumab) or an antigen binding fragment thereof. In the method or use of some embodiments, the compound that inhibits integrin signaling is a compound other than Tysabri (natalizumab). In the method or use some embodiments, the compound that inhibits integrin signaling comprises, consists of, or consists essentially of Tysabri® (natalizumab) formulated for administration into the CSF of the subject or as an ointment to the head of the subject. In the method or use of some embodiments, the compound that inhibits integrin signaling comprises, consists essentially of, or consists of ReoPro® (Abcizimab), Vedolizumab, etrolizumab, anti-av integrin, or Volocixmab, or a combination of two or more of these. In the method or use of some embodiments, the compound that inhibits integrin signaling is ReoPro® (Abcizimab), Vedolizumab, etrolizumab, anti-av integrin, or Volocixmab. In the method or use of some embodiments, the compound that inhibits integrin signaling is a compound other than ReoPro® (Abcizimab), Vedolizumab, etrolizumab, anti-av integrin, or Volocixmab.
[0112] In methods, uses, compositions, and pharmaceutical compositions of some embodiments, the anti-CD49a antibody as described herein binds to and inhibits the activity of
[0113] CD49a by at least 50% (e.g., 60%, 70%, 80%, 90%, 95% or greater, including any increment therein). The apparent inhibition constant (Ki.sup.app or K.sub.i,app), which provides a measure of inhibitor potency, is related to the concentration of inhibitor required to reduce target (e.g., CD49a) activity and is not dependent on target concentrations. The inhibitory activity of an anti-CD49a antibody described herein can be determined by methods known in the art. In some embodiments, the anti-CD49a binds to CD49a with a dissociation constant K.sub.D that is numerically lower (indicating tighter binding than) 10.sup.−1, 10.sup.−2, 10.sup.−3, 10.sup.−4, 10.sup.−5, 10.sup.−6, 10.sup.−7, 10.sup.−8, 10.sup.−9, 10.sup.−10, 10.sup.−11, or 10.sup.−12, including ranges between any two of the listed values. A K.sub.D can be determined using methods known in the art, for example surface plasmon resonance on a BIACORE apparatus.
[0114] The K.sub.i,.sup.aPP value of an antibody may be determined by measuring the inhibitory effect of different concentrations of the antibody on the extent of the reaction (e.g., target activity such as CD49a activity); fitting the change in pseudo-first order rate constant (v) as a function of inhibitor concentration to the modified Morrison equation (Equation 1) yields an estimate of the apparent Ki value. For a competitive inhibitor, the Ki.sup.app can be obtained from the y-intercept extracted from a linear regression analysis of a plot of K.sub.i,.sup.app versus substrate concentration.
[0115] Where A is equivalent to v.sub.o/E, the initial velocity (v.sub.o) of the enzymatic reaction in the absence of inhibitor (I) divided by the total enzyme concentration (E).
[0116] In some embodiments, the anti-CD49a antibody described herein has a Kiapp value of 1000, 900, 800, 700, 600, 500, 400, 300, 200, 100, 50, 40, 30, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5 pM or less for the target antigen or antigen epitope, such as an epitope of CD49a. Differences in Kiapp (e.g., for specificity or other comparisons) can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 105 fold. In some examples, the anti-CD49a antibody inhibits a first antigen (e.g., a first protein in a first conformation or mimic thereof) better relative to a second antigen (e.g., the same first protein in a second conformation or mimic thereof; or a second protein). In some embodiments, any of the anti-CD49a antibodies may be further affinity matured to reduce the Kiapp of the antibody to the target antigen or antigenic epitope thereof.
[0117] In methods, uses, compositions, and pharmaceutical compositions of some embodiments, the anti-CD49a antibody suppresses or inhibits integrin signaling triggered by CD49a by at least 50% (e.g., 60%, 70%, 80%, 90%, 95% or greater, including any increment therein). Such inhibitory activity can be determined by conventional methods.
EXAMPLES
[0118] In the following Examples, CD49a is identified as a marker that can differentiate two distinct populations of meningeal T cells and that blockade of CD49a, using a blocking antibody in vivo, results in the accumulation of numerous populations of immune cells in the meninges and the parenchymal infiltration of NKT and T cells.
Example 1
Naïve Meninges are Composed of Distinct Populations of CD4 T Cells
[0119] Meningeal CD4 T cells have been shown to support cognitive function, in part through the secretion of cytokine IL-4.sup.8. In order to further analyze the different populations of T cells that populate the naïve meninges, both meninges and diaphragm were isolated and analyzed from adult mice. As described before.sup.8, the majority of T cells in the meninges express CD44 and half of the CD44+ cells also express the activation marker CD69 (
Example 2
CD49a is Expressed by Multiple Immune Populations in the Meninges and Its Blockade Results in the Transient Accumulation of Immune Cells in the Meninges
[0120] CD49a is an integrin alpha subunit, expressed by multiple cell types throughout the body.sup.15, notably by immune cells.sup.15, and is especially implicated in homing of immune cells in specific tissues. The expression of CD49a by the immune cells that populate the naïve meninges was analyzed. Not only CD4 T cells express CD49a, but also CD8 and NK cells, and to a greater extent NKT cells and monocytes/macrophages (
[0121] To test the role of CD49a on meningeal immune cells, CD49a interaction and signaling was blocked by using a blocking antibody.sup.16. Surprisingly, intracerebroventricular (i.c.v.) injection of a CD49a-blocking antibody [purchased from BD Biosciences, Catalog No. 553961, Clone Ha4/8] at about 5 μg in 5 μLvolume resulted in increased numbers of immune cells previously shown to express high level of CD49a, i.e. T cells, NK cells, and monocytes/macrophages, as soon as 24 h after the antibody injection (
Example 3
CD49a Blockade Results in the Parenchymal Infiltration of T Cells and NKT Cells, Most Likely Through a Trans-Pial Migration.
[0122] I.c.v. injection of the CD49a blockade antibody results in elevated numbers of immune cells in the meningeal compartment. The next example was to show CD49a blockade also resulted in infiltration of immune cells into the brain parenchyma. Brains from CD49a injected mice were then analyzed by both flow cytometry and IHC for the presence of intraparenchymal immune cells. Labeling of brain slices with anti-CD45 antibody revealed the presence of roundly shaped immune cells within the brain parenchyma of CD49a-injected mice as soon as 24 h after the injection (
[0123] Not only is CD49a expressed by immune cells but also by the blood endothelial cells.sup.15. To confirm that the parenchymal infiltration of immune cells upon CD49a blockade is not related to a transient opening of the blood brain barrier (BBB), the integrity of the BBB was tested by injecting Evans Blue in the blood vasculature during the 24 h after CD49a treatment. As seen in
[0124] Overall, blocking the integrin signaling through CD49a induces the proliferation and migration of specific immune cells from the meninges to the brain parenchyma.
Example 4
Repetitive Blockade of CD49a Results in a Decrease in EAE Scoring
[0125] Blockade of CD49a interaction and signaling results in the accumulation of T cells and NKT cells in the brain parenchyma of WT mice, likely coming from endogenous meningeal immune cells. The next example shows blocking of CD49a interferes with the development of EAE, the animal model of Multiple Sclerosis, where immune cells, notably T cells, transit through the meninges and also infiltrate the parenchyma. Catheters were inserted into the cisterna magna into mice and were injected every other day with about 5 μg in 5 mL of the CD49a blockade antibodies. At day 6 after beginning of CD49a treatment, EAE was induced by injection of an emulsion of MOG35-55 subcutaneously above the tail. Surprisingly, the repetitive injection of CD49a blocking antibodies decreased the diseases severity compared to IgG injected mice, showing a protective effect of CD49a blockade in the development of EAE (
[0126] Overall those data show that interfering with an integrin, highly expressed by the meningeal immune cells, is sufficient to induce drastic changes in local immune cell populations and favor the migration of cells into the brain parenchyma. CD49a is an example of one integrin that controls immune cell localization and function within brain borders.
Example 5
Administration of an Antibody that Inhibits CD49a Results in a Decrease in EAE Score
[0127] Adult C57BI6 female mice were injected i.c.m. with 5 μl of anti-CD49a antibody (or IgG control) at day 8 post EAE induction (EAE was induced by 200 μg of MOG.sub.35-55+CFA). Mice were subsequently followed daily for disease progression. The results of this experiment are shown in
Example 6
Modulation of a CD49a Blockade
[0128] Adult C57B16 mice where sham operated or denervated (SCG excision). One week after surgery, mice were injected with 5 μg of anti-CD49a (or IgG) and tissues were harvested 24h after.
[0129] Adult C57B16 mice had their meningeal lymphatic vessels ablated using Visudyne (control mice were injected with PBS). One week after meningeal lymphatic ablation, mice were injected with 5 μg of anti-CD49a (or IgG) and tissues were harvested 24 h after injection.
Example 7
CD49a Blockade During EAE Results in Decrease Disease Incidence without Preventing Immune Cells Infiltration
[0130] Adult C57B16 mice were immunized with 200 μg of MOG with CFA supplemented with 2mg/m1 of mycobacterium. At D7 post EAE induction, mice were injected i.c.m. with 5 μg of anti-CD49a (or IgG).
[0131] Thus, administering an inhibitor of CD49a signaling to an EAE subject (a model of MS) in accordance with some embodiments herein delayed the onset of EAE, reduced the incidence of EAE, and improved the clinical score of the EAE subject. Accordingly, it is contemplated that administering an inhibitor of CD49a (such as an antibody or antigen binding fragment thereof that binds specifically to CD49a) in accordance with some embodiments herein can delay the onset of, reduce the incidence of, and/or ameliorate symptoms of MS.
Example 8
Validation of the CD49a-KO Mice
[0132] Meninges from adult CD49a WT and CD49a KO mice were harvested and analyzed by FACS.
Example 9
Anti-CD49a Induced Recruitment of Myeloid Cells Alters Neuronal Survival After Injury
[0133] Adult C57B16 mice received a unilateral optic nerve crush. At D3 post crush, IgG or anti-CD49a antibodies were injected i.c.m.. Mice were sacrificed at D7 post crush.
[0134] It is noted that treatment with anti-CD49a did not result in major behavioral abnormalities, as measured in open field, elevated plus maze, three chamber assay, and rotarod experiments (
[0135] In summary, treatment with an inhibitor of CD49a (anti-CD49a antibody) in accordance with some embodiments herein inhibited damage to and loss of nervous system cells, as demonstrated by higher numbers of neurons (RGCs) compared to controls, and as demonstrated by superior BMS score for spinal cord injury.
Example 10
Anti-CD49a Induced Recruitment of Myeloid Cells Alters AD Pathology
[0136] One month old 5xFAD mice were injected weekly with anti-CD49a antibodies (i.c.m.) or IgG for a month. Representative images of plaques in the hippocampus of IgG and anti-CD49a treated 5xFAD mice are shown in
Example 11
Anti-CD49a Results in the Migration of Myeloid Cells Through the Skull Bone Marrow Channels
[0137] Mice were injected with anti-CD49a antibodies or IgG control. Representative images of myeloid cells (Ly6C/Ly6G+, red) in the skull bone marrow channels (Osteo sense, white) were shown in
Example 12
Single Cells of Macrophages and Myeloid Cells from Brain and Meninges of CD49a-Treated Mice
[0138] Adult C57B16 male mice were injected into the cisterna magna with 5 μg of IgG or anti-CD49a. Meningeal macrophages (CD11b+F4/80+), brain and meninges monocytes (CD11b+Ly6C+) and neutrophils (CD11b+Ly6G+) were sorted and pooled, and mRNA from the cell was sequenced using the 10x genomic technology.
TABLE-US-00001 TABLE 1 Genes Upregulated in anti-CD49a Treated Mice Immune Cell Tissue Gene p Value Average LogFC Macrophages Meninges CCL3 1.81E−08 0.995337169 CCL4 2.72E−08 0.942200279 SPP1 3.81E−08 0.29343668 Monocytes Meninges CXCL2 9.07E−21 1.592258245 CCL3 4.41E−23 1.184362281 CCL4 7.72E−15 0.760886636 CXCL16 1.47E−08 0.51565002 SPP1 4.15E−08 0.889201598 TREM2 4.77E−13 0.66783204 TGFBI 8.08E−15 0.730685182 Monocytes Brain CXCL2 4.11E−27 0.774361039 CCL3 2.65E−22 0.884708905 CCL4 4.55E−19 0.66355292 CCR2 7.69E−09 0.33137933 ARG1 1.37E−10 0.671877631 TREM2 4.07E−10 0.589774 TGFBI 1.79E−11 0.485576652 Neutrophils Meninges CCL3 1.33E−12 1.964905469 CCL4 1.45E−06 1.108528825 Neutrophils Brain CXCL2 3.57E−18 0.988546129 CCL3 8.93E−48 1.764351504 CCL4 1.68E−26 0.692442627 CCR2 2.06E−37 1.238451562 SPP1 1.40E−20 0.990124071 ARG1 1.86E−24 0.751502474 TREM2 4.47E−16 0.526029864 TGFBI 1.74E−17 0.456909786
[0139] As shown in Table 1 and
[0140] The differentially expressed genes identified in this study are listed in the Tables 2-13 in Appendix A.
Example 13
Mass-Cytometry Analysis of the Meninges and Brain After Anti-CD49a Treatment and Vascular Extravasation Blockade
[0141] Adult C57B16 male mice were injected into the cisterna magna with 5 μg of IgG or anti-CD49a.
[0142] These results demonstrated that the anti-CD49a treatment selectively recruited myeloid cells to the CNS. These results also demonstrate that myeloid cells can be recruited within the CNS without the requirement of blood vasculature extravasation. It highlights a new route of infiltration of immune cells that might have differential outcome in diseases.
[0143] Each of the following references is incorporated by reference in its entirety herein.
[0144] 1. Louveau, A., Harris, T. H. & Kipnis, J. Revisiting the Mechanisms of CNS Immune Privilege. Trends Immunol. 36,569-577 (2015).
[0145] 2. Kipnis, J., Gadani, S. & Derecki, N. C. Pro-cognitive properties of T cells. Nat. Rev. Immunol. 12,663-669 (2012).
[0146] 3. Main, I. & Kipnis, J. Learning and memory ... and the immune system. Learn. Mem. Cold Spring Harb. N 20,601-606 (2013).
[0147] 4. Schwartz, M., Kipnis, J., Rivest, S. & Prat, A. How do immune cells support and shape the brain in health, disease, and aging? J. Neurosci. Off. J. Soc. Neurosci. 33, 17587-17596 (2013).
[0148] 5. Ransohoff, R. M. & Engelhardt, B. The anatomical and cellular basis of immune surveillance in the central nervous system. Nat. Rev. Immunol. 12, 623-635 (2012).
[0149] 6. Andersson, U. & Tracey, K. J. Neural reflexes in inflammation and immunity. J. Exp. Med. 209, 1057-1068 (2012).
[0150] 7. Brynskikh, A., Warren, T., Zhu, J. & Kipnis, J. Adaptive immunity affects learning behavior in mice. Brain. Behay. Immun. 22, 861-869 (2008).
[0151] 8. Derecki, N. C. et al. Regulation of learning and memory by meningeal immunity: a key role for IL-4. J. Exp. Med. 207, 1067-1080 (2010).
[0152] 9. Radjavi, A., Smirnov, I., Derecki, N. & Kipnis, J. Dynamics of the meningeal CD4(+) T-cell repertoire are defined by the cervical lymph nodes and facilitate cognitive task performance in mice. Mol. Psychiatry 19, 531-533 (2014).
[0153] 10. Louveau, A. et al. Structural and functional features of central nervous system lymphatic vessels. Nature (2015). doi:10.1038/nature14432
[0154] 11. Carbone, F. R. Tissue-Resident Memory T Cells and Fixed Immune Surveillance in Nonlymphoid Organs. J. Immunol. Baltim. Md 1950 195, 17-22 (2015).
[0155] 12. Park, C. O. & Kupper, T. S. The emerging role of resident memory T cells in protective immunity and inflammatory disease. Nat. Med. 21, 688-697 (2015).
[0156] 13. Clark, R. A. Resident memory T cells in human health and disease. Sci. Transl. Med. 7, 269rv1 (2015).
[0157] 14. Fan, X. & Rudensky, A. Y. Hallmarks of Tissue-Resident Lymphocytes. Cell 164, 1198-1211 (2016).
[0158] 15. Gardner, H. Integrin α1β1. Adv. Exp. Med. Biol. 819, 21-39 (2014).
[0159] 16. Chen, Y. et al. CD49a promotes T-cell-mediated hepatitis by driving T helper 1 cytokine and interleukin-17 production. Immunology 141, 388-400 (2014).
INCORPORATION BY REFERENCE
[0160] All publications, patents, and patent applications mentioned herein are hereby incorporated by reference in their entirety as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.
EQUIVALENTS
[0161] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the present invention described herein. Such equivalents are intended to be encompassed by the following claims.
Appendix A: Differentially Expressed Genes in Anti-CD49A Treated Mice
Tables 2-13
[0162]
TABLE-US-00002 TABLE 2 Genes Upregulated in Macrophages in Meninges of anti-CD49a Treated Mice Gene p-val avg_logFC Sparc 2.95E−12 1.69853217 Hexb 6.21E−07 1.5228273 Cd9 1.45E−07 1.18946818 Lpl 2.51E−08 1.07463278 Ccl3 1.81E−08 0.99533717 B930036N10Rik 3.51E−15 0.99401264 Ccl4 2.72E−08 0.94220028 Junb 3.77E−08 0.92900107 Fn1 5.67E−09 0.91420686 Sgk1 3.89E−11 0.86967656 Gm10076 3.55E−12 0.76985168 Ly86 9.73E−07 0.76287697 Ldhb 6.67E−10 0.75060559 Gapdh 4.39E−08 0.74390535 mt.Co2 2.42E−10 0.72509221 Fscn1 9.46E−13 0.69135085 Serpine2 1.29E−15 0.68226896 Gpr84 4.28E−16 0.6810003 Syngr1 1.15E−10 0.67577512 mt.Atp6 1.15E−08 0.66056277 Eef2 1.22E−09 0.64440598 Capg 5.97E−10 0.64192741 Phgdh 1.03E−18 0.62828551 mt.Nd3 3.89E−06 0.62808873 mt.Nd1 1.15E−08 0.62754412 Atf3 7.20E−09 0.61793263 mt.Co3 1.16E−10 0.60872986 Dusp1 1.69E−06 0.60692694 mt.Nd2 1.11E−10 0.60565418 mt.Nd4 1.05E−07 0.58977341 Rpsa 5.06E−10 0.58694348 Gm10263 2.04E−06 0.57161343 Gm11808 3.99E−08 0.56981655 Gm10269 2.73E−08 0.56607098 Cst7 1.81E−15 0.56339711 Rps18.ps3 8.84E−07 0.55979526 Mafb 1.49E−07 0.54409028 Gm26917 2.09E−08 0.54071596 Rps26.ps1 4.75E−07 0.54017705 Uba52 1.34E−06 0.52148784 Ecscr 2.24E−14 0.51111523 Plxdc2 1.15E−07 0.50965403 Rpl41 5.89E−08 0.49953714 Rps12.ps3 1.37E−06 0.49723671 Eef1a1 4.76E−11 0.48906095 Rps26 2.14E−09 0.4827306 Rps2 2.45E−07 0.48186137 Rps12 6.05E−08 0.4818404 Gm6133 1.22E−06 0.47766452 Lag3 8.14E−08 0.46687135 Gm2000 3.85E−06 0.46382303 Rpl13.ps3 9.26E−08 0.46136352 Gm8730 9.00E−08 0.44022363 Nfkbiz 5.50E−07 0.42301174 Rpl13a.ps1 3.86E−06 0.41027722 Gins1 2.16E−06 0.40485876 Rps10 2.88E−06 0.40153727 Rplp0 5.50E−08 0.39881993 Rps27a 1.44E−08 0.39442097 Golm1 4.01E−08 0.391201 Wdr89 9.78E−08 0.38585982 Rps7 3.21E−06 0.38479492 Gm6576 4.05E−07 0.38232836 Slc2a5 3.14E−12 0.37212076 Rpl10a 6.58E−07 0.35665635 Rpl24 1.63E−06 0.35242046 Gm10073 9.58E−07 0.35078443 Rpl8 3.55E−07 0.34491338 Rpl31 3.59E−06 0.33175957 Gal3st4 1.33E−13 0.31789298 Cd34 3.14E−12 0.31602571 Rplp2 1.64E−06 0.29400795 Spp1 3.81E−08 0.29343668 Gm7293 6.39E−07 0.28108527 Adgrg1 1.62E−11 0.26915971 Galns 2.33E−06 0.26835041 Smad7 2.73E−08 0.26203018 Naglu 2.05E−06 0.25043821
TABLE-US-00003 TABLE 3 Genes Upregulated in Macrophages in Brain of anti-CD49a Treated Mice Gene p_value avg_logFC Hexb 7.58E−07 1.64454476 Olfml3 8.19E−08 1.57543901 Cd9 5.06E−08 1.32620257 Cd81 4.37E−07 1.29179631 Tmem119 4.19E−07 1.22655965 Fcrls 8.65E−10 1.18020405 P2ry12 2.69E−07 1.00981846 Gpr34 2.52E−07 0.99254852 Gm26917 2.30E−13 0.98140947 C1qa 3.05E−08 0.97943974 C1qc 1.01E−06 0.96311477 B930036N10Rik 4.23E−08 0.92983585 Siglech 3.86E−09 0.92488144 C1qb 1.10E−06 0.89940699 Ly86 8.74E−07 0.83663832 Lrrc58 1.20E−07 0.79632837 Calr 1.63E−06 0.73818469 Gpr84 1.78E−11 0.72500672 Ldhb 1.90E−06 0.7085327 Syngr1 2.40E−06 0.69233115 Gm6133 8.50E−09 0.68339879 Gm11808 1.28E−08 0.67541996 Abhd12 2.43E−06 0.66841052 Fscn1 3.42E−09 0.65397023 mt.Nd1 2.69E−07 0.64955257 Gm10020 1.02E−07 0.63591712 Rps18.ps3 1.62E−06 0.63335645 Hmgn1 1.50E−07 0.62856861 Gm10269 4.88E−08 0.62811363 Phgdh 5.39E−10 0.61437971 Serpine2 4.06E−08 0.5899207 mt.Nd2 1.19E−07 0.56124584 Gm8730 1.38E−08 0.54891195 Gm10036 8.93E−07 0.54129244 Cst7 1.39E−07 0.54025665 Gm10073 1.38E−08 0.53965999 Rpl13.ps3 9.96E−08 0.53037794 Plxdc2 6.12E−07 0.52102411 Rpl13a.ps1 1.23E−06 0.51815517 Rpl10.ps3 2.33E−07 0.51726194 Lag3 1.96E−07 0.50386936 Gm6576 2.50E−08 0.46559774 Ppp1r14b 3.25E−06 0.46271074 Rpl4 2.78E−07 0.43396692 Tanc2 2.59E−06 0.32589348 Gal3st4 7.53E−07 0.31789298 Rtn1 1.97E−06 0.30907644 Gm7293 1.24E−06 0.30722243
TABLE-US-00004 TABLE 4 Genes Downregulated in Macrophages in Meninges of anti-CD49a Treated Mice Gene p−val Avg_logFC Fcer1g 3.59E−06 −0.2588198 Stab1 3.92E−06 −0.4190385 Tmem176b 2.08E−06 −0.4282242 S100a11 8.88E−07 −0.436066 Mmp8 7.03E−07 −0.4805831 Sepp1 1.24E−07 −0.4868411 Tmem176a 1.31E−06 −0.4960306 Ifitm6 1.68E−07 −0.5212641 Ms4a7 1.28E−06 −0.5238705 Igfbp4 1.68E−06 −0.5545901 Cbr2 3.25E−07 −0.5749881 Slpi 5.68E−09 −0.5967292 Fcgrt 1.13E−07 −0.6003568 Smagp 6.56E−08 −0.6894383 Dab2 7.01E−10 −0.7038323 Ccl8 4.06E−12 −0.7052558 Trf 2.23E−12 −0.7121524 Mrc1 1.08E−10 −0.7220726 Pglyrp1 1.66E−10 −0.743788 Pf4 3.39E−12 −0.7865412 Clec10a 1.05E−07 −0.8197547 Ccl24 2.87E−06 −0.9116746 Apoe 7.68E−15 −0.9171204 Ltf 1.44E−17 −1.0182296 Cd74 5.09E−09 −1.0271156 Cd209g 2.89E−06 −1.0298734 H2.Aa 6.48E−12 −1.142515 H2.Ab1 7.54E−12 −1.1749434 H2.Eb1 8.16E−12 −1.2853002 Cd209f 2.00E−06 −1.3023423 Wfdc21 2.04E−23 −1.3505274 Mgl2 4.60E−17 −1.4346766 Lcn2 5.04E−26 −1.4489891 Ngp 9.07E−31 −1.911379 Retnlg 6.45E−33 −2.0423089 S100a8 1.91E−33 −2.1668801 Camp 2.10E−32 −2.2177266 S100a9 1.74E−33 −2.2237595
TABLE-US-00005 TABLE 5 Genes Downregulated in Macrophages in Brain of anti-CD49a Treated Mice Gene p_val avg_logFC Psap 6.87E−07 −0.5286052 Il1b 1.19E−06 −0.6026112 Samhd1 1.68E−06 −0.6080534 H2.Aa 3.20E−08 −0.650763 H2.Ab1 7.18E−08 −0.6529269 Plac8 2.03E−09 −0.7495257 Chil3 2.05E−09 −0.7638213 Crip1 1.55E−09 −0.7922957 Fabp5 1.78E−06 −1.006639 Hbb.bs 1.43E−11 −4.5620426
TABLE-US-00006 TABLE 6 Genes Upregulated in Monocytes in Meninges of anti-CD49a Treated Mice Gene p_val avg_logFC Cxcl2 9.07E−21 1.59225825 Ccl3 4.41E−23 1.18436228 Jun 3.73E−31 1.1307181 Ier3 4.10E−22 1.08742218 Fos 1.33E−27 1.0818198 Ccrl2 1.13E−24 1.02618799 Bcl2a1b 8.94E−23 1.02351383 Junb 2.15E−26 0.91695761 Spp1 4.15E−08 0.8892016 Cd14 2.69E−18 0.88658123 Atf3 6.69E−22 0.87236514 Lgmn 7.03E−20 0.86640958 Dusp1 2.75E−20 0.8530505 Hexb 3.43E−16 0.83137339 Nfkbia 2.27E−17 0.81396206 Zfp36 1.18E−24 0.78789442 Ccl4 7.72E−15 0.76088664 Rps18.ps3 3.86E−29 0.7521328 Gm10263 3.79E−31 0.74549134 Tgfbi 8.08E−15 0.73068518 Rpl36.ps3 1.94E−31 0.72040883 Gm10116 5.65E−26 0.71571404 Clec4n 1.39E−08 0.6916935 Ctsd 1.08E−15 0.68830414 Jund 4.57E−17 0.68244339 Gm6133 1.68E−27 0.6813687 C3ar1 5.48E−16 0.67250082 Trem2 4.77E−13 0.66783204 Rps26.ps1 1.74E−23 0.63450575 Apoe 2.78E−09 0.62813261 Eef1a1 3.68E−31 0.62386507 Cstb 3.13E−15 0.60290542 Gm10020 4.11E−25 0.59776291 Gm10260 1.83E−17 0.58859315 Itgb5 4.38E−13 0.58723671 Fcgr2b 3.80E−13 0.58682332 Gm10036 1.68E−26 0.58541323 Cdkn1a 6.81E−14 0.58465673 Rpl13.ps3 4.11E−26 0.58432616 Aif1 6.76E−12 0.56662687 Rpl12 1.44E−20 0.56240499 Il1b 3.66E−10 0.56059929 Rpl3 2.48E−23 0.55053625 Nr4a1 1.17E−11 0.54066788 Fth1 1.62E−18 0.53733343 Rpl9.ps6 3.99E−22 0.53606222 Gm10076 5.17E−26 0.53217595 Rps2 2.97E−21 0.52932219 Csf1r 4.31E−16 0.52855039 Rpl10.ps3 3.21E−21 0.52466072 Bcl2a1d 1.11E−11 0.52391958 Gdi2 7.03E−18 0.52352028 Egr1 1.32E−10 0.52312561 Gm2000 1.49E−24 0.52111064 Socs3 6.05E−08 0.51892829 Cxcl16 1.47E−08 0.51565002 Tlr2 1.57E−09 0.50383948 Gm10269 2.52E−14 0.49286779 Snx5 1.76E−12 0.491965 Hexa 6.15E−14 0.49177822 Slc3a2 1.23E−12 0.49092509 Ier5 5.82E−11 0.48752322 Ldhb 1.20E−07 0.48404015 Rpl23 1.96E−26 0.47944043 Rpl30 1.15E−20 0.47349305 Grn 1.38E−11 0.47104378 Npm1 2.45E−14 0.46571434 Rpl7a.ps5 7.45E−14 0.46505831 Gm8730 4.97E−20 0.46184496 Hnrnpa1 9.52E−12 0.46164942 Rpl29 1.54E−20 0.46160418 Eef2 1.04E−14 0.46007348 Gm9493 9.59E−19 0.45715163 Ctss 3.76E−12 0.45610934 Pim1 1.92E−07 0.45508414 Ubc 8.22E−12 0.45349269 Lat2 3.22E−11 0.45270285 Rpl6l 1.46E−20 0.45250361 Lyz1 4.91E−08 0.44689646 Btg2 6.28E−08 0.44572946 Tgif1 5.03E−14 0.4443003 Rpl13a.ps1 9.36E−11 0.44223906 Gm10073 2.00E−15 0.43831364 Rps26 4.25E−18 0.43782603 Mif 9.43E−09 0.43648174 Rps18 9.44E−22 0.4364405 Rpl5 3.10E−15 0.43596908 Bri3 1.06E−10 0.43505773 AF251705 1.04E−08 0.43486273 Eef1g 3.34E−11 0.43479688 Rpl17 1.15E−22 0.43243098 Lamp1 3.44E−17 0.43006618 Rps7 2.70E−18 0.4246649 Rgs10 1.99E−12 0.42414568 Nfkbiz 4.27E−11 0.4228873 Rgs1 3.13E−07 0.41929294 Tmem86a 5.10E−09 0.41672086 Rps8 3.06E−21 0.41486908 Rpl15 1.71E−19 0.41425509 Acp5 2.16E−09 0.41324354 Gm6576 1.32E−10 0.41297692 Pold4 4.30E−09 0.41124473 Rps27rt 4.82E−20 0.40896444 Bcl2a1a 6.77E−09 0.40794881 Tpt1 1.67E−23 0.40753015 Npc2 1.16E−11 0.40353206 Sirpb1c 1.15E−07 0.40283153 Gm17541 5.11E−10 0.40281009 Mafb 2.24E−07 0.39996572 Ppp1r15a 7.99E−13 0.39862351 Rps4x 2.98E−19 0.39541898 Tctex1d2 9.35E−08 0.39440673 Rpl32 2.06E−21 0.39378982 Rnase4 3.32E−06 0.39268533 Gnb2l1 2.69E−14 0.39182243 Rpl14 1.04E−15 0.39082249 Dpep2 4.19E−10 0.39018648 Pabpc1 1.21E−11 0.38980326 Zeb2 8.34E−07 0.38584435 Gusb 4.58E−08 0.38512577 Rpl36a 3.14E−13 0.3844358 Lgals1 4.38E−08 0.38404466 Atp5g2 7.30E−10 0.38393988 Ecm1 9.21E−09 0.38263944 Rps3a1 3.31E−19 0.38233571 Rpl6 8.89E−20 0.3818314 Gm26917 4.41E−11 0.38062605 Ifnar2 7.51E−09 0.38055011 Rplp0 2.56E−17 0.37810841 Capg 2.11E−06 0.37442111 Rps2.ps6 8.85E−10 0.37367338 Rps10 5.18E−19 0.37352636 Abhd12 1.89E−09 0.37290472 Ctsz 1.12E−10 0.3725525 Lilr4b 3.50E−08 0.37229361 Rpl9 6.55E−20 0.37177858 Rps6 2.19E−17 0.36968059 Gm11808 4.98E−18 0.3686181 Pid1 1.44E−08 0.36571006 Fam213b 6.68E−09 0.36404883 Olfml3 3.67E−11 0.36099023 Rpl10a 6.23E−14 0.35729615 Ms4a6d 1.30E−06 0.35307693 Wdr89 2.45E−17 0.35174725 Nme2 7.52E−09 0.35119695 Gadd45b 9.13E−07 0.35020483 Rpl8 4.74E−16 0.34947419 Skil 2.20E−07 0.34881342 Rpl35 1.75E−15 0.3479576 Rpl13 3.23E−16 0.3468875 Ftl1 1.07E−13 0.34559395 Rpl7a 4.54E−14 0.34521554 Ctsa 2.97E−09 0.34478194 Pnrc1 6.99E−07 0.3441851 Gapdh 3.25E−10 0.34391631 Rps20 6.08E−14 0.3432715 Rpl27.ps3 3.78E−16 0.34275645 Rpl18 1.72E−13 0.33970856 Rps17 2.46E−13 0.33811056 Slc25a3 7.56E−09 0.33626489 Rpl24 2.78E−17 0.3341386 Rps3 2.98E−16 0.3336198 Anxa4 9.29E−08 0.33206645 Rpl26 1.99E−18 0.33168208 Gm10709 3.21E−09 0.33102067 Cd86 3.81E−08 0.32819907 Rpl11 7.99E−17 0.32230094 Sirpb1b 2.99E−06 0.32175365 Coro1b 5.50E−08 0.32013786 Rpl31 5.71E−13 0.31955013 Ptafr 3.37E−06 0.31896716 Hexim1 1.28E−08 0.31760664 Rpl10 4.27E−12 0.31607151 Renbp 1.36E−07 0.31574238 Gm5093 1.84E−08 0.31467301 Rpl37 1.43E−17 0.31311495 Eif3m 7.94E−07 0.3126113 Uba52 3.06E−15 0.31255569 Rpl4 1.37E−10 0.3120875 Rpl36 9.23E−15 0.30931069 Fam3c 1.17E−08 0.30908997 Rplp1 1.68E−12 0.30842047 Rpl18a 1.55E−15 0.30831851 Unc93b1 1.98E−08 0.30810276 Gm7293 1.31E−07 0.30500944 Trib1 2.32E−08 0.30447713 Rps13 2.40E−14 0.30364043 P2rx4 1.05E−06 0.30290505 Sirpb1a 1.60E−06 0.30285609 Tnf 1.48E−09 0.3024245 Rps5 7.92E−14 0.30160415 Eif3h 1.32E−08 0.29990535 Dnase2a 2.06E−08 0.29930975 Rpl27a 5.49E−14 0.29696805 Rpl22 7.46E−11 0.29647979 Gm9843 3.15E−15 0.29554278 Eef1b2 1.76E−07 0.29313712 Eid1 5.82E−07 0.2930419 Rps23 7.16E−14 0.29288449 Svbp 3.31E−06 0.29262014 Pkib 6.15E−07 0.29213481 Efhd2 1.18E−06 0.29185241 Gm6377 7.01E−09 0.28706344 Rpl41 8.12E−14 0.28697375 Rps15 1.53E−12 0.2863559 Adap2os 2.63E−06 0.28551041 Axl 3.53E−06 0.28528186 Matk 1.34E−08 0.28134571 Rpl21 6.40E−15 0.28116597 Rpl13a 7.16E−14 0.28105739 Gm17056 1.20E−06 0.28067132 Hebp1 3.46E−07 0.28006399 Tmem119 1.13E−07 0.27935084 Pebp1 7.07E−07 0.27461933 Rpl34 7.92E−14 0.27370395 Rps12 1.76E−09 0.27337944 Parp1 8.16E−07 0.27232466 Rps19 4.54E−14 0.26865824 Rps25 5.01E−11 0.26680405 Rpl19 2.40E−12 0.26614002 Rpl23a.ps3 2.77E−09 0.26538006 Rps15a 1.42E−11 0.26318066 Rps16 1.44E−12 0.26264588 P2ry12 5.30E−07 0.26073223 Fcgr3 7.43E−07 0.26072837 Naa20 1.07E−06 0.26031527 Plgrkt 3.59E−06 0.25684742 Gde1 8.98E−07 0.2556075 Gm8973 1.11E−06 0.25459625 Rpl23a 2.05E−10 0.25355601 Itga6 1.06E−07 0.25195368 Rps9 1.93E−09 0.2507595 Rpl39 4.96E−10 0.25036861 Nr4a2 3.23E−07 0.25033848 Tnfaip3 4.86E−08 0.25002145
TABLE-US-00007 TABLE 7 Genes Upregulated in Monocytes in Brain of anti-CD49a Treated Mice Gene p_val avg_logFC Lgmn 1.79E−22 0.94635474 Ccl3 2.65E−22 0.88470891 Hbb.bs 1.71E−31 0.79953777 Apoe 2.06E−15 0.7898567 Cxcl2 4.11E−27 0.77436104 H2.Aa 1.09E−08 0.75277355 Il1b 9.60E−29 0.7250685 Fcgr2b 3.36E−21 0.72217285 Cd74 4.26E−09 0.72014483 H2.Ab1 9.02E−07 0.68204028 Arg1 1.37E−10 0.67187763 Ccl4 4.55E−19 0.66355292 H2.DMb1 2.54E−11 0.65141758 Aif1 3.11E−17 0.63880011 C3ar1 1.00E−14 0.63539176 Cstb 1.56E−16 0.63109919 Ctsd 1.72E−13 0.62552478 Bcl2a1b 7.84E−11 0.61901346 Trem2 4.07E−10 0.589774 H2.DMa 8.57E−15 0.58583716 Ccrl2 1.82E−18 0.57369817 AF251705 1.89E−15 0.56638501 Ecm1 5.92E−13 0.53964741 Fth1 1.49E−21 0.52523305 Ctss 3.64E−18 0.51990111 Sepp1 8.05E−07 0.50602612 Rgs10 6.67E−15 0.49102385 Jun 1.18E−10 0.49076918 Tgfbi 1.79E−11 0.48557665 Snx5 1.41E−12 0.47576167 Clec4n 3.88E−06 0.46257497 Grn 5.61E−14 0.45127534 Npc2 4.28E−16 0.45110731 Bri3 5.43E−12 0.43718394 Rpl3 1.52E−18 0.42861879 Hexa 4.74E−13 0.42713199 Tmem176b 8.74E−09 0.4248092 Nfkbia 5.65E−08 0.41453465 Ftl1 4.57E−17 0.41228431 Ms4a6d 3.25E−09 0.40908981 Gdi2 2.98E−11 0.40085416 Fcgr1 6.13E−09 0.39971253 Csf1r 3.77E−11 0.3954489 Tmem86a 8.79E−08 0.3924534 Dhrs3 1.05E−07 0.38975683 Adgre1 1.71E−08 0.38774431 Tubb2a 5.93E−08 0.38140761 Cd14 2.51E−07 0.37910603 Sirpb1c 1.12E−07 0.37639865 Fos 1.92E−09 0.37502954 Ctsc 4.92E−10 0.37296656 Ctsa 4.33E−11 0.37261756 Pold4 2.94E−08 0.37083642 Lamp1 4.88E−14 0.36377671 Ly86 2.35E−07 0.36278813 Fcgr3 5.33E−09 0.35499684 Ier3 3.36E−07 0.3543161 Unc93b1 2.66E−11 0.35291165 Pkib 1.62E−08 0.35083758 Ctsz 2.06E−10 0.34876465 Xpot 1.15E−09 0.34851092 Atp2b1 1.01E−06 0.34094438 Tctex1d2 1.14E−07 0.33432392 Ccr2 7.69E−09 0.33137933 P2rx4 4.97E−07 0.32868404 Ifnar2 1.78E−08 0.32804369 Coro1b 1.17E−07 0.32774076 Lgals1 3.53E−06 0.32773597 Junb 6.15E−07 0.32258707 Fam213b 6.31E−08 0.31105349 Tgif1 2.14E−07 0.31042174 Hba.a2 3.13E−11 0.30755306 Rsrp1 1.52E−07 0.30524161 P2ry6 5.82E−07 0.30017037 Btg1 1.81E−08 0.30000777 Hba.a1 8.99E−12 0.29692736 Gusb 3.75E−06 0.29590749 Sdcbp 2.46E−06 0.29207431 Atp5g2 3.40E−08 0.2919616 Abhd12 2.43E−06 0.29153728 Zfos1 3.53E−06 0.2817017 Fam105a 3.64E−07 0.28144716 Itm2c 9.30E−07 0.27961282 Snap23 6.78E−07 0.27837648 Eef1g 2.10E−07 0.27738145 Ubc 3.65E−07 0.27664954 Eef1a1 1.17E−11 0.27315025 Ctsh 1.04E−07 0.27255533 Hbb.bt 9.56E−12 0.27135894 Egr1 2.34E−06 0.27113381 Rps2 4.09E−08 0.27001391 Slc25a3 1.17E−06 0.2676465 Pebp1 1.87E−07 0.26450558 Plgrkt 2.33E−06 0.26397809 Apoa1bp 1.12E−06 0.25892109 Ppp1r15a 6.86E−07 0.25568953 Rpl41 1.15E−13 0.25539481 Gm5150 1.36E−06 0.25368698 Parp1 6.56E−07 0.25219642
TABLE-US-00008 TABLE 8 Genes Downregulated in Monocytes in Meninges of anti-CD49a Treated Mice Gene p_val avg_logFC Ccl7 1.48E−08 −0.2516399 Sec61g 3.66E−06 −0.2663989 BC035044 2.10E−07 −0.2738574 Retnla 6.23E−09 −0.2794928 Nhsl2 2.48E−06 −0.2877171 H3f3a 7.96E−10 −0.2907085 Ccna2 6.02E−09 −0.2982257 Spn 8.61E−08 −0.3080083 S1pr4 2.24E−09 −0.3081526 Tspo 6.85E−07 −0.3110725 Myl6 4.87E−09 −0.3205517 Lockd 1.33E−08 −0.3207781 Ndufb7 6.54E−07 −0.321696 Racgap1 3.23E−07 −0.3255227 Cdca3 1.03E−07 −0.3262457 Nfe2 2.11E−07 −0.3272263 Rrm2 6.45E−07 −0.3321582 Me2 2.40E−07 −0.3385882 Gda 3.08E−07 −0.345601 H2.Aa 8.68E−07 −0.3475977 Cbfa2t3 1.19E−06 −0.3616784 Bin2 3.34E−06 −0.366002 Sec11c 3.65E−06 −0.375721 Ccnb2 5.95E−08 −0.3776796 Gpx1 5.12E−10 −0.3830604 Mki67 6.92E−08 −0.3866818 H2.Ab1 4.59E−08 −0.3952973 Ckap4 3.41E−07 −0.4103882 Fam107b 3.15E−06 −0.4139293 Serpinb10 1.36E−10 −0.417487 Unc119 1.54E−08 −0.4218404 Pi16 1.06E−07 −0.4248127 Mrpl33 4.50E−07 −0.4309734 Mgl2 9.13E−11 −0.4367282 G0s2 1.85E−06 −0.4477917 Ifitm2 1.67E−08 −0.4481207 S100a6 3.68E−09 −0.4620605 Coro1a 1.91E−14 −0.4629945 Trem3 1.29E−06 −0.4741985 Glipr2 3.20E−10 −0.4861011 Flna 1.50E−09 −0.4961726 Cdc42ep3 4.97E−13 −0.4964199 Fam111a 9.74E−09 −0.5009945 Taldo1 1.06E−10 −0.5096429 Wfdc17 2.79E−07 −0.512349 Itgal 1.11E−09 −0.5263466 Cebpe 7.73E−07 −0.5286079 C1galt1c1 1.27E−08 −0.5350003 Top2a 1.98E−09 −0.5469942 H2.Eb1 9.28E−11 −0.5497042 Arhgdib 9.09E−11 −0.5500561 Lbr 1.37E−09 −0.5552334 Cdkn2d 1.13E−10 −0.5564479 Lsp1 1.05E−11 −0.565686 Ltb4r1 1.06E−09 −0.5802268 Lrg1 2.02E−08 −0.5867745 Tmcc1 5.30E−08 −0.5891387 Sell 1.98E−08 −0.5963218 Birc5 4.68E−11 −0.5966319 Rasgrp2 1.26E−14 −0.597488 Cnn2 3.84E−10 −0.5975979 Tppp3 7.14E−08 −0.6232919 Anxa2 1.25E−12 −0.6303441 Ccl8 2.87E−24 −0.6343291 Itgb7 5.65E−12 −0.6351765 Serpinb1a 2.87E−12 −0.6392389 Cytip 6.70E−12 −0.656651 H2afx 2.82E−07 −0.6709242 Ccnd3 4.10E−14 −0.6786465 Mmp9 1.21E−07 −0.6801023 Ly6c2 2.60E−08 −0.6897489 Cd177 1.08E−12 −0.6897568 Ccl17 1.38E−07 −0.6945208 Msrb1 2.61E−10 −0.696232 Napsa 3.62E−14 −0.7177677 Tmsb10 7.05E−12 −0.7203773 X2810417H13Rik 3.40E−07 −0.7285495 Ly6g 8.21E−14 −0.7323743 Prtn3 1.17E−10 −0.740452 Pf4 1.00E−20 −0.7427163 Ube2c 6.02E−09 −0.8063575 Prr13 6.24E−18 −0.8317058 Klf2 4.60E−14 −0.8330745 S100a11 2.63E−16 −0.8445053 Anxa1 6.11E−13 −0.9042466 Stmn1 3.29E−07 −0.9389285 Mgst1 1.33E−13 −0.9445076 Ear2 8.43E−15 −0.9618132 Mmp8 1.14E−18 −1.0503527 Plac8 1.44E−13 −1.1161366 Gsr 2.70E−19 −1.1489925 Ifitm6 3.57E−18 −1.2006513 Slpi 9.96E−21 −1.2396313 Hp 1.91E−20 −1.3308912 Hmgb2 7.91E−15 −1.3998485 Pglyrp1 6.44E−28 −1.7401983 Ltf 6.12E−35 −1.9053366 Wfdc21 5.02E−37 −2.2122398 Lcn2 7.29E−45 −2.6487626 Retnlg 1.41E−43 −2.9460372 S100a9 1.25E−43 −3.2436403 S100a8 7.11E−43 −3.2463785 Ngp 2.90E−48 −3.6346084 Camp 6.31E−49 −3.9257027
TABLE-US-00009 TABLE 9 Genes Downregulated in Monocytes in Brain of anti-CD49a Treated Mice Gene p_val avg_logFC Ccna2 5.85E−10 −0.2553609 Knstrn 3.98E−10 −0.2592968 Ywhaz 3.17E−06 −0.2619571 Lockd 1.31E−06 −0.2651745 X6430548M08Rik 1.95E−07 −0.2717079 Fam101b 4.85E−07 −0.2744322 Gm26917 3.06E−08 −0.2848814 Racgap1 7.90E−09 −0.2855324 Ccl12 2.16E−06 −0.289565 Cdca3 3.85E−09 −0.2908443 S1pr4 6.24E−12 −0.2915418 Me2 4.89E−07 −0.2927714 AY036118 1.19E−06 −0.323587 Mki67 1.24E−09 −0.3292276 Mrpl33 3.37E−06 −0.3363041 Tmpo 8.81E−07 −0.3365711 Fcrls 3.44E−12 −0.3392043 Rnase6 1.23E−06 −0.3400341 Ccnb2 1.33E−10 −0.3510472 Cdc42ep3 2.02E−08 −0.3527338 Gda 2.62E−07 −0.354308 Ckap4 1.31E−06 −0.3544928 Adpgk 2.64E−08 −0.3546949 Nfe2 1.03E−12 −0.364706 Unc119 2.86E−08 −0.3696868 Gm10320 9.52E−10 −0.3773832 Serpinb10 4.54E−17 −0.3836176 Cdk1 3.06E−06 −0.3961652 Itgal 2.17E−08 −0.3999043 Ltb4r1 2.98E−06 −0.4016906 Coro1a 6.76E−15 −0.4126199 AI839979 3.98E−07 −0.4128051 Pi16 6.69E−10 −0.4177522 Lsp1 4.53E−10 −0.4185581 Cd81 2.77E−13 −0.4213482 Taldo1 4.29E−10 −0.4285385 Napsa 1.06E−08 −0.4293459 Glipr2 6.81E−10 −0.4303753 S100a6 1.79E−09 −0.4395265 Fam107b 5.19E−09 −0.4418406 Tagln2 3.16E−06 −0.4449391 Tuba4a 2.69E−06 −0.4481479 Arhgdib 2.99E−08 −0.4496288 Rasgrp2 1.45E−11 −0.451841 Lbr 2.59E−08 −0.4596399 Trem3 5.13E−10 −0.4726988 Top2a 1.93E−10 −0.4735547 Cdkn2d 1.54E−09 −0.4800311 Cytip 1.71E−08 −0.4813451 Plp2 5.99E−07 −0.4959285 Birc5 9.41E−10 −0.4967589 Flna 1.34E−13 −0.5111655 Ccl17 3.41E−07 −0.5218452 Cebpe 2.71E−09 −0.5225471 Mcemp1 2.81E−11 −0.5291514 Lrg1 3.50E−12 −0.5395922 Msrb1 1.44E−08 −0.5420216 Itgb7 1.73E−11 −0.543036 Serpinb1a 4.58E−09 −0.5492289 H2afx 1.00E−07 −0.5656593 Ccnd3 1.66E−14 −0.5744146 Anxa2 9.66E−14 −0.5755038 Prr13 3.95E−14 −0.6128314 X2810417H13Rik 5.99E−09 −0.6205342 Tmsb10 1.14E−12 −0.6376529 Cd177 1.41E−16 −0.6436889 Gm5483 3.15E−10 −0.6828154 Ear2 2.02E−16 −0.6901505 Ccl8 4.81E−27 −0.6908091 Sell 3.84E−15 −0.6922516 Ube2c 1.37E−10 −0.7344389 Mgst1 2.56E−12 −0.7432898 Ly6g 8.53E−27 −0.7434769 Mmp9 1.83E−10 −0.7518618 S100a11 1.70E−17 −0.7670145 Stmn1 3.60E−09 −0.7845974 Gm9844 3.14E−16 −0.8063219 Gsr 2.83E−16 −0.8509971 Anxa1 3.46E−15 −0.8529099 Pf4 9.57E−31 −0.9221419 Mmp8 2.51E−25 −1.027464 Hmgb2 2.14E−10 −1.0669291 Ifitm6 7.40E−22 −1.0920321 Hp 1.20E−18 −1.1157102 Slpi 1.65E−24 −1.2235875 Pglyrp1 1.11E−36 −1.6237952 Ltf 3.92E−71 −2.0031277 Wfdc21 2.13E−53 −2.2034873 Lcn2 2.93E−70 −2.6817382 Retnlg 1.98E−56 −3.2086941 S100a8 5.54E−55 −3.3668782 S100a9 1.72E−55 −3.3727258 Ngp 7.60E−86 −3.7483047 Camp 2.38E−87 −4.0465663
TABLE-US-00010 TABLE 10 Genes Upregulated in Neutrophils in Meninges of anti-CD49a Treated Mice Genes p_val avg_logFC Ccl3 1.33E−12 1.96490547 Gm12840 6.69E−07 1.51730346 Ccrl2 9.03E−16 1.46732097 Egr1 1.04E−12 1.23299514 Jun 2.58E−10 1.21968689 Ppp1r15a 5.07E−11 1.1762097 Nr4a1 4.14E−10 1.12578013 Ccl4 1.45E−06 1.10852882 Gngt2 3.14E−09 1.07938539 Ptgs2 8.99E−07 1.06695034 Csf3r 3.11E−10 1.02924582 Bcl2a1b 5.78E−09 0.94860512 Gadd45b 1.34E−06 0.94328437 Tsc22d3 2.76E−06 0.91365274 Btg2 3.09E−09 0.8904592 Fbxo31 3.83E−07 0.88187837 Gm10263 2.96E−06 0.87993745 Cstb 1.60E−08 0.80939337 Gm10076 4.25E−11 0.80086816 Rps27rt 3.90E−15 0.80058492 Zfp36 2.90E−11 0.79379032 Polr2l 6.78E−07 0.79310469 Gm10116 2.79E−14 0.76747653 Gm2a 1.84E−08 0.76121142 Tctex1d2 8.16E−07 0.75581618 Pmaip1 1.87E−06 0.74915327 Junb 3.32E−10 0.7420738 Gm6133 3.66E−07 0.73307625 Sirpb1c 1.63E−08 0.7287267 Wdr89 2.22E−09 0.72014444 Rbm3 2.60E−08 0.71413584 Nfkbia 1.25E−06 0.71101113 Il1b 2.34E−08 0.6918114 Fosb 1.06E−06 0.68759572 Dusp1 6.83E−08 0.68186473 Fos 3.33E−10 0.67662503 Rps8 6.72E−10 0.66116482 Rpl8 1.03E−09 0.62992155 Fxyd5 4.35E−09 0.62445023 Rpl17 4.89E−12 0.61891277 D8Ertd738e 1.31E−07 0.61797208 Bcl2a1a 3.29E−06 0.60710188 Gm10073 3.44E−06 0.60071835 Rps5 4.34E−08 0.57685126 Gm9843 1.52E−15 0.56770548 Rplp2 1.40E−08 0.56693404 Sirpb1b 1.09E−06 0.56000329 Tpt1 1.73E−08 0.5390388 Rps27 1.73E−14 0.53515601 Csf1 1.39E−07 0.52951881 Rps10 4.35E−07 0.52100802 Rpl18 1.05E−07 0.51769893 Rpl41 6.38E−10 0.51263584 Ctsd 5.73E−09 0.50632209 Rpl39 2.15E−06 0.46652164 Rps9 1.19E−11 0.46207842 Fau 1.75E−12 0.44625037 Rpl37a 8.54E−07 0.43186832 Rps16 1.66E−06 0.41412743 Fth1 1.67E−08 0.39908358 Dusp2 1.11E−06 0.39842844 Rps14 5.03E−07 0.38848674 FIG. 4 2.59E−06 0.37530425 Ftl1 7.80E−09 0.31699408 S100a5 1.84E−07 0.26042222
TABLE-US-00011 TABLE 11 Genes Upregulated in Neutrophils in Brain of anti-CD49a Treated Mice Genes p_val avg_logFC Ccrl2 2.17E−51 1.89807822 Ccl3 8.93E−48 1.7643515 Ccr2 2.06E−37 1.23845156 Fn1 3.69E−32 1.08969992 Rps28 4.32E−38 1.08594683 Rpl35 1.04E−33 1.05102004 Ppp1r15a 1.94E−38 1.02265971 Spp1 1.40E−20 0.99012407 Cxcl2 3.57E−18 0.98854613 Rpl3 3.02E−29 0.95035886 Ifi30 3.86E−31 0.94367272 Ctss 1.96E−36 0.9263954 Ms4a6c 1.93E−27 0.92525539 Rpl13 1.93E−36 0.92155671 Gm2000 2.79E−29 0.91412572 Rpl36 1.46E−34 0.90601989 Npc2 1.81E−37 0.90543998 Hbb.bs 1.21E−56 0.90237148 Rpl10 2.29E−32 0.90114946 Rpl6l 7.67E−30 0.89723592 Gadd45b 6.14E−28 0.89678617 Rpl10.ps3 4.39E−25 0.88550478 Rps2 3.29E−29 0.87992109 Nfkbia 2.61E−20 0.87797277 Rps18 4.31E−33 0.87172705 Rps26 4.63E−42 0.8637836 Fy86 6.30E−26 0.86188537 Rps18.ps3 4.28E−27 0.85840474 Rpl36a 5.60E−30 0.85396596 Nr4a1 1.09E−27 0.85097084 Bcl2a1b 5.78E−24 0.84031691 Gngt2 4.93E−24 0.83522978 Eef1a1 1.36E−39 0.82752842 Rpl6 4.69E−34 0.82517046 Rpl38 8.22E−38 0.82419269 Gm8730 1.05E−23 0.81940997 Rps8 1.66E−34 0.81578129 Gm9493 1.64E−24 0.81281843 Rps3a1 8.70E−44 0.81280181 Rpl37a 5.35E−43 0.80382163 Rps26.ps1 1.11E−27 0.80372161 Rplp0 4.69E−29 0.79806811 Cd74 1.85E−08 0.79648633 Rpl41 1.01E−43 0.7947976 Rpl36.ps3 6.66E−26 0.79400423 Ms4a4c 5.71E−21 0.78675019 Jun 1.90E−28 0.78582962 Mrpl52 2.30E−27 0.78193958 Rpl32 2.60E−35 0.77638992 Rpl39 6.26E−34 0.77568239 Dusp2 2.06E−20 0.77321474 Egr1 1.22E−21 0.76291146 Gm10263 1.87E−25 0.76214145 Rpl10a 2.65E−24 0.75716816 Ptma 2.24E−28 0.75663442 Rps5 1.05E−36 0.75538041 Rps19 8.07E−35 0.75515619 Arg1 1.86E−24 0.75150247 Npm1 6.65E−25 0.7473045 Ptgs2 5.72E−22 0.74607829 Ccl9 2.08E−22 0.7454576 Rps6 1.13E−33 0.74527209 Tpt1 6.47E−44 0.7411226 Rpl15 4.98E−21 0.73624045 Plac8 8.58E−15 0.73196268 AF251705 5.35E−26 0.72770461 Psap 8.41E−27 0.72341856 S100a4 7.49E−20 0.7232476 Rps7 1.18E−29 0.71643142 Zeb2 1.51E−23 0.71287178 Lgmn 8.55E−18 0.71276283 H2.DMa 2.50E−19 0.71180882 Rpl18 4.29E−33 0.71102361 Fcgr2b 9.17E−23 0.70124419 Rpl14 1.59E−27 0.69979376 Cstb 3.17E−26 0.69929037 Fam105a 7.52E−29 0.69777628 Sirpb1c 2.79E−29 0.69610617 Rpl13.ps3 2.13E−20 0.69454833 Ccl4 1.68E−26 0.69244263 Gm10076 8.36E−29 0.69078255 Rps15a 2.74E−26 0.68877511 Rps4x 2.31E−21 0.68728663 Wdr89 4.00E−30 0.67483321 Rpl22 2.46E−26 0.67158127 Rpsa 2.42E−23 0.67115186 Rpl26 5.74E−31 0.66920805 Lgals1 4.11E−19 0.66735198 Rplp2 7.05E−33 0.66287802 Zfos1 1.06E−26 0.66010764 Mif 4.26E−21 0.65069447 Rpl12 4.51E−20 0.64639865 Rpl8 4.77E−31 0.64505772 Mpeg1 1.01E−26 0.64502661 Rpl11 7.44E−28 0.64252281 H2.Aa 4.27E−10 0.63597788 Rpsl6 1.06E−39 0.63384376 Gm10036 8.46E−20 0.62902927 Rpl27 2.50E−28 0.6260205 Gm8186 2.84E−23 0.62370029 Gm10073 1.34E−21 0.62369916 Rpl24 4.86E−29 0.62179978 H2.DMb1 1.63E−17 0.62155345 Rpl13a 1.48E−37 0.61634273 Ms4a6b 1.28E−16 0.61488446 Rpl27a 1.35E−28 0.60666399 Sepw1 4.21E−17 0.60439946 Eef2 6.98E−20 0.59764163 Rpl36al 2.11E−23 0.59261293 Rpl23 1.51E−28 0.59246412 Mnda 2.27E−22 0.59128519 Rps23 2.26E−30 0.58868737 Rpl23a.ps3 6.57E−20 0.58828868 Rpl35a 1.64E−33 0.58826933 Eif3f 4.71E−21 0.585731 Gm2a 2.57E−21 0.58429497 Naca 3.80E−25 0.58346814 Rpl28 5.50E−25 0.58282448 mt.Nd1 2.06E−19 0.58251063 Atf3 5.88E−28 0.57996495 Gnb2l1 1.45E−21 0.57903078 Rps14 2.16E−32 0.57712655 Il1b 1.06E−09 0.57562682 Rpl18a 1.08E−33 0.57469482 Rpl5 1.78E−20 0.57265016 Clec4a3 4.17E−18 0.57087678 Rps17 4.69E−24 0.56850249 Snrpf 1.99E−19 0.56795291 Rps29 1.30E−29 0.56529953 Rpl27.ps3 1.46E−18 0.56424624 Ly6e 1.47E−19 0.55698497 Rpl30 5.53E−24 0.5523436 Rps3 3.74E−26 0.54944177 Rbm3 1.13E−20 0.54760898 Zfp36 6.89E−09 0.54492636 Rpl34 3.82E−26 0.54200003 Atp5g2 7.97E−18 0.54097147 Rps15 6.05E−24 0.53969603 Rps20 1.02E−19 0.53760995 Ifi204 5.70E−17 0.53734287 Gm10020 9.80E−16 0.53607152 Rps12.ps3 3.37E−16 0.5352634 Rpl7a 9.69E−18 0.53332554 Rps27rt 1.33E−28 0.52676178 Hspa8 7.70E−19 0.52638452 Snrpe 2.00E−18 0.52615373 Trem2 4.47E−16 0.52602986 Rps11 5.15E−23 0.52530681 Slc25a5 5.88E−19 0.52339524 Rpl29 5.51E−16 0.51838473 Rpl9.ps6 3.49E−19 0.51834878 Ms4a6d 3.18E−16 0.5164798 Ahnak 2.03E−19 0.51532816 Rpl9 3.87E−27 0.51339216 Rps27 4.17E−37 0.51193796 Lamp1 3.30E−19 0.51121099 Snx5 1.67E−16 0.51060085 Snrpg 1.81E−15 0.509988 Ly6i 8.05E−19 0.5090844 Rps24 1.82E−21 0.50875849 Ly6a 1.72E−14 0.50556657 Rps10 1.13E−23 0.50523422 Fabp5 2.74E−09 0.50453746 Eef1b2 6.61E−18 0.50385127 Ctsc 3.68E−13 0.49644715 Rplp1 6.22E−23 0.49514809 Rpl17 5.77E−28 0.49512814 Rpl19 6.26E−23 0.49291462 Cd14 5.20E−11 0.49192917 Mafb 7.76E−21 0.48826102 Ndufb5 5.52E−15 0.48581832 Unc93b1 3.73E−17 0.48528149 Ier5 7.74E−13 0.48441408 Rpl21 2.09E−21 0.4788783 H2.Ab1 2.14E−07 0.4784771 Crip1 3.47E−12 0.47840723 Rgs10 7.13E−15 0.47764148 S100a10 1.45E−13 0.47697262 Cxcl10 1.34E−11 0.4740744 Uba52 2.85E−16 0.47214738 Atox1 2.12E−20 0.47155515 Eif3e 6.56E−17 0.47056287 Rpl37 1.21E−30 0.47033308 Rpl23a 1.20E−19 0.46966524 Ifngr1 6.59E−14 0.46858856 Btf3 2.36E−18 0.46609376 Rps13 3.58E−25 0.46594685 Pcbp2 1.65E−15 0.46566539 Nme2 4.04E−19 0.464722 mt.Atp6 4.33E−16 0.46264825 Akr1a1 3.21E−14 0.46078126 Tgfb1 2.39E−14 0.46040141 Nfkbid 4.94E−13 0.45707073 Tgfbi 1.74E−17 0.45690979 Plekho1 6.00E−18 0.45656961 mt.Nd3 2.14E−14 0.45156535 Ifi27l2a 2.42E−15 0.44785084 Epsti1 7.71E−19 0.44767908 Eif4a1 5.01E−14 0.44552668 Bax 1.06E−18 0.44254673 Nupr1 4.33E−18 0.44166366 mt.Nd2 6.24E−13 0.44023555 Rassf4 1.96E−21 0.44015389 Ptafr 9.61E−13 0.43996599 Eif3i 5.59E−18 0.43983316 Ctsl 4.61E−16 0.43953562 Lrp1 3.20E−21 0.43725718 Hnrnpa1 6.26E−20 0.43723866 Gltscr2 6.29E−17 0.43702337 Mndal 6.38E−17 0.43665 Prdx2 1.49E−14 0.43604707 M6pr 6.97E−16 0.43500306 Hspe1 7.68E−13 0.43471358 Bcl2a1d 1.59E−14 0.43470395 Gm10269 3.98E−19 0.43350477 Erp29 1.07E−13 0.43307381 Rps21 3.33E−17 0.4304929 Pold4 5.66E−15 0.43024677 Pmaip1 3.14E−14 0.42990139 AI413582 3.67E−18 0.42822063 Gm11808 1.23E−13 0.42818777 Lair1 2.47E−18 0.42439025 Ier3 2.14E−10 0.42206107 Ctsa 1.81E−15 0.42099692 X2700060E02Rik 1.36E−17 0.42098569 Tnfaip3 2.93E−16 0.42065938 Dbi 8.51E−13 0.4176635 Tnfaip2 6.10E−11 0.41616843 Bri3 9.29E−12 0.41505823 Nsa2 1.20E−17 0.41385193 Bcl2a1a 4.68E−17 0.41114196 Bola2 2.91E−16 0.40979191 Lat2 5.26E−17 0.40900246 Rpl7 4.95E−15 0.40551303 Skil 4.62E−19 0.40541572 Lpl 7.44E−14 0.40499437 Ctsh 1.78E−11 0.40484743 Rps27l 6.34E−12 0.40420794 Serbp1 6.11E−14 0.40401301 Irf8 1.55E−16 0.40391491 mt.Nd4 2.57E−11 0.40192899 Naaa 5.59E−14 0.40118319 Pld4 1.47E−11 0.39701619 Rpl4 7.72E−12 0.39675635 Rps9 5.33E−30 0.39492821 Per1 4.84E−19 0.39323747 Zfp36l2 1.42E−08 0.39315085 Abi3 1.47E−15 0.39146944 Ndufc2 9.54E−12 0.38955655 Saa3 2.49E−11 0.38727196 Sf3b5 5.12E−13 0.38680828 Polr2e 3.17E−18 0.3867312 Ctsz 1.34E−11 0.38660295 Ssr4 3.23E−11 0.38587063 Polr2l 1.04E−15 0.38473846 Eef1d 5.74E−14 0.38354789 Rpl31 2.39E−14 0.37659561 Cd48 2.11E−12 0.37598964 Rps12 2.19E−13 0.37594793 Prep 8.57E−14 0.37511703 Aif1 5.25E−08 0.37335088 Eif3m 1.86E−16 0.37278339 Eif3k 1.55E−12 0.37234283 Irf2bp2 4.51E−15 0.37214214 Pkib 5.57E−21 0.36882789 AI607873 1.18E−16 0.36813025 Cox7a2l 9.96E−12 0.36698544 Mrpl30 2.61E−14 0.36620827 Atp2b1 1.74E−14 0.36606774 Tgif1 8.19E−18 0.36169098 Clec4n 2.64E−08 0.36117355 Slc25a3 5.55E−12 0.36049284 BC005537 4.99E−09 0.356889 Rpl7a.ps5 1.84E−12 0.35589902 Atp5c1 2.38E−11 0.35577277 Tmem176b 7.65E−07 0.3557493 Tomm20 2.30E−13 0.35570189 Nap1l1 8.70E−15 0.35540505 Ifi47 3.21E−15 0.35200683 Snrpb2 1.34E−12 0.35187709 Hbb.bt 5.61E−21 0.35136283 Gstp1 2.82E−18 0.35078439 Pnpla7 1.09E−13 0.34730775 Tubb5 5.39E−12 0.34631782 Pyhin1 3.90E−16 0.34620587 Clec4a1 4.52E−10 0.34264589 Ccnl1 1.19E−10 0.34135188 Hmgb1 9.66E−11 0.34081413 Ybx1 6.09E−11 0.3385658 mt.Co2 2.87E−10 0.338129 Eif3h 6.61E−10 0.33766722 Nme1 3.36E−12 0.33722605 St13 1.94E−13 0.33721847 Rps25 2.03E−16 0.33658237 Cmc1 2.14E−19 0.33584869 H1f0 8.75E−17 0.33316241 Anxa5 4.09E−10 0.33131992 Grn 1.23E−07 0.33043509 Rexo2 2.83E−15 0.33004147 Pgls 2.07E−13 0.32713514 Map3k1 2.03E−17 0.32660047 C3ar1 3.11E−11 0.32338722 Fcgr1 1.88E−09 0.32245126 Slc25a4 2.05E−16 0.32243686 Fosb 4.63E−14 0.32238838 Gm10260 2.13E−16 0.32141071 B3gnt8 1.67E−18 0.3207686 Echs1 2.54E−14 0.32042313 Bcl2l11 8.34E−16 0.31961154 Comt 3.15E−12 0.31959647 Cirbp 2.37E−14 0.31912946 F10 1.17E−18 0.31799603 Gm6133 2.56E−09 0.31758034 Asah1 3.89E−09 0.31685274 Polr1d 4.75E−09 0.31683627 Gsto1 1.58E−15 0.31631127 Tmem86a 1.73E−13 0.31493838 Qk 4.01E−13 0.31483676 Lgals3bp 7.82E−14 0.31376458 Fundc2 1.69E−15 0.31062057 Ppia 5.12E−10 0.3096689 Ccdc109b 5.56E−16 0.30956964 Fam174a 1.70E−11 0.30895763 Dek 2.23E−15 0.30803259 Rnf213 2.24E−15 0.30798455 Eef1g 1.51E−08 0.3078968 Sdc3 1.21E−14 0.30745524 Snrpd2 1.12E−11 0.30711669 Abcg1 6.05E−13 0.30590019 Irf7 5.17E−11 0.30574375 mt.Cytb 1.17E−09 0.30508207 mt.Co3 1.27E−12 0.30382104 Tsc22d3 2.45E−08 0.30362208 Cd302 1.00E−12 0.30277622 Gm4955 1.52E−12 0.30167697 Fau 5.35E−18 0.30077024 Tgm2 1.11E−11 0.30066465 Marcks 4.47E−08 0.30004833 AW112010 2.60E−06 0.29890841 Dexr 2.37E−16 0.29865505 Ecm1 3.44E−19 0.29819367 Klf10 7.89E−16 0.29809202 Gnpda1 3.11E−16 0.29595047 Mrpl54 2.81E−13 0.29566892 Gltp 7.05E−12 0.29535778 Arf4 3.03E−14 0.29482811 Slc43a2 3.24E−13 0.29444497 Lpxn 3.19E−18 0.29317957 Clta 1.56E−09 0.2927906 Cisd2 8.30E−13 0.2927779 Cdkn1a 8.88E−11 0.29192915 Arl4c 8.93E−13 0.29022512 Bcas2 7.33E−11 0.28940197 Ivns1abp 1.53E−13 0.28918336 Llph 1.12E−12 0.28860161 mt.Nd5 2.12E−10 0.28848098 Mrpl17 1.24E−11 0.28675437 Ms4a8a 6.42E−19 0.2863833 Sec61g 5.38E−09 0.28633092 Pddc1 6.76E−13 0.28611079 Amdhd2 1.08E−15 0.28607292 Hexb 8.98E−08 0.28492037 Sirpb1a 6.29E−16 0.28481663 Bst2 6.06E−07 0.2839835 Cct4 8.37E−13 0.28335034 Fam26f 1.97E−14 0.28316064 Dpysl2 2.63E−13 0.28229326 Ncl 2.28E−12 0.28181495 Zc3h12a 4.82E−09 0.28131843 Gdi2 4.89E−08 0.28117994 Tnf 4.91E−08 0.28027146 Atp5d 7.89E−08 0.27956578 Flcn 1.51E−16 0.27876183 Stra13 9.34E−12 0.2777716 Mrpl4 2.44E−16 0.27773583 Isg15 1.93E−08 0.27636886 Mef2a 2.86E−13 0.27544105 Mtdh 1.55E−09 0.27530715 Csf1 1.63E−13 0.27456959 X2010107E04Rik 1.06E−07 0.27330647 Cd93 2.62E−13 0.27263216 Dnajc19 2.82E−11 0.27222693 Itga4 3.58E−14 0.27154 Polr2g 1.25E−10 0.27126551 B2m 4.02E−13 0.2712007 Elk3 1.63E−11 0.27066616 Yy1 4.28E−12 0.27006136 Psma7 1.08E−07 0.26973296 Cuta 5.88E−12 0.26897942 Itm2c 2.39E−11 0.26878589 Hba.a2 4.02E−23 0.26852962 Evl 1.57E−12 0.2684975 Igfbp6 2.34E−09 0.26789718 Dhrs3 8.19E−11 0.26775037 Plk3 1.63E−11 0.2672776 Ndufa6 3.84E−08 0.26583434 X1600014C10Rik 4.70E−11 0.26512287 Trmt112 2.17E−10 0.2640664 Eif3j1 2.93E−11 0.26392096 Gns 4.38E−13 0.26292239 Pnp 1.01E−08 0.26250561 Fam20c 6.41E−16 0.26236639 Tifab 8.90E−14 0.26099479 Emg1 7.31E−12 0.26042088 Phf5a 1.19E−12 0.26024163 Rbm7 1.54E−14 0.25999311 Anxa4 2.02E−17 0.25971888 Gnas 6.51E−07 0.2595508 Ifi203 8.16E−10 0.25893923 Ppt2 6.96E−15 0.25717786 Mif4gd 3.54E−14 0.25653028 Pnrc2 7.67E−14 0.25613315 Tmem256 5.25E−07 0.25594164 Mrps24 1.70E−08 0.25549719 Npm3 6.78E−12 0.25464737 Trappc2l 1.36E−10 0.25431791 Atp5a1 2.25E−08 0.25398807 Hint1 4.95E−07 0.25344951 Psmb1 2.41E−09 0.25341123 Csf1r 1.63E−06 0.2533516 Srsf3 8.04E−07 0.25275942 Psmg4 1.61E−12 0.25233136 Eif3a 4.36E−12 0.25180541 Dnajc15 5.18E−12 0.25102069 Xist 1.55E−06 0.25086749
TABLE-US-00012 TABLE 12 Genes Downregulated in Neutrophils in Meninges of anti-CD49a Treated Mice Gene p_val avg_logFC Itm2b 1.84E−06 −0.3467123 Myl6 2.36E−08 −0.5112851 Shfm1 3.42E−08 −0.5471315 Lgals3 3.23E−07 −0.5711241 Lyz2 2.52E−11 −0.571991 Tkt 1.95E−07 −0.5757586 Actr3 6.32E−08 −0.6240156 Prdx5 1.01E−08 −0.6269279 Hp 1.82E−08 −0.649573 Apoe 2.30E−16 −0.6799873 mt.Co1 2.20E−11 −0.6989009 Trem3 3.63E−06 −0.7029397 Gda 1.49E−07 −0.703407 Capza1 5.22E−07 −0.7113132 Hk3 1.34E−06 −0.7242723 Sri 4.66E−07 −0.7245648 Ccnd3 9.67E−09 −0.7245672 Aldh2 8.05E−07 −0.7317524 Fpr2 3.05E−10 −0.7548722 Atxn10 6.31E−07 −0.7733475 Ly6c2 2.42E−09 −0.7896751 Tmcc1 7.28E−09 −0.7995845 Hmgn2 8.13E−07 −0.8084779 Arhgdib 1.20E−11 −0.8132104 Mrgpra2b 1.05E−06 −0.8261332 Ceacam10 7.02E−07 −0.8317525 Serpinb1a 1.17E−06 −0.8592986 Ltb4r1 7.63E−08 −0.8611326 Mgst2 7.34E−07 −0.8758051 Plaur 8.61E−07 −0.8791689 Sepp1 1.01E−10 −0.887687 Cd74 1.72E−13 −0.8997973 Prr13 1.32E−12 −0.901672 Cdkn2d 1.47E−08 −0.9065293 H2.Aa 2.43E−15 −0.9093922 Lmo4 3.37E−08 −0.9095078 Timp2 3.78E−09 −0.9347264 Mgl2 5.87E−07 −0.9463588 C1qb 2.22E−10 −0.9472063 Mrc1 1.77E−06 −0.9778767 Pglyrp1 7.17E−13 −0.9808341 Itgb2l 2.83E−07 −0.9842519 Dstn 1.04E−08 −1.0029117 H2.Ab1 2.17E−16 −1.0139576 Mgst1 1.20E−12 −1.0198348 Glrx 9.33E−11 −1.0440623 Cd177 3.17E−09 −1.055608 Adpgk 1.57E−09 −1.0690492 H2.Eb1 1.84E−11 −1.0714054 Cybb 5.34E−09 −1.087698 C1qa 9.69E−14 −1.0902225 Chil1 1.02E−10 −1.1041069 Lrg1 1.05E−13 −1.1538101 Ccl12 4.33E−09 −1.1695488 S100a8 1.80E−16 −1.1948886 S100a9 1.28E−16 −1.2264832 Anxa1 3.14E−15 −1.3592756 C1qc 4.36E−16 −1.3622972 Retnlg 4.27E−19 −1.4527536 Ccl8 1.85E−16 −1.5104426 Ifitm6 1.04E−16 −1.5185012 Wfdc21 4.61E−20 −1.7152159 Mmp8 1.92E−19 −1.7179759 Ly6g 1.14E−17 −1.7455808 Pf4 1.02E−19 −1.7913594 Lcn2 1.87E−23 −1.9541429 Ltf 2.31E−17 −2.1032831 Ngp 1.42E−25 −2.5248239 Camp 1.28E−27 −2.9299336
TABLE-US-00013 TABLE 13 Genes Downregulated in Neutrophils in Brain of anti-CD49a Treated Mice Gene p_val avg_logFC Ccno 2.65E−06 −0.2738811 Tyrobp 1.14E−12 −0.2765349 1−Sep 2.25E−06 −0.2851003 Gpx1 2.66E−06 −0.2886348 Olfml2b 3.10E−08 −0.2912001 Cd55 2.59E−06 −0.2941151 Gm1604a 6.95E−07 −0.313213 Tpm3 3.43E−06 −0.3294335 Ccl17 1.96E−06 −0.3295013 Eif1 7.93E−12 −0.3313038 Ubl5 3.55E−08 −0.3383655 Actr3 1.49E−06 −0.3453485 Tst 4.65E−08 −0.3472778 Gca 1.89E−06 −0.3509441 Sh3bgrl3 8.75E−15 −0.355514 Fcer1g 2.94E−22 −0.3642714 Cotl1 1.38E−10 −0.3644488 Oaz1 1.08E−11 −0.3658103 Serf2 9.53E−14 −0.3685677 Atp6v0e 1.36E−06 −0.3694543 Alox5ap 8.63E−13 −0.3744867 C5ar1 1.18E−07 −0.3760388 H3f3a 5.27E−15 −0.3809382 Lgals3 1.32E−07 −0.394717 Cd53 2.10E−09 −0.4008551 Tmem40 2.10E−06 −0.402431 Cep19 1.26E−06 −0.4050563 Megf9 8.52E−07 −0.4098612 Hdc 1.83E−09 −0.4174241 Atp6v1g1 1.40E−13 −0.4174588 X9830107B12Rik 8.93E−09 −0.4235807 Ifitm2 7.98E−07 −0.4239375 Ppp1r42 1.90E−10 −0.4292823 Cox17 4.14E−08 −0.4367966 Tspo 1.07E−08 −0.4421788 Cdc42 3.55E−14 −0.4476084 Cd52 4.36E−16 −0.4596892 Gnb2 8.65E−11 −0.4639089 Vsir 1.36E−09 −0.4641482 Arpc2 3.85E−15 −0.4650985 Eno1 4.30E−08 −0.4674324 Golim4 3.53E−06 −0.4684107 Spi1 1.04E−11 −0.4684381 Ankrd22 2.65E−06 −0.4753663 Cyba 3.22E−18 −0.491161 Arpc3 2.86E−18 −0.4936799 X2310001H17Rik 7.24E−07 −0.4953506 Atp6v1e1 2.91E−06 −0.4955607 Ppp1r18 3.58E−06 −0.4959528 X4933408B17Rik 1.13E−09 −0.5017587 Pet100 2.08E−07 −0.5055566 Gnai2 1.32E−16 −0.5073132 Kira17 4.60E−08 −0.5187677 Bmx 1.29E−06 −0.5229477 Ly6c2 1.41E−10 −0.5230278 Lrrk2 1.25E−08 −0.5397331 Fis1 6.09E−09 −0.5404619 Gpsm3 3.09E−11 −0.5433357 Crispld2 3.96E−08 −0.5487685 Ncf4 4.23E−07 −0.5515707 Tmsb4x 2.31E−39 −0.5521121 Cfl1 1.50E−24 −0.5555309 Mrgpra2a 7.53E−11 −0.5559796 Gpr27 1.18E−10 −0.5625554 Gm26917 1.98E−06 −0.5651023 Prok2 1.27E−06 −0.5655199 Myl12b 9.47E−12 −0.5660797 Cyfip2 6.16E−10 −0.5745562 Tinagl1 2.52E−10 −0.5778632 Capza1 9.25E−07 −0.580598 Osm 9.06E−07 −0.5809865 Nadk 2.05E−06 −0.5810601 Zyx 1.47E−08 −0.5830795 Lilrb4a 1.34E−10 −0.5836649 Slpr4 5.41E−13 −0.585887 Ccdc180 1.79E−06 −0.5876489 Cd63 9.77E−10 −0.5902601 Fam65b 2.49E−06 −0.5909863 Pabpc1l 1.79E−11 −0.5919356 Iqgap1 1.48E−09 −0.5945848 Slc27a4 8.59E−08 −0.5953537 Rab3d 2.44E−07 −0.6000699 Lsp1 3.05E−17 −0.602176 Msrb1 1.78E−18 −0.6036536 Stk39 7.05E−13 −0.6061084 Pilra 1.36E−13 −0.6082663 Scrg1 2.79E−13 −0.6111041 Actg1 3.00E−30 −0.6234706 Gapdh 8.90E−17 −0.6266962 Adam8 7.41E−07 −0.6281612 Shfm1 1.42E−25 −0.6292129 Mxd1 3.59E−11 −0.6378963 Syne1 5.28E−13 −0.639095 St3gal5 6.59E−07 −0.6391293 Ccl8 9.15E−23 −0.6400125 C1qc 4.66E−14 −0.6416385 Scp2 1.48E−07 −0.6439638 X1700047M11Rik 5.62E−13 −0.6467846 Rdh12 2.20E−10 −0.6469699 Coro1a 1.53E−25 −0.6549073 Cd209f 4.86E−08 −0.6563716 Xdh 3.64E−07 −0.6586771 Mpc2 1.57E−07 −0.663464 Cd81 3.02E−09 −0.6635554 Hk3 6.01E−09 −0.6673921 C1qa 1.24E−16 −0.673834 Hsd11b1 2.88E−12 −0.6794722 B230208H11Rik 8.8OE−13 −0.6801641 Ldha 3.30E−09 −0.6825935 Unc119 3.23E−07 −0.6843834 Mgl2 3.10E−07 −0.6927752 Aldoa 1.10E−20 −0.6938609 Lbr 1.89E−07 −0.7001391 Arpc5 1.25E−22 −0.703563 Gm10282 8.47E−09 −0.7088609 Fcrls 3.20E−10 −0.7127892 Rnf144a 2.02E−11 −0.7137474 X1110008F13Rik 3.24E−15 −0.7204102 Tecr 7.95E−07 −0.7286357 Lilr4b 1.52E−12 −0.7291511 Flot1 4.29E−08 −0.7349339 Dhrs7 4.87E−15 −0.7407431 Lcp1 7.17E−25 −0.7426167 Sri 2.03E−12 −0.7472529 Flna 3.46E−11 −0.749235 Limd2 4.49E−16 −0.7500331 Alox5 6.26E−11 −0.7534523 Itgb2 3.55E−19 −0.7558419 Ncf1 8.29E−15 −0.7563511 Triobp 5.02E−12 −0.7681859 Cd24a 9.44E−18 −0.7746612 Lasp1 3.23E−08 −0.7754124 Plaur 6.37E−10 −0.7865317 Msra 4.63E−11 −0.789573 Sell 3.29E−11 −0.7922012 Ccl12 1.66E−10 −0.7937523 Rasgrp2 1.42E−07 −0.797943 Gmfg 9.80E−29 −0.7983013 AA467197 1.21E−06 −0.803601 Mettl9 6.79E−10 −0.8082325 Pfn1 2.37E−40 −0.8088777 Myl6 1.84E−36 −0.8093836 Pram1 2.44E−13 −0.817607 Pkm 1.50E−26 −0.8230565 Gpi1 2.85E−17 −0.8230798 Il1f9 6.38E−21 −0.8298498 Mrpl33 6.01E−29 −0.8463777 Degs1 3.14E−11 −0.8490231 Grina 2.41E−16 −0.855234 Timp2 1.38E−14 −0.8614557 Aldh2 1.39E−14 −0.8676256 Ostf1 8.27E−30 −0.8684213 Cdkn2d 2.18E−13 −0.8701764 Atxn10 1.81E−13 −0.8780172 Mapk13 1.89E−15 −0.8782322 Ccnd3 3.21E−14 −0.8788046 Vasp 1.40E−23 −0.8806605 Ltb4r1 9.18E−12 −0.8808808 Pgd 1.35E−21 −0.8886128 Nfe2 9.45E−15 −0.893519 Pnkp 6.84E−14 −0.9014237 Lmo4 1.27E−13 −0.9023597 Actb 2.33E−19 −0.9088269 Txn1 4.64E−31 −0.9114281 Taldo1 2.37E−30 −0.9120236 Actn1 1.36E−14 −0.9140751 Max 8.49E−10 −0.9158238 Cxcr2 1.72E−15 −0.9170293 Cebpe 3.52E−12 −0.9262342 Mrgpra2b 6.29E−21 −0.9409811 Plp2 1.36E−20 −0.9441579 Anxa11 3.97E−15 −0.9472993 Fpr1 2.57E−14 −0.9591607 Tkt 1.69E−21 −0.9794108 Pygl 7.55E−20 −0.9827099 Dgat1 1.6OE−16 −0.9882231 Prdx5 1.75E−35 −1.0140241 Asprv1 1.07E−07 −1.0142876 Mgst2 3.35E−21 −1.0148273 Rac2 1.94E−33 −1.017885 Fam101b 3.34E−18 −1.0202052 Hmgb2 1.59E−26 −1.025282 Gsr 6.88E−3O −1.0263222 Glipr2 1.26E−17 −1.02669 Padi4 5.43E−19 −1.0347502 Pi16 1.82E−17 −1.0442386 Slc2a3 4.95E−19 −1.0504712 Trem3 9.73E−20 −1.0512713 Itgb2l 1.01E−20 −1.0517592 Serpinb1a 5.62E−18 −1.0547502 Hcst 1.01E−24 −1.0662812 Ceacam10 1.78E−22 −1.0666733 Tmcc1 1.38E−26 −1.0702161 Chil1 9.97E−25 −1.0707168 R3hdm4 5.37E−25 −1.078889 Ckap4 8.17E−17 −1.086595 Anxa2 1.05E−34 −1.120058 Gda 2.29E−25 −1.1374218 Arhgdib 3.07E−41 −1.1383099 Cd9 4.96E−28 −1.1783892 Dstn 5.86E−17 −1.1928566 Glrx 3.47E−25 −1.1985145 Gadd45a 5.01E−25 −1.2027462 Cnn2 1.16E−28 −1.2264219 Pf4 3.35E−33 −1.2679102 Hmgn2 4.28E−29 −1.3057563 Fpr2 3.87E−30 −1.3205548 Adpgk 3.21E−27 −1.3938158 S100a6 1.43E−44 −1.400967 Stfa2l1 2.03E−06 −1.4506312 Slpi 7.64E−38 −1.4514155 Mcemp1 1.27E−38 −1.453741 Mgst1 1.19E−33 −1.4878819 Prr13 1.20E−44 −1.4946458 Hp 1.05E−49 −1.5484988 S100a11 4.35E−48 −1.5629079 Mmp9 5.37E−49 −1.6808594 Cd177 1.61E−31 −1.7539383 Lrg1 1.10E−46 −1.8441386 Anxa1 1.94E−48 −2.0784718 Ly6g 2.18E−50 −2.1245872 Pglyrp1 1.05E−58 −2.3238468 Retnlg 4.63E−60 −2.4944767 Mmp8 5.05E−61 −2.5122499 S100a8 1.11E−62 −2.5474235 Ifitm6 1.14E−51 −2.5843405 S100a9 9.37E−64 −2.6660066 Wfdc21 1.27E−62 −2.7474632 Lcn2 1.72E−65 −3.182155 Ltf 1.39E−53 −3.8500598 Ngp 5.56E−74 −4.977874 Camp 4.69E−76 −5.2082909