HtrA Inhibitors and CagA Inhibitors and Use Thereof
20220122691 · 2022-04-21
Assignee
Inventors
- Zachary Apte (San Francisco, CA)
- Jessica Richman (San Francisco, CA)
- Daniel Almonacid (San Francisco, CA)
- Valeria Marquez (San Francisco, CA, US)
Cpc classification
C07D273/02
CHEMISTRY; METALLURGY
A01N47/24
HUMAN NECESSITIES
A01N43/30
HUMAN NECESSITIES
A01N43/64
HUMAN NECESSITIES
G16B15/30
PHYSICS
C07D401/12
CHEMISTRY; METALLURGY
A01N43/86
HUMAN NECESSITIES
C07C317/14
CHEMISTRY; METALLURGY
C07D211/26
CHEMISTRY; METALLURGY
A01N43/713
HUMAN NECESSITIES
A01N43/84
HUMAN NECESSITIES
A01N53/00
HUMAN NECESSITIES
A01N43/90
HUMAN NECESSITIES
International classification
Abstract
The present application relates to new HtrA inhibitors and use thereof. Additionally, the present application also relates to new peptides for inhibiting CagA and use thereof.
Claims
1. A formulation in pharmaceutically acceptable form suitable for administration to a patient containing an excipient and a HtrA inhibitor having Formula (I): ##STR00747## wherein: R.sub.1 is H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence selected from the groups listed in Table 1; R.sub.2 is H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; R.sub.3 is H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)alkylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; R.sub.4 is H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)alkylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; R.sub.5 is H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)alkylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; R.sub.6 is H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)alkylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; R.sup.w at each occurrence is independently H, halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10) cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10)heterocyclo, —(CH.sub.2).sub.n-aryl, —(CH.sub.2).sub.n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
2. The formulation of claim 1, wherein R.sub.1 is selected from the groups listed in Table 1; R.sub.2 is selected from the groups listed in Table 2; R.sub.3 is selected from the groups listed in Table 3; R.sub.4 is selected from the groups listed in Table 4; R.sub.5 is selected from the groups listed in Table 5; and R.sub.6 is selected from the groups listed in Table 6.
3. The formulation of claim 1, wherein the HtrA inhibitor is selected from the group consisting of: N′-benzyl-N-[2-[(2R)-1-(4-methylphenyl)sulfonylpiperidin-2-yl]ethyl]oxamide; 1-[2-[methyl(naphthalen-2-ylsulfonyl)amino]acetyl]piperidine-4-carboxamide; 8-(4-methylphenyl)sulfonyl-4-(2,4,6-trimethylphenyl)sulfonyl-1-oxa-4,8-diazaspiro[4.5]decane; N-{1-[2-(2-Biphenylyloxy)ethyl]-3-pyrrolidinyl}-3,4-difluorobenzenesulfonamide; 1-(2-Anthrylsulfonyl)-3-piperidinecarboxylic acid; (3S)-1-Carbamimidoyl-N-({(2S)-1-[N-(2-naphthylsulfonyl)glycyl]-2-pyrrolidinyl}methyl)-3-piperidinecarboxamide; (3S)-1-Carbamimidoyl-N-({(2S)-1-[N-(2-naphthylsulfonyl)-L-alanyl]-2-pyrrolidinyl}methyl)-3-piperidinecarboxamide; Cyclohexyl[4-(1-naphthylsulfonyl)-2-(trifluoromethyl)-1-piperazinyl]methanone; and 2-[(8S,11R)-11-{(1R)-1-hydroxy-2-[(3-methylbutyl)(phenylsulfonyl)amino]ethyl}-6,9-dioxo-2-oxa-7,10-diazabicyclo[11.2.2]heptadeca-1(15),13,16-trien-8-yl]acetamide.
4. A method of treating a bacterial infection comprising administering a pharmaceutically effective amount of the HtrA inhibitor of claim 1 to a human subject in need thereof.
5. The method of claim 4, wherein the bacterial infection is a Helicobacter pylori infection.
6. A CagA inhibitor having the sequence of X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12; wherein: X.sub.1 is D, R, H, I, F, P, W, or Y; X.sub.2 is T or N; X.sub.3 is D, N, or Y; X.sub.4 is P, E, L, or Y; X.sub.5 is T, R, or L; X.sub.6 is A or S; X.sub.7 is P, R, E, I, or L; X.sub.8 is P, I, L, or W; X.sub.9 is F, or Y; X.sub.10 is D, F, or W; X.sub.11 is S, A, D, E, H, I, L, or Y; and X.sub.12 is L, A, N, W, or Y.
7. The CagA inhibitor of claim 6, having the sequence of DTDPTAPPYDSL.
8. The CagA inhibitor of claim 6, having the sequence listed in Table 13.
9. A CagA inhibitor having the sequence at least 80% identity to any of the sequence of SEQ ID NOs: 1-38, listed in Table 13.
10. A method of treating gastric cancer comprising administering a pharmaceutically effective amount of the CagA inhibitor of claim 6 to a human subject in need thereof.
11. A method of inhibiting, down-regulating, reducing and/or killing pathogenic bacteria comprising steps of: a. Screening a microorganism that produces an antibacterial compound; b. Conducting structural analysis of the antibacterial compound; c. Modifying the antibacterial compound to improve the affinity to target bacteria.
12. The method of claim 11, wherein BLAST, FASTA or CLUSTAL is used for sequence analysis in step a).
13. The method of claim 11, wherein at least one amino acid of the antibacterial compound is mutated in step c).
14. The method of claim 11, where the structural analysis is performed using solvent-accessible surface area.
15. The method of claim 11, wherein the antibacterial compound is Salivaricin A, Ruminococcin A, or Bacteriocin staphylococcus 188.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
DETAILED DESCRIPTION OF THE DISCLOSURE
Definition
[0068] The articles “a” and “an” as used herein and in the appended claims are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article unless the context clearly indicates otherwise. By way of example, “an element” means one element or more than one element.
[0069] “” indicates the double bond in E or Z configuration.
[0070] The term “H” denotes a single hydrogen atom. This radical may be attached, for example, to an oxygen atom to form a hydroxyl radical.
[0071] Where the term “alkyl” is used, either alone or within other terms such as “haloalkyl” or “alkylamino”, it embraces linear or branched radicals having one to about twelve carbon atoms. More preferred alkyl radicals are “lower alkyl” radicals having one to about six carbon atoms. Examples of such radicals include methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isoamyl, hexyl and the like. Even more preferred are lower alkyl radicals having one or two carbon atoms. The term “alkylenyl” or “alkylene” embraces bridging divalent alkyl radicals such as methylenyl or ethylenyl. The term “lower alkyl substituted with R.sup.2” does not include an acetal moiety. The term “alkyl” further includes alkyl radicals wherein one or more carbon atoms in the chain is substituted with a heteroatom selected from oxygen, nitrogen, or sulfur.
[0072] The term “alkenyl” embraces linear or branched radicals having at least one carbon-carbon double bond of two to about twelve carbon atoms. More preferred alkenyl radicals are “lower alkenyl” radicals having two to about six carbon atoms. Most preferred lower alkenyl radicals are radicals having two to about four carbon atoms. Examples of alkenyl radicals include ethenyl, propenyl, allyl, propenyl, butenyl and 4-methylbutenyl. The terms “alkenyl” and “lower alkenyl”, embrace radicals having “cis” and “trans” orientations, or alternatively, “E” and “Z” orientations.
[0073] The term “alkynyl” denotes linear or branched radicals having at least one carbon-carbon triple bond and having two to about twelve carbon atoms. More preferred alkynyl radicals are “lower alkynyl” radicals having two to about six carbon atoms. Most preferred are lower alkynyl radicals having two to about four carbon atoms. Examples of such radicals include propargyl, and butynyl, and the like.
[0074] Alkyl, alkylenyl, alkenyl, and alkynyl radicals may be optionally substituted with one or more functional groups such as halo, hydroxy, nitro, amino, cyano, haloalkyl, aryl, heteroaryl, and heterocyclo and the like.
[0075] The term “halo” means halogens such as fluorine, chlorine, bromine or iodine atoms.
[0076] The term “haloalkyl” embraces radicals wherein any one or more of the alkyl carbon atoms is substituted with halo as defined above. Specifically embraced are monohaloalkyl, dihaloalkyl and polyhaloalkyl radicals including perhaloalkyl. A monohaloalkyl radical, for example, may have either an iodo, bromo, chloro or fluoro atom within the radical. Dihalo and polyhaloalkyl radicals may have two or more of the same halo atoms or a combination of different halo radicals. “Lower haloalkyl” embraces radicals having 1 to 6 carbon atoms. Even more preferred are lower haloalkyl radicals having one to three carbon atoms. Examples of haloalkyl radicals include fluoromethyl, difluoromethyl, trifluoromethyl, chloromethyl, dichloromethyl, trichloromethyl, pentafluoroethyl, heptafluoropropyl, difluorochloromethyl, dichlorofluoromethyl, difluoroethyl, difluoropropyl, dichloroethyl and dichloropropyl.
[0077] The term “perfluoroalkyl” means alkyl radicals having all hydrogen atoms replaced with fluoro atoms. Examples include trifluoromethyl and pentafluoroethyl.
[0078] The term “hydroxyalkyl” embraces linear or branched alkyl radicals having one to about ten carbon atoms any one of which may be substituted with one or more hydroxyl radicals. More preferred hydroxyalkyl radicals are “lower hydroxyalkyl” radicals having one to six carbon atoms and one or more hydroxyl radicals. Examples of such radicals include hydroxymethyl, hydroxyethyl, hydroxypropyl, hydroxybutyl and hydroxyhexyl. Even more preferred are lower hydroxyalkyl radicals having one to three carbon atoms.
[0079] The term “alkoxy” embraces linear or branched oxy-containing radicals each having alkyl portions of one to about ten carbon atoms. More preferred alkoxy radicals are “lower alkoxy” radicals having one to six carbon atoms. Examples of such radicals include methoxy, ethoxy, propoxy, butoxy and tert-butoxy. Even more preferred are lower alkoxy radicals having one to three carbon atoms. Alkoxy radicals may be further substituted with one or more halo atoms, such as fluoro, chloro or bromo, to provide “haloalkoxy” radicals. Even more preferred are lower haloalkoxy radicals having one to three carbon atoms. Examples of such radicals include fluoromethoxy, chloromethoxy, trifluoromethoxy, trifluoroethoxy, fluoroethoxy and fluoropropoxy.
[0080] The term “aryl”, alone or in combination, means a carbocyclic aromatic system containing one or two rings, wherein such rings may be attached together in a fused manner. The term “aryl” embraces aromatic radicals such as phenyl, naphthyl, indenyl, tetrahydronaphthyl, and indanyl. More preferred aryl is phenyl. An “aryl” group may have 1 or more substituents such as lower alkyl, hydroxyl, halo, haloalkyl, nitro, cyano, alkoxy, and lower alkylamino, and the like. Phenyl substituted with —O—CH.sub.2—O— forms the aryl benzodioxolyl substituent.
[0081] The term “heterocyclyl” (or “heterocyclo”) embraces saturated, partially saturated and unsaturated heteroatom-containing ring radicals, where the heteroatoms may be selected from nitrogen, sulfur and oxygen. It does not include rings containing —O—O—,—O—S— or —S—S— portions. The “heterocyclyl” group may have 1 to 4 substituents such as hydroxyl, Boc, halo, haloalkyl, cyano, lower alkyl, lower aralkyl, oxo, lower alkoxy, amino and lower alkylamino.
[0082] Examples of saturated heterocyclic radicals include saturated 3 to 6-membered heteromonocyclic groups containing 1 to 4 nitrogen atoms [e.g., pyrrolidinyl, imidazolidinyl, piperidinyl, pyrrolinyl, piperazinyl]; saturated 3 to 6-membered heteromonocyclic group containing 1 to 2 oxygen atoms and 1 to 3 nitrogen atoms [e.g., morpholinyl]; saturated 3 to 6-membered heteromonocyclic group containing 1 to 2 sulfur atoms and 1 to 3 nitrogen atoms [e.g., thiazolidinyl]. Examples of partially saturated heterocyclyl radicals include dihydrothienyl, dihydropyranyl, dihydrofuryl and dihydrothiazolyl.
[0083] Examples of unsaturated heterocyclic radicals, also termed “heteroaryl” radicals, include unsaturated 5 to 6 membered heteromonocyclyl group containing 1 to 4 nitrogen atoms, for example, pyrrolyl, imidazolyl, pyrazolyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, pyrimidyl, pyrazinyl, pyridazinyl, triazolyl [e.g., 4H-1,2,4-triazolyl, 1H-1,2,3-triazolyl, 2H-1,2,3-triazolyl]; unsaturated 5- to 6-membered heteromonocyclic group containing an oxygen atom, for example, pyranyl, 2-furyl, 3-furyl, etc.; unsaturated 5 to 6-membered heteromonocyclic group containing a sulfur atom, for example, 2-thienyl, 3-thienyl, etc.; unsaturated 5- to 6-membered heteromonocyclic group containing 1 to 2 oxygen atoms and 1 to 3 nitrogen atoms, for example, oxazolyl, isoxazolyl, oxadiazolyl [e.g., 1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl, 1,2,5-oxadiazolyl]; unsaturated 5 to 6-membered heteromonocyclic group containing 1 to 2 sulfur atoms and 1 to 3 nitrogen atoms, for example, thiazolyl, thiadiazolyl [e.g., 1,2,4-thiadiazolyl, 1,3,4-thiadiazolyl, 1,2,5-thiadiazolyl].
[0084] The term heterocyclyl, (or heterocyclo) also embraces radicals where heterocyclic radicals are fused/condensed with aryl radicals: unsaturated condensed heterocyclic group containing 1 to 5 nitrogen atoms, for example, indolyl, isoindolyl, indolizinyl, benzimidazolyl, quinolyl, isoquinolyl, indazolyl, benzotriazolyl, tetrazolopyridazinyl [e.g., tetrazolo [1,5-b]pyridazinyl]; unsaturated condensed heterocyclic group containing 1 to 2 oxygen atoms and 1 to 3 nitrogen atoms [e.g. benzoxazolyl, benzoxadiazolyl]; unsaturated condensed heterocyclic group containing 1 to 2 sulfur atoms and 1 to 3 nitrogen atoms [e.g., benzothiazolyl, benzothiadiazolyl]; and saturated, partially unsaturated and unsaturated condensed heterocyclic group containing 1 to 2 oxygen or sulfur atoms [e.g. benzofuryl, benzothienyl, 2,3-dihydro-benzo[1,4]dioxinyl and dihydrobenzofuryl]. Preferred heterocyclic radicals include five to ten membered fused or unfused radicals. More preferred examples of heteroaryl radicals include quinolyl, isoquinolyl, imidazolyl, pyridyl, thienyl, thiazolyl, oxazolyl, furyl and pyrazinyl. Other preferred heteroaryl radicals are 5- or 6-membered heteroaryl, containing one or two heteroatoms selected from sulfur, nitrogen and oxygen, selected from thienyl, furyl, pyrrolyl, indazolyl, pyrazolyl, oxazolyl, triazolyl, imidazolyl, pyrazolyl, isoxazolyl, isothiazolyl, pyridyl, piperidinyl and pyrazinyl.
[0085] Particular examples of non-nitrogen containing heteroaryl include pyranyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, benzofuryl, and benzothienyl, and the like.
[0086] Particular examples of partially saturated and saturated heterocyclyl include pyrrolidinyl, imidazolidinyl, piperidinyl, pyrrolinyl, pyrazolidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, thiazolidinyl, dihydrothienyl, 2,3-dihydro-benzo[1,4]dioxanyl, indolinyl, isoindolinyl, dihydrobenzothienyl, dihydrobenzofuryl, isochromanyl, chromanyl, 1,2-dihydroquinolyl, 1,2,3,4-tetrahydro-isoquinolyl, 1,2,3,4-tetrahydro-quinolyl, 2,3,4,4a,9,9a-hexahydro-1H-3-aza-fluorenyl, 5,6,7-trihydro-1,2,4-triazolo[3,4-a]isoquinolyl, 3,4-dihydro-2H-benzo[1,4]oxazinyl, benzo[1,4]dioxanyl, 2,3-dihydro-1H-1λ′-benzo[d]isothiazol-6-yl, dihydropyranyl, dihydrofuryl and dihydrothiazolyl, and the like.
[0087] The term “heterocyclo” thus encompasses the following ring systems:
##STR00002## ##STR00003## ##STR00004##
and the like.
[0088] The term “sulfonyl”, whether used alone or linked to other terms such as alkylsulfonyl, denotes respectively divalent radicals —SO.sub.2—.
[0089] The terms “sulfamyl,” “aminosulfonyl” and “sulfonamidyl,” denotes a sulfonyl radical substituted with an amine radical, forming a sulfonamide (—SO.sub.2NH.sub.2).
[0090] The term “alkylaminosulfonyl” includes “N-alkylaminosulfonyl” where sulfamyl radicals are independently substituted with one or two alkyl radical(s). More preferred alkylaminosulfonyl radicals are “lower alkylaminosulfonyl” radicals having one to six carbon atoms. Even more preferred are lower alkylaminosulfonyl radicals having one to three carbon atoms. Examples of such lower alkylaminosulfonyl radicals include N-methylaminosulfonyl, and N-ethylaminosulfonyl.
[0091] The terms “carboxy” or “carboxyl,” whether used alone or with other terms, such as “carboxyalkyl,” denotes —CO.sub.2H.
[0092] The term “carbonyl,” whether used alone or with other terms, such as “aminocarbonyl,” denotes —(C═O)—.
[0093] The term “aminocarbonyl” denotes an amide group of the formula C(═O)NH.sub.2.
[0094] The terms “N-alkylaminocarbonyl” and “N,N-dialkylaminocarbonyl” denote aminocarbonyl radicals independently substituted with one or two alkyl radicals, respectively. More preferred are “lower alkylaminocarbonyl” having lower alkyl radicals as described above attached to an aminocarbonyl radical.
[0095] The terms “N-arylaminocarbonyl” and “N-alkyl-N-arylaminocarbonyl” denote aminocarbonyl radicals substituted, respectively, with one aryl radical, or one alkyl and one aryl radical.
[0096] The terms “heterocyclylalkylenyl” and “heterocyclylalkyl” embrace heterocyclic-substituted alkyl radicals. More preferred heterocyclylalkyl radicals are “5- or 6-membered heteroarylalkyl” radicals having alkyl portions of one to six carbon atoms and a 5- or 6-membered heteroaryl radical. Even more preferred are lower heteroarylalkylenyl radicals having alkyl portions of one to three carbon atoms. Examples include such radicals as pyridylmethyl and thienylmethyl.
[0097] The term “aralkyl” embraces aryl-substituted alkyl radicals. Preferable aralkyl radicals are “lower aralkyl” radicals having aryl radicals attached to alkyl radicals having one to six carbon atoms. Even more preferred are “phenylalkylenyl” attached to alkyl portions having one to three carbon atoms. Examples of such radicals include benzyl, diphenylmethyl and phenylethyl. The aryl in said aralkyl may be additionally substituted with halo, alkyl, alkoxy, halkoalkyl and haloalkoxy.
[0098] The term “alkylthio” embraces radicals containing a linear or branched alkyl radical, of one to ten carbon atoms, attached to a divalent sulfur atom. Even more preferred are lower alkylthio radicals having one to three carbon atoms. An example of “alkylthio” is methylthio, (CH.sub.3S—).
[0099] The term “haloalkylthio” embraces radicals containing a haloalkyl radical, of one to ten carbon atoms, attached to a divalent sulfur atom. Even more preferred are lower haloalkylthio radicals having one to three carbon atoms. An example of “haloalkylthio” is trifluoromethylthio.
[0100] The term “alkylamino” embraces “N-alkylamino” and “N,N-dialkylamino” where amino groups are independently substituted with one alkyl radical and with two alkyl radicals, respectively. More preferred alkylamino radicals are “lower alkylamino” radicals having one or two alkyl radicals of one to six carbon atoms, attached to a nitrogen atom. Even more preferred are lower alkylamino radicals having one to three carbon atoms. Suitable alkylamino radicals may be mono or dialkylamino such as N-methylamino, N-ethylamino, N,N-dimethylamino, and N,N-diethylamino, and the like.
[0101] The term “arylamino” denotes amino groups, which have been substituted with one or two aryl radicals, such as N-phenylamino. The arylamino radicals may be further substituted on the aryl ring portion of the radical.
[0102] The term “heteroarylamino” denotes amino groups, which have been substituted with one or two heteroaryl radicals, such as N-thienylamino. The “heteroarylamino” radicals may be further substituted on the heteroaryl ring portion of the radical.
[0103] The term “aralkylamino” denotes amino groups, which have been substituted with one or two aralkyl radicals. More preferred are phenyl-C.sub.1-C.sub.3-alkylamino radicals, such as N-benzylamino. The aralkylamino radicals may be further substituted on the aryl ring portion.
[0104] The terms “N-alkyl-N-arylamino” and “N-aralkyl-N-alkylamino” denote amino groups, which have been independently substituted with one aralkyl and one alkyl radical, or one aryl and one alkyl radical, respectively, to an amino group.
[0105] The term “aminoalkyl” embraces linear or branched alkyl radicals having one to about ten carbon atoms any one of which may be substituted with one or more amino radicals. More preferred aminoalkyl radicals are “lower aminoalkyl” radicals having one to six carbon atoms and one or more amino radicals. Examples of such radicals include aminomethyl, aminoethyl, aminopropyl, aminobutyl and aminohexyl. Even more preferred are lower aminoalkyl radicals having one to three carbon atoms.
[0106] The term “alkylaminoalkyl” embraces alkyl radicals substituted with alkylamino radicals. More preferred alkylaminoalkyl radicals are “lower alkylaminoalkyl” radicals having alkyl radicals of one to six carbon atoms. Even more preferred are lower alkylaminoalkyl radicals having alkyl radicals of one to three carbon atoms. Suitable alkylaminoalkyl radicals may be mono or dialkyl substituted, such as N-methylaminomethyl, N,N-dimethyl-aminoethyl, and N,N-diethylaminomethyl, and the like.
[0107] The term “alkylaminoalkoxy” embraces alkoxy radicals substituted with alkylamino radicals. More preferred alkylaminoalkoxy radicals are “lower alkylaminoalkoxy” radicals having alkoxy radicals of one to six carbon atoms. Even more preferred are lower alkylaminoalkoxy radicals having alkyl radicals of one to three carbon atoms. Suitable alkylaminoalkoxy radicals may be mono or dialkyl substituted, such as N-methylaminoethoxy, N,N-dimethylaminoethoxy, and N,N-diethylaminoethoxy, and the like.
[0108] The term “alkylaminoalkoxyalkoxy” embraces alkoxy radicals substituted with alkylaminoalkoxy radicals. More preferred alkylaminoalkoxyalkoxy radicals are “lower alkylaminoalkoxyalkoxy” radicals having alkoxy radicals of one to six carbon atoms. Even more preferred are lower alkylaminoalkoxyalkoxy radicals having alkyl radicals of one to three carbon atoms. Suitable alkylaminoalkoxyalkoxy radicals may be mono or dialkyl substituted, such as N-methylaminomethoxyethoxy, N-methylaminoethoxyethoxy, N,N-dimethylaminoethoxyethoxy, and N,N-diethylaminomethoxymethoxy, and the like.
[0109] The term “carboxyalkyl” embraces linear or branched alkyl radicals having one to about ten carbon atoms any one of which may be substituted with one or more carboxy radicals. More preferred carboxyalkyl radicals are “lower carboxyalkyl” radicals having one to six carbon atoms and one carboxy radical. Examples of such radicals include carboxymethyl, and carboxypropyl, and the like. Even more preferred are lower carboxyalkyl radicals having one to three CH.sub.2 groups.
[0110] The term “halosulfonyl” embraces sulfonyl radicals substituted with a halogen radical. Examples of such halosulfonyl radicals include chlorosulfonyl and fluorosulfonyl.
[0111] The term “arylthio” embraces aryl radicals of six to ten carbon atoms, attached to a divalent sulfur atom. An example of “arylthio” is phenylthio.
[0112] The term “aralkylthio” embraces aralkyl radicals as described above, attached to a divalent sulfur atom. More preferred are phenyl-C.sub.1-C.sub.3-alkylthio radicals. An example of “aralkylthio” is benzylthio.
[0113] The term “aryloxy” embraces optionally substituted aryl radicals, as defined above, attached to an oxygen atom. Examples of such radicals include phenoxy.
[0114] The term “aralkoxy” embraces oxy-containing aralkyl radicals attached through an oxygen atom to other radicals. More preferred aralkoxy radicals are “lower aralkoxy” radicals having optionally substituted phenyl radicals attached to lower alkoxy radical as described above.
[0115] The term “heteroaryloxy” embraces optionally substituted heteroaryl radicals, as defined above, attached to an oxygen atom.
[0116] The term “heteroarylalkoxy” embraces oxy-containing heteroarylalkyl radicals attached through an oxygen atom to other radicals. More preferred heteroarylalkoxy radicals are “lower heteroarylalkoxy” radicals having optionally substituted heteroaryl radicals attached to lower alkoxy radical as described above.
[0117] The term “cycloalkyl” includes saturated carbocyclic groups. Preferred cycloalkyl groups include C.sub.3-C.sub.6 rings. More preferred compounds include, cyclopentyl, cyclopropyl, and cyclohexyl.
[0118] The term “cycloalkylalkyl” embraces cycloalkyl-substituted alkyl radicals. Preferable cycloalkylalkyl radicals are “lower cycloalkylalkyl” radicals having cycloalkyl radicals attached to alkyl radicals having one to six carbon atoms. Even more preferred are “5 to 6-membered cycloalkylalkyl” attached to alkyl portions having one to three carbon atoms. Examples of such radicals include cyclohexylmethyl. The cycloalkyl in said radicals may be additionally substituted with halo, alkyl, alkoxy and hydroxy.
[0119] The term “cycloalkenyl” includes carbocyclic groups having one or more carbon-carbon double bonds including “cycloalkyldienyl” compounds. Preferred cycloalkenyl groups include C.sub.3-C.sub.6 rings. More preferred compounds include, for example, cyclopentenyl, cyclopentadienyl, cyclohexenyl and cycloheptadienyl.
[0120] The term “comprising” is meant to be open ended, including the indicated component but not excluding other elements.
[0121] A group or atom that replaces a hydrogen atom is also called a substituent.
[0122] Any particular molecule or group can have one or more substituent depending on the number of hydrogen atoms that can be replaced.
[0123] The symbol “-” represents a covalent bond and can also be used in a radical group to indicate the point of attachment to another group. In chemical structures, the symbol is commonly used to represent a methyl group in a molecule.
[0124] The term “therapeutically effective amount” means an amount of a compound that ameliorates, attenuates or eliminates one or more symptom of a particular disease or condition, or prevents or delays the onset of one of more symptom of a particular disease or condition.
[0125] The terms “patient” and “subject” may be used interchangeably and mean animals, such as dogs, cats, cows, horses, sheep and humans. Particular patients are mammals. The term patient includes males and females.
[0126] The term “pharmaceutically acceptable” means that the referenced substance, such as a compound of Formula I, or a salt of a compound of Formula I, or a formulation containing a compound of Formula I, or a particular excipient, are suitable for administration to a patient.
[0127] The terms “treating”, “treat” or “treatment” and the like include preventative (e.g., prophylactic) and palliative treatment.
[0128] The term “excipient” means any pharmaceutically acceptable additive, carrier, diluent, adjuvant, or other ingredient, other than the active pharmaceutical ingredient (API), which is typically included for formulation and/or administration to a patient.
[0129] The term “cancer” means a physiological condition in mammals that is characterized by unregulated cell growth. General classes of cancers include carcinomas, lymphomas, sarcomas, and blastomas.
[0130] The following description of the embodiments is not intended to limit the embodiments, but rather to enable any person skilled in the art to make and use.
[0131] In embodiments, methods (e.g., pipeline, etc.) and/or systems (e.g., components facilitating performance of the pipeline; therapeutic compositions etc.) (and/or suitable portions of the embodiments) can include and/or function to inhibit, down-regulate, reduce and/or kill pathogenic bacteria using antibacterial compounds from the microbiota. In embodiments, the methods and/or systems can use one or more bioinformatics pipelines to identify compounds in the microbiota and/or can use one or more structural biology techniques to design new antibacterial compounds, such as by using as a basis the existing ones. In examples, the obtained antibacterial compounds can be used as treatment of one or more diseases and/or conditions, such as for healthcare, biotechnology, and pharmaceutical applications. In examples, other uses of these antibacterial compounds can additionally or alternatively include one or more of: food preservation, producing active probiotic culture, treatment of infections, antibiotic resistance to conventional antibiotics, post-surgical control of infectious bacteria, anti-cancer agents, and/or other suitable uses.
[0132] In embodiments, the method (e.g., pipeline, etc.) and/or system can include a first stage (and/or can be performed at any suitable time and frequency), which can include finding new antibacterial compounds produced by the microbiota. In examples, in this stage (and/or at any suitable time and frequency), a screening of known antibacterial compounds-producing microorganisms and/or antibacterial compounds can be performed, such as to generate one or more databases of antibacterial compounds produced by bacteria and/or other suitable microorganisms. In examples, all related information can be determined and/or stored (e.g., data usable for subsequent steps, etc.), such as including one or more of: the name of the antibacterial, the microorganisms that produce it, the application, host site, target microorganisms that inhibit and/or kill, and/or any other suitable data. In examples, curated antibacterial compounds (e.g., lantibiotic, bacteriocin, microcin, etc.), such as stored in the database, can be search against reference proteomes (e.g., from Uniprot or NCBI databases, etc.) using one or more sequence alignment algorithms (e.g., BLAST, FASTA, Clustal, among others, etc.). In examples, the alignment(s) can be used to identify peptide motif(s) that can be useful to predict the binding region of antibacterial compounds to other microorganisms, and/or to identify new bacteria-producing antibacterial compounds (e.g., an example of this stage is depicted in
[0133] In embodiments, the method (e.g., pipeline, etc.) and/or system can include second stage (and/or can be performed at any suitable time and frequency) which can include and/or function to allow modification of the antibacterial compounds to improve the antimicrobial activity. In examples, the method and/or system can include modifying antibacterial peptides that have a defined tridimensional structure and/or have a known particular target (e.g., obtained from a structural database, such as Protein Data Bank, Bactibase, BAGEL, among others, etc.). In examples, according to that, and/or based on the identification of relevant peptide motif(s) from the first stage (and/or at any suitable time and frequency), a structural analysis can be performed to identify whether those motifs are exposed to the solvent and, therefore, can interact with proteins from other microorganisms. In examples, this analysis can be performed using solvent-accessible surface area (SASA) but can additionally or alternatively be otherwise performed. In examples, then, a molecular docking (e.g., as control) can be performed to model the atomic interaction between the antimicrobial peptide and/or motif and the target from a microorganism(s) known to be inhibited by the action of the antibacterial peptide. In examples, both molecules are considered rigid, that is, the bonds do not rotate and maintain the secondary structure. In examples, taking this into account, new antimicrobial peptides can be designed. In examples, to do this, modifications on segments of amino acids of antibacterial peptide(s) can be performed to determine and/or obtain new antibacterial peptide(s) with improved antimicrobial activity. The modifications can include mutating each position of peptides (and/or any suitable position) for one or more of the remaining 19 amino acids. In examples, subsequently, docking between modified peptides and the target can be performed. In examples, thus, the new antibacterial peptide can bind with high affinity to the target, and therefore, can improve their antimicrobial activity (e.g., an example of this procedure is shown in
[0134] Embodiments can additionally or alternatively include applying any suitable approaches described herein for identification, generation, application, provision, and/or other suitable usage (e.g., in therapeutic compositions, etc.) of any suitable peptides, proteins, and/or other components, such as for any suitable antimicrobial activity, diseases, and/or conditions (e.g., described herein, etc.).
[0135] Embodiments of the method and/or system can additionally or alternatively include:
[0136] One or more methodologies to identify new antibacterial compounds (e.g., peptides, proteins, etc.) produced by the human microbiota.
[0137] One or more methodologies to modify the antibacterial compounds (e.g., peptides, proteins, etc.) to determine and/or obtain new ones.
[0138] Embodiments can additionally or alternatively include applying any suitable approaches described herein for identification, generation, application, provision, and/or other suitable usage (e.g., in therapeutic compositions, etc.) of any suitable peptides, proteins, and/or other components, such as for any suitable antimicrobial activity, diseases, and/or conditions (e.g., described herein, etc.).
[0139] In embodiments, methods (e.g., pipeline, etc.) and/or systems (e.g., components facilitating performance of the pipeline; therapeutic compositions etc.) (and/or suitable portions of the embodiments) can function to and/or include identification and/or targeting of virulence factors in bacteria (and/or other suitable microorganisms) that bind human cell-junctions proteins (e.g., e-cadherin, etc.), such as new targets of drugs that can help to prevent diseases and/or conditions provoked by those bacteria (and/or other suitable microorganisms), such as one or more of: colorectal cancer, gastric cancer, pancreatic cancer, gallbladder cancer, chronic diarrhea, abdominal infections and/or other suitable diseases and/or conditions. Additionally or alternatively, embodiments of the method and/or system can include the protection of cell-junctions proteins from cleavage mediated by the binding of bacterial virulence factors. In examples, the protection is addressed through the development of new peptide drugs. Additionally or alternatively, embodiments can include a pipeline and/or suitable approaches, which allow identification of new virulence proteins that target cell-junctions proteins. In examples, by analyzing the binding interface between the proteins, new peptides that can target virulence factor can be generated, aimed to prevent cell-junction protein binding and/or cleavage. In examples, the method and/or system can include and/or otherwise be used for new drugs that can prevent, ameliorate, and/or otherwise improve diseases provoked by adherens proteins from bacteria and/or other suitable microorganisms.
[0140] In embodiments, the method (e.g., pipeline) and/or system aims to find orthologous bacterial virulence factors to those already known by sequence matching against reference proteomes (e.g. available in NCBI). In examples, to this end, one or more alignment algorithms can be used (e.g., BLAST, FASTA, CLUSTAL, among others). Additionally or alternatively, structural information of known virulence factors (e.g., as those available in the Protein Data Bank—PDB) and predicted binding to a cell-junction protein (e.g e-cadherin) can be used to identify protein motifs in the binding site, allowing to identify new virulence factors in available bacterial proteomes. In examples, sequence similarity networks can be used to classify different classes of virulence factors that bind cell-junction proteins (e.g., E-cadherin, etc.), depending on the mechanisms that the proteins use to disrupt cell-junction proteins (e.g., E-cadherin, etc.).
[0141] In examples, new virulence factors that can alter cell junctions can additionally or alternatively be identified. Additionally or alternatively, using the available structural information in the structural databases (e.g., PDB, etc.), the binding site between the cell-junction protein (e.g., E-cadherin) and the different virulence factors can be determined. In examples, if a specific virulence factor is not found, a homology model of the structure can be obtained and the binding site can be found. In examples, once the binding site is determined, a peptide with higher affinity than the original cell-junction protein-binding site can be obtained by in-silico reengineering techniques (e.g., one or more of molecular docking, fragment-based discovery, free energy calculations, etc). In examples, thus, it is expected that new peptide drugs can bind with high affinity to the virulence factor, inhibiting by competition the original binding with the cell-junction protein.
[0142] However, any suitable portions, approaches, and/or steps described above and/or herein can be performed in any suitable sequence, and at any suitable time and frequency.
[0143] Embodiments of the method and/or system can additionally or alternatively include:
[0144] One or more pipelines to identify new proteins, peptides, and/or other components as virulence factors that can alter cell junctions, such as by cell-junction protein binding.
[0145] One or more pipelines to identify peptides, proteins, and/or other suitable components as inhibitors of the cell-junction protein (e.g., E-cadherin, etc.)/virulence factors binding.
[0146] Embodiments can additionally or alternatively include applying any suitable approaches described herein for identification, generation, application, provision, and/or other suitable usage (e.g., in therapeutic compositions, etc.) of any suitable proteins, peptides, and/or other components for targeting cell junctions, such as for any suitable conditions (e.g., described herein, etc.).
[0147] In embodiments, methods method (e.g., pipeline, etc.) and/or systems (e.g., components facilitating performance of the pipeline; therapeutic compositions etc.) (and/or suitable portions of the embodiments) disclosed can function to identify one or more bacterial proteins, peptides, and/or other components, that can cause cross reaction with human proteins, peptides, and/or other components. Additionally or alternatively, embodiments can include one or more approaches to inhibit the action of such bacterial proteins, peptides, and/or other components (e.g., for inhibiting the cross reaction with human proteins, peptides, and/or other components).
[0148] Embodiments of methods and/or systems (e.g., therapeutic compositions; etc.) can be identify bacterial proteins that can produce cross-reaction with human ones and to target such bacterial proteins using small molecules or peptides. In embodiments, the methods can include a procedure for identifying bacterial proteins that can lead to cross-reaction with host proteins. In examples, the obtained bacterial proteins are screened to find MHC class II epitopes, thus the proteins having those epitopes can be identified to generate antibody production. Additionally or alternatively, identified proteins can be new targets for the design of peptide inhibitors. In specific examples, new peptide-based drugs to target cross-reactive proteins can be used to alleviate or prevent the triggering of autoimmune diseases.
[0149] In embodiments, the method (e.g., pipeline, etc.) and/or system can include a first step (and/or can be performed at any suitable time and frequency), which can include one or more sequence identity searches performed between human gut microbiota reference proteomes (e.g., Uniprot and/or NCBI, etc.) against the human proteome and/or other suitable components. Any suitable combination of the organisms (e.g., taxa, all organisms, etc.) detected and/or detectable in the human gut (e.g., by any suitable database) can be considered, but any suitable database (e.g., Human Microbiome project, etc.) can additionally or alternatively be used. In a specific example, the similarity search is performed by using a sequence alignment algorithm (e.g. pBLAST), but any suitable similarity search approaches can additionally or alternatively be used. In a specific example, bacterial protein regions that match with human proteins are saved.
[0150] In embodiments, the method and/or system can include a second stage (and/or can be performed at any suitable time and frequency), which can include bacterial proteins regions obtained in the first stage (and/or at any suitable time and frequency) being analyzed to find HLA-class II epitopes. In specific examples, HLA-class II alleles are considered depending on each health condition or disease. In specific examples, this can be performed by one or more tools (e.g., Propred, IEDB, etc). In specific examples, proteins and/or peptide fragments that were predicted to have epitopes sequences can then be correlated with autoimmune diseases and/or conditions (e.g., by literature curation). In specific examples, cluster visualization can be performed to identify the predominant taxonomic order of those bacteria predicted to have proteins implied in a specific disease and/or condition.
[0151] In embodiments, the method and/or system can include a later stage (and/or can be performed at any suitable time and frequency), which can include generating peptide inhibitors targeting bacterial proteins. In examples, first, a structural model of the bacterial protein and/or epitope should be obtained from a structural database (e.g. Protein Data Bank PDB, etc.). In examples, if the sequence is short, peptide modelling can additionally or alternatively apply. In examples, if the protein fragment is large, a homology model can be built. The receptor, MHC-class II molecule, can be obtained from the structural database (e.g., PDB, etc.) and/or modelled according to the allele associated with the health condition under study (e.g., lupus risk alleles are HLA-DR3 and HLA-DR15).
[0152] Embodiments of the method and/or system can additionally or alternatively include:
[0153] One or more methodologies to identify bacterial proteins, peptides, and/or other suitable components responsible for triggering an autoimmune reaction.
[0154] One or more methodologies to obtain inhibitory peptides, proteins, and/or other suitable components against bacterial proteins, peptides, and/or other suitable components that mediate autoimmune reactions.
[0155] Embodiments can additionally or alternatively include applying any suitable approaches described herein for identification, generation, application, provision, and/or other suitable usage (e.g., in therapeutic compositions, etc.) of any suitable peptides, proteins, and/or other components, such as for any suitable autoimmune conditions (e.g., described herein, etc.).
Specific Examples
[0156] As an example, an inhibitory lead peptide can be obtained from the bacterial protein binding region in the MHC-class II receptor. In examples, by using in-silico reengineering aided by molecular docking, that means, by producing single or double mutations in the lead peptide, a peptide with higher affinity to bacterial protein than the original MHC-class II binding site can be generated. Thus, in examples, it is expected that the new peptide can inhibit by competition the bacterial protein binding to MHC-class II receptor. In specific examples, some considerations can be taken into account, for example, the inhibitory peptides should not cross-react with human proteins triggering other autoimmune responses; to meet this requirement, inhibitory peptides can be searched against proteins/peptides found in the first stage (and/or at any suitable time and frequency), which are candidates to be autoimmune protein candidates.
[0157] In an example, embodiments can include and/or otherwise be applied for the targeting of Ro60 antigen orthologue bacterial protein. In humans, Ro60 protein has a RNA repair role (e.g., as shown in
[0158] However, any suitable portions, approaches, and/or steps described above and/or herein can be performed in any suitable sequence, and at any suitable time and frequency.
[0159] In embodiments, according to the mentioned antecedents, new pathogen-selective HtrA inhibitors might represent a new drug discovery opportunity. In embodiments, the method and/or system can include and/or otherwise prevent E-cadherin cleavage mediated by HtrA proteins from H.pylori. In embodiments, the method and/or system can include and/or otherwise identify and generate inhibitors of the proteolytic region of HrtA proteins from H.pylori, aimed to prevent E-cadherin binding and cleavage. In embodiments, the method and/or system can include, determine, provide, generate, administer, and/or otherwise facilitate new drugs, such as drugs that can be used to prevent attachment and/or cleavage mediated by H.pylori, thus they can be used as palliative and/or as a treatment against gastric cancer and/or any other suitable gastrointestinal conditions, cancers, and/or other suitable conditions.
[0160] The crystal structure of H. pylori HtrA with a deletion of the PDZ2 domain (PDB ID: 5Y28) with a resolution of 3.08 Å is obtainable, and additional characteristics regarding this structure can additionally or alternatively be determined. In variations, the method and/or system can include and/or be used to generate one or more trimeric homology model(s) including PDZ2 domain (sequence UNIPROT ID: G2J5T2), such as where DegS protein from E. coli can be used as a template (PDB: 4RQY) but any suitable proteins and/or or microorganisms can be used for templates. In a specific example, the homologous region between both proteins includes 37% sequence identity and 67% sequence similarity. In examples, the homology model and the crystal structure in PDB ID: 5Y28 can be structurally aligned and the PDZ1 and the proteolytic domain are structurally similar (RMSD). A potential allosteric site in each monomer of the trimer can act as a potential site (e.g., ideal site) for drug binding, which can facilitate preventing pathogen transmigration across the gastric epithelial barrier.
[0161] In examples, the method and/or system can include and/or be used to perform, after the HtrA homology model is built (and/or at any suitable time and frequency), the control binding affinity of an in-silico reported inhibitor was calculated as a reference through docking simulations. In a specific example, this binding energy was calculated in −7.5 kcal/mol. Compounds can exist (K.sub.D=13 μM and IC.sub.50=26 μM), which according to our docking calculation has HtrA binding energy of −7.7 kcal/mol and −8.1 kcal/mol. Embodiments can include, In the search of new possible inhibitors of HtrA proteolytic function, screening a set of molecules from a suitable source (e.g. CHEMBL database and/or any other suitable databases and/or other suitable sources) against HtrA enzyme using massive molecular docking simulations (and/or other suitable in silico approaches and/or other suitable approaches; etc.). In embodiments, the method and/or system can include applying any suitable set of criteria (e.g., thresholds; etc.). In examples, from this set, only molecules with a Tanimoto similarity coefficient higher than 0.5 compared with a reported inhibitor were considered; however, any suitable thresholds (e.g., any suitable Tanimoto similarity coefficient value; etc.) and/or other suitable criteria for the Tanimoto similarity coefficient, other similarity coefficients, and/or other suitable metrics can be used. In examples, then, these molecules were filtered by applying Lipinski rules of druggability (and/or any suitable criteria). In specific examples, the Lipinski rules of druggability can include any one or more of: molecular weight <500 daltons, number of H-bonds donor <5, number of H-bonds acceptor <10, number of N and O atoms <15, range of partition coefficient log P between −2 and 5, number of rotatable bonds <10, number of ring number <10; and/or any other suitable criteria.
[0162] The present application also relates to a method of treating a bacterial infection comprising administering a pharmaceutically effective amount of the HtrA inhibitor described herein to a human subject in need thereof. In an embodiment, the bacterial infection is a Helicobacter pylori infection.
[0163] The following includes a specific example of a main scaffold (Formula (I)):
##STR00005##
wherein R.sub.1 to R.sub.6 are defined below and the dotted line indicates the bond is either none, a single bond or a double bond. For clarity, each cell of Tables 1-6 illustrates the chemical structure of the substituent on the top and its Canonical SMILES at the bottom. “A” indicates either H or the connection position of the group. For example, “A-Cl” indicates that the substituent is —Cl; “A-” indicates that the substituent is —CH.sub.3. If there are two or more “A” in the chemical structure, each A is independently either H or the connection position.
R.SUB.1
[0164] R.sub.1 can be H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; wherein R.sup.w at each occurrence is independently H, halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10) cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10)heterocyclo, —(CH.sub.2).sub.n-aryl, —(CH.sub.2).sub.n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
[0165] In some embodiments, R.sub.1 is selected from the groups listed in Table 1.
TABLE-US-00001 TABLE 1 R.sub.1 substituent A—Cl Cl* A [*H]
R.SUB.2
[0166] R.sub.2 can be H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; wherein R.sup.w at each occurrence is independently H, halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10) cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10)heterocyclo, —(CH.sub.2).sub.n-aryl, —(CH.sub.2).sub.n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
[0167] In some embodiments, R.sub.2 is selected from the groups listed in Table 2.
TABLE-US-00002 TABLE 2 R.sub.2 substitutent A—Cl C*
R.SUB.3
[0168] R.sub.3 can be H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)alkylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more Rw groups as allowed by valence; wherein Rw at each occurrence is independently HK halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C3-C10)heterocyclo, (C3-C10)cycloalkyl, —(CH2)n-(C3-C10) cycloalkyl, —(CH2)n-(C3-C10)heterocyclo, —(CH2)n-aryl, —(CH2)n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
[0169] In some embodiments, R.sub.3 is selected from the groups listed in Table 3.
TABLE-US-00003 TABLE 3 R.sub.3 substituent A—Br Br*
R.SUB.4
[0170] R.sub.4 can be H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)akenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)akylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; wherein R.sup.w at each occurrence is independently H, halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10) cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10)heterocyclo, —(CH.sub.2).sub.n-aryl, —(CH.sub.2).sub.n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
[0171] In some embodiments, R.sub.4 is selected from the groups listed in Table 4.
TABLE-US-00004 TABLE 4 R.sub.4 substituent A—Cl Cl*
R.SUB.5
[0172] R.sub.5 can be H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)akenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6*akylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; wherein R.sup.w at each occurrence is independently H, halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10) cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10)heterocyclo, —(CH.sub.2).sub.n-aryl, —(CH.sub.2).sub.n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
[0173] In some embodiments R.sub.5 is selected from the groups listed in Table 5.
TABLE-US-00005 TABLE 5 R.sub.5 substituent A—Br Br*
R.SUB.6
[0174] R.sub.6 can be H, halo, cyano, OH, (C.sub.1-C.sub.6)alkyl, (C.sub.2-C.sub.8)alkenyl, (C.sub.2-C.sub.8)carboxyalkyl; N—(C.sub.1-C.sub.6)akylaminocarbonyl, (C.sub.1-C.sub.6)alkoxy, (C.sub.1-C.sub.6)sulfonyl, (C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, aryl, or heteroaryl, any of which may be optionally substituted with 1 or more R.sup.w groups as allowed by valence; wherein R.sup.w at each occurrence is independently H, halo, cyano, nitro, oxo, amino, alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, heterocycloalkyl, wherein said alkyl, haloalkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, heterocyclo, aryl, heteroaryl, arylalkyl, heteroarylalkyl, cycloalkylalkyl, and heterocycloalkyl groups may be further independently substituted with one or more groups selected from the group consisting of halo, cyano, oxo(C.sub.3-C.sub.10)heterocyclo, (C.sub.3-C.sub.10)cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10) cycloalkyl, —(CH.sub.2).sub.n—(C.sub.3-C.sub.10)heterocyclo, —(CH.sub.2).sub.n-aryl, —(CH.sub.2).sub.n-heteroaryl, aryl, and heteroaryl, wherein n is 0, 1, 2, 3, 4, 5, or 6.
[0175] In some embodiments, R.sub.6 is selected from the groups listed in Table 6.
TABLE-US-00006
Additional or Alternative Examples
[0176] In examples, after the virtual screening (and/or at any suitable time and frequency), the first nine molecules with binding energy less than −9.5 kcal/mol against the HtrA enzymes (however, any suitable criteria can be used, such as any suitable binding energy threshold; etc.) were chosen as the selected candidates (e.g., called “Dataset 1”,
TABLE-US-00007 TABLE 7 IUPAC nomenclature and canonical SMILES of specific examples of selected candidates (Dataset 1). Compound # Molecule Canonical SMILES Name 1 CHEMBL1515370 Cc1ccc(cc1)S(═O)(═O)N1CCCC N′-benzyl-N-[2-[(2R)-1-(4- (binding energy = −9.6 [C@@H]1CCNC(═O)C(═O)NCc1ccccc1 methylphenyl)sulfonylpiperidin-2- kcal/mol) yl]ethyl]oxamide 2 CHEMBL1868353 NC(═O)C1CCN(CC1)C(═O)CN 1-[2-[methyl(naphthalen-2- (binding energy = −9.6 (S(═O)(═O)c1ccc2c(c1)cccc2)C ylsulfonyl)amino]acetyl]piperidine-4- kcal/mol) carboxamide 3 CHEMBL1880232 Cc1ccc(cc1)S(═O)(═O)N1CCC2 8-(4-methylphenyl)sulfonyl-4-(2,4,6- (binding energy = −9.6 (CC1)OCCN2S(═O)(═O) trimethylphenyl)sulfonyl-1-oxa-4,8- kcal/mol) c1c(C)cc(cc1C)C diazaspiro[4.5]decane 4 CHEMBL2159481 Fc1cc(ccc1F)S(═O)(═O)N[C@H] N-{1-[2-(2-Biphenylyloxy)ethyl]-3- (binding energy = −9.6 1CCN(C1)CCOc1ccccc1c1ccccc1 pyrrolidinyl}-3,4- kcal/mol) difluorobenzenesulfonamide 5 CHEMBL2172063 OC(═O)[C@H]1CCCN(C1)S(═O) 1-(2-Anthrylsulfonyl)-3- (binding energy = −9.7 (═O)c1ccc2c(c1)cc1c(c2)cccc1 piperidinecarboxylic acid kcal/mol) 6 CHEMBL342904 O═C([C@H]1CCCN(C1)C(═[NH2])N) (3S)-1-Carbamimidoyl-N-({(2S)-1- (binding energy = −9.7 NC[C@@H]1CCCN1C(═O) [N-(2-naphthylsulfonyl)glycyl]-2- kcal/mol) CNS(═O)(═O)c1ccc2c(c1)cccc2 pyrrolidinyl}methyl)-3- piperidinecarboxamide 7 CHEMBL421919 O═C([C@H]1CCCN(C1)C (3S)-1-Carbamimidoyl-N-({(2S)-1- (binding energy = −10.2 (=[NH2])N)NC[C@@H]1CCCN1C [N-(2-naphthylsulfonyl)-L-alanyl]-2- kcal/mol) (═O)[C@@H](NS pyrrolidinyl}methyl)-3 - (═O)(═O)c1ccc2c(c1)cccc2)C piperidinecarboxamide 8 CHEMBL489852 O═C(N1CCN(C[C@H]1C(F)(F)F) Cyclohexyl[4-(1-naplithylsulfonyl)- (binding energy = −9.7 S(═O)(═O)c1cccc2c1cccc2)C1CCCCC1 2-(trifluoromethyl)-1- kcal/mol) piperazinyl]methanone
Additional or Alternative Examples
[0177] In examples, after the virtual screening (and/or at any suitable time and frequency), the first nine molecules with binding energy less than −9.5 kcal/mol against the HtrA enzymes (however, any suitable criteria can be used, such as any suitable binding energy threshold; etc.) were chosen as the selected candidates (e.g., called “Dataset 1”,
TABLE-US-00008 TABLE 7 IUPAC nomenclature and canonical SMILES of specific examples of selected candidates (Dataset 1). Compound # Molecule Canonical SMILES Name 1 CHEMBL1515370 Cc1ccc(cc1)S(═O)(═O)N1CCCC N′-benzyl-N-[2-[(2R)-1-(4- (binding energy = −9.6 [C@@H]1CCNC(═O)C(═O)NCc1ccccc1 methylphenyl)sulfonylpiperidin-2 - kcal/mol) yl]ethyl]oxamide 2 CHEMBL1868353 NC(═O)C1CCN(CC1)C(═O)CN 1-[2-[methyl(naphthalen-2- (binding energy = −9.6 (S(═O)(═O)c1ccc2c(c1)cccc2)C ylsulfonyl)amino]acetyl]piperidine-4- kcal/mol) carboxamide 3 CHEMBL1880232 Cc1ccc(cc1)S(═O)(═O)N1CCC2 8-(4-methylphenyl)sulfonyl-4-(2,4,6- (binding energy = −9.6 (CC1)OCCN2S(═O)(═O) trimethylphenyl)sulfonyl-1-oxa-4,8- kcal/mol) c1c(C)cc(cc1C)C diazaspiro[4.5]decane 4 CHEMBL2159481 Fc1cc(ccc1F)S(═O)(═O)N[C@H] N-{1-[2-(2-Biphenylyloxy)ethyl]-3- (binding energy = −9.6 1CCN(C1)CCOc1ccccc1c1ccccc1 pyrrolidinyl}-3,4- kcal/mol) difluorobenzenesulfonamide 5 CHEMBL2172063 OC(═O)[C@H]1CCCN(C1)S(═O) 1-(2-Anthrylsulfonyl)-3- (binding energy = −9.7 (═O)c1ccc2c(c1)cc1c(c2)cccc1 piperidinecarboxylic acid kcal/mol) 6 CHEMBL342904 O═C([C@H]1CCCN(C1)C(═[NH2])N) (3S)-1-Carbamimidoyl-N-({(2S)-1- (binding energy = −9.7 NC[C@@H]1CCCN1C(═O) [N-(2-naphthylsulfonyl)glycyl]-2- kcal/mol) CNS(═O)(═O)c1ccc2c(c1)cccc2 pyrrolidinyl}methyl)-3- piperidinecarboxamide 7 CHEMBL421919 O═C([C@H]1CCCN(C1)C(=[N (3S)-1-Carbamimidoyl-N-({(2S)-1- (binding energy = −10.2 H2])N)NC[C@@H]1CCCN1C [N-(2-naphthylsulfonyl)-L-alanyl]-2- kcal/mol) (═O)[C@@H](NS pyrrolidinyl}methyl)-3 - (═O)(═O)c1ccc2c(c1)cccc2)C piperidinecarboxamide 8 CHEMBL489852 O═C(N1CCN(C[C@H]1C(F)(F)F) Cyclohexyl[4-(1-naplithylsulfonyl)- (binding energy = −9.7 S(═O)(═O)c1cccc2c1cccc2)C1CCCCC1 2-(trifluoromethyl)-1- kcal/mol) piperazinyl]methanone
TABLE-US-00009 TABLE 8 Specific examples of ADME properties of the selected candidates (Dataset 1) obtained in SwissADME. In specific examples, Compounds 2, 6 and 7 appeared as a good drug candidates, as they are predicted do not inhibit cytochromes P450 isoforms. Compound 1 2 3 4 5 6 7 8 9 MW 443.56 389.47 478.62 458.52 369.43 501.62 515.65 454.51 592.75 #H-bond 5 5 7 7 5 5 5 7 8 acceptors #H-bond 2 1 0 1 1 4 4 0 4 donors TPSA 103.96 109.16 100.75 67.02 83.06 159.24 159.24 66.07 176.51 Consensus 2.62 1.35 3.23 4.11 2.94 −0.27 0.23 4.01 1.64 Log P Ali Moderately Soluble Moderately Moderately Moderately Soluble Moderately Moderately Moderately Class soluble soluble soluble soluble soluble soluble soluble GI High High High High High Low Low High Low absorption BBB No No No No No No No No No permeant CYP1A2 No No No No Yes No No No No inhibitor CYP2C19 Yes No Yes Yes No No No Yes No inhibitor CYP2C9 Yes No Yes Yes Yes No No Yes No inhibitor CYP2D6 Yes No No Yes No No No Yes No inhibitor CYP3A4 Yes No Yes Yes Yes No No Yes Yes inhibitor
[0178] In examples, in a second filter (and/or any suitable filter able to be applied at any suitable time and frequency; etc.), molecules having a binding energy higher than −9.4 kcal/mol and less than −8.9 kcal/mol (e.g., which can be an improvement over the reported compound) (however, any suitable criteria can be used, such as any suitable binding energy threshold; etc.) were chosen as the Dataset 2. In specific examples, two molecules having MW>500 were also included in the dataset 2, as the showed high binding affinity.
TABLE-US-00010 TABLE 9 IUPAC nomenclature and canonical SMILES of specific examples of the selected candidates (Dataset 2). Compound # Molecule Canonical SMILES Name 10 CHEMBL168720 NC(═N)NCCC[C@H](C(═O)N1 N-[5-Carbamimidamido-1-(4 - CCOCC1)NS(═O)(═O)c1ccc2c(c1)cccc2 morpholinyl)-1-oxo-2-pentanyl]- 2-naphthalenesulfonamide 11 CHEMBL168727 NC(═N)NCCC[C@H](C(═O) N-[1-(1-Azepanyl)-5- N1CCCCCC1)NS(═O)(═O)c1ccc2c(c1)cccc2 (carbamimidamido-1-oxo-2- pentanyl]-2- naphthalene sulfonamide 12 CHEMBL1891859 Cc1ccc(c(c1)S(═O)(═O)N1CCC N-Cyclopentyl-N′-({1-[(2,5- [C@@H]1CNC(═O)C(═O)NC1CCCC1)C dimethylphenyl)sulfonyl]-2- pyrrolidinyl}methyl)ethanediamide 13 CHEMBL1923450 O═C1N(CCC[C@@H]1NS(═O) N-{(3S)-2-Oxo-1-[2-oxo-2-(1- (═O)c1ccc2c(c1)cccc2)CC(═O)N1CCCC1 pyrrolidinyl)ethyl]-3- piperidinyl}-2- naphthalene sulfonamide 14 CHEMBL1923452 Clc1ccc2c(c1)cc(cc2)S(═O)(═O) 7-Chloro-N-{(3S)-2-oxo-1-[2- N[C@H]1CCCN(C1═O)CC(═O)N1CCCC1 oxo-2-(1-pyrrolidinyl)ethyl]-3- piperidinyl}-2- naphthalenesulfonamide 15 CHEMBL212360 Clc1ccc2c(c1)ccc(c2)S(═O)(═O) 6-Chloro-N-methyl-N-{(3S)-2- N([C@H]1CCN(C1═O)CC(═O)N1CCCCC1)C oxo-1-[2-oxo-2-(1- piperidinyl)ethyl]-3- pyrrolidinyl}-2- naphthalenesulfonamide 16 CHEMBL2152233 O═C([C@@]1(C)CCCN1S(═O) 1-(4-Biphenylylsulfonyl)-N- (═O)c1ccc(cc1)c1ccccc1)N[C@@H]1 [(2s,5R)-5-hydroxyadamantan-2- [C@@H]2C[C@@H]3C[C@H]1C[C@](C2)(C3)O yl]-2-methyl-D-prolinamide 17 CHEMBL227136 NC(═[NH2])NCCC[C@@H](C(═O) N-[(2S)-5-carbamimidamido-1- N1CCOCC1)NS(═O)(═O)c1cccc2c1cccc2 (morpholin-4-yl)-1-oxopentan-2- yl]naphthalene-1-sulfonamide 18 CHEMBL227246 NC(═N)NCCC[C@@H](C(═O) N-[(2S)-5-carbamimidamido-1- N1CCNCC1)NS(═O)(═O)c1cccc2c1cccc2 oxo-1-(piperazin-1-yl)pentan-2- yl]naphthalene-1-sulfonamide 19 CHEMBL227406 NC(═[NH2])NCCC[C@@H](C(═O) N-[(2S)-5-carbamimidamido-1- N1CCCCC1)NS═O)(═O)c1cccc2c1cccc2 oxo-1-(piperidin-1-yl)pentan-2- yl]naphthalene-1-sulfonamide 20 CHEMBL301610 O═C([C@@H]1CCCN1S(═O) (3S,3aR,6aS)-1-Acetyl-4-{[(2S)- (═O)c1cccc2c1cccc2N(C)C)N1CC 1-{[5-(dimethylamino)-1- [C@H]2[C@H]1[C@H](C)C(═O) naphthyl]sulfonyl}-2- N2C(═O)C pyrrolidinyl]carbonyl}-3- methylhexahydropyrrolo[3,2- b]pyrrol-2(1H)-one 21 CHEMBL342043 O═C([C@@H]1CCCN1S(═O)(═O) (3S,3aR,6aS)-1- c1ccc2c(c1)cccc2)N1CC[C@H]2 (Cyclopropylcarbonyl)-3- [C@H]1[C@H](C)C(═O)N2C methyl-4-{[(2S)-1-(2- (═O)C1CC1 naphthylsulfonyl)-2- pyrrolidinyl]carbonyl}hexahydro pyrrolo[3,2-]pyrrol-2(1H)-one 22 CHEMBL352178 O═C(CN1CCCC[C@@H]C1═O) 4-(2-Oxo-3-{(3S)-2-oxo-3- NS(═O)(═O)c1ccccc1)CC1CCN [(phenylsulfonyl)amino]-1- (CC1)C(═[NH2])N azepanyl}propyl)-1- piperidinecarboximidamide 23 CHEMBL354149 NC(═[NH2])NCCC[C@H](C(═O) N-[1-(1-Azepanyl)-5- N1CCCCCC1)NS(═O)(═O)c1cccc2c1cccc2 carbamimidamido-1-oxo-2- pentanyl]-1- naphthalene sulfonamide 24 CHEMBL3740086 N#C[C@@H](NC(═O)[C@@H] N-[(1S)-3-Amino-1-cyano-3- 1CCCN1S(═O)(═O)c1ccc(cc1)c1ccc(cc1)C(F)(F)F) oxopropyl]-1-{[4′- CC(═O)N (trifluoromethyl)-4- biphenylyl]sulfonyl}-L- prolinamide 25 CHEMBL3740253 N#C[C@@H](NC(═O)[C@@H] N-[(1S)-3-Amino-1-cyano-3- 1CCCN1S(═O)(═O)c1ccc(cc1)c1ccc(cc1)C)CC oxopropyl]-1-[(4′-methyl-4- (═O)N biphenylyl)sulfonyl]-L- prolinamide 26 CHEMBL3740368 N#C[C@@H](NC(═O)[C@@H] N-[(1S)-3-Amino-1-cyano-3- 1CCCN1S(═O)(═O)c1ccc(cc1)c1ccc(cc1)C#N)CC oxopropyl]-1-[(4′-cyano-4- (═O)N biphenylyl)sulfonyl]-L- prolinamide 27 CHEMBL3741666 N#C[C@@H](NC(═O)[C@@H] N-[(1S)-3-Amino-1-cyano-3- 1CCCN1S(═O)(═O)c1ccc(cc1)c1cccc(c1)C(F)(F)F) oxopropyl]-1-{[3′- CC(═O)N (trifluoromethyl)-4- biphenylyl]sulfonyl}-L- prolinamide 28 CHEMBL374524 O═C([C@@H](N1CC[C@@H] (2S)-2-[(3S)-3-{[(6-Chloro-2- (C1═O)NS(═O)(═O)c1ccc2c(c1)ccc(c2)Cl)C) naphthyl)sulfonyl]amino}-2- NCCNS(═O)(═O)C oxo-1-pyrrolidinyl]-N-{2- [(methylsulfonyl)amino]ethyl}pro- panamide 29 CHEMBL394714 CN(C(═O)[C@@H]1CCCN1S(═O) N-(1-Benzyl-4-piperidinyl)-N- (═O)c1ccc2c(c1)cccc2)C1CCN methyl-1-naphthylsulfonyl)- (CC1)Cc1ccccc1 L-prolinamide 30 CHEMBL428576 CC(c1ccc(cc1)S(═O)(═O)N1CCC N-(1-Benzyl-4-piperidinyl)-1- [C@H]1C(═O)NC1CCN(CC1)Cc1ccccc1)C [(4-isopropylphenyl)sulfonyl]-L- prolinamide 31 CHEMBL436413 O═C([C@@H]1CCCN1S(═O)(═O) (3S,3aR,6aS)-1- c1cccc2c1cccc2)N1CC[C@H] (Cyclopropylcarbonyl)-3- 2[C@H]1[C@H](C)C(═O)N2C(═O) methyl-4-{[(2S)-1-(1- C1CC1 naphthylsulfonyl)-2- pyrrolidinyl]carbonyl}hexahydro pyrrolo[3,2-b]pyrrol-2(1H)-one 32 CHEMBL482194 N[C@@H]1CCN(C1)C(═O)[C@H] [(3R)-3-Amino-1 1CCCCN1S(═O)(═O)c1ccc(cc1)c1ccccc1 pyrrolidinyl][(2R)-1-(4- biphenylylsulfonyl)-2 piperidinyl]methanone 33 CHEMBL523100 O═C(N1CCN(CC1)S(═O)(═O) Cyclohexyl[4-(1- c1cccc2c1cccc2)C1CCCCC1 naphthylsulfonyl)-1- piperazinyl]methanone 34 CHEMBL525204 O═C(N1CCN(CC1(C)C)S(═O)(═O) Cyclohexyl[2,2-dimethyl-4-(1- c1cccc2c1cccc2)C1CCCCC1 naphthylsulfonyl)-1- piperazinyl]methanone
TABLE-US-00011 TABLE 10 Specific examples of ADME properties of the selected candidates (Dataset 2) obtained in SwissADME (part 1); in specific examples, Compounds 10, 11, 17, and 18 appeared as good drug candidates, as they are predicted do not inhibit cytochromes P450 isoforms. Compound # 10 11 12 13 14 15 16 17 18 MW 433.52 445.58 407.53 415.51 449.95 463.98 494.65 434.53 432.54 #H-bond 6 5 5 5 5 5 5 5 6 acceptors #H-bond 4 4 2 1 1 0 2 4 5 donors TPSA 145.99 136.76 103.96 95.17 95.17 86.38 95.09 148.16 148.79 Consensus 1.04 2.12 2.16 1.91 2.43 2.58 3.55 −0.72 0.56 Log P Ali Class Soluble Moderately Moderately Soluble Moderately Moderately Moderately Soluble Soluble soluble soluble soluble soluble soluble GI Low Low High High High High High Low Low absorption BBB No No No No No No No No No permeant CYP1A2 No No No No No No No No No inhibitor CYP2C19 No No Yes Yes Yes Yes Yes No No inhibitor CYP2C9 No No No Yes Yes Yes No No No inhibitor CYP2D6 No No No No Yes Yes Yes No No inhibitor CYP3A4 No No Yes Yes Yes Yes Yes No No inhibitor
TABLE-US-00012 TABLE 11 Specific examples of ADME properties of the selected candidates (Dataset 2) obtained in SwissADME (part 2). In specific examples, Compounds 19, 22 and 23 appeared as a good drug candidates, as they are predicted do not inhibit cytochromes P450 isoforms. Compound # 19 20 21 22 23 24 25 26 27 28 MW 432.56 512.62 495.59 450.57 446.59 494.49 440.52 451.5 494.49 517.02 #H-bond 4 6 6 5 4 9 6 7 9 8 acceptors #H-bond 4 0 0 3 4 2 2 2 2 3 donors TPSA 138.93 106.69 103.45 147.21 138.93 141.74 141.74 165.53 141.74 158.51 Consensus 0.26 2.02 2.38 −0.34 0.84 2.24 1.53 1.06 2.19 1.08 Log P Ali Class Moderately Moderately Moderately Soluble Moderately Moderately Moderately Moderately Moderately Moderately soluble soluble soluble soluble soluble soluble soluble soluble soluble GI High High High Low High Low Low Low Low Low absorption BBB No No No No No No No No No No permeant CYP1A2 No No No No No No No No No No inhibitor CYP2C19 No No Yes No No Yes No No Yes No inhibitor CYP2C9 No No Yes No No No No No No No inhibitor CYP2D6 No No No No No Yes No No Yes No inhibitor CYP3A4 No Yes Yes No No Yes Yes Yes Yes Yes inhibitor
TABLE-US-00013 TABLE 12 Specific examples of ADME properties of the selected candidates (Dataset 2) obtained in SwissADME (part 3). Compound # 29 30 31 32 33 34 MW 491.64 469.64 495.59 413.53 386.51 414.56 #H-bond 5 5 6 5 4 4 acceptors #H-bond donors 0 1 0 1 0 0 TPSA 69.31 78.1 103.45 92.09 66.07 66.07 Consensus Log 3.56 3.44 2.36 2.26 3.05 3.6 P Ali Class Moderately Moderately Moderately Soluble Moderately Moderately soluble soluble soluble soluble soluble GI absorption High High High High High High BBB permeant Yes No No No Yes Yes CYP1A2 No No No No Yes No inhibitor CYP2C19 Yes Yes Yes No Yes Yes inhibitor CYP2C9 Yes Yes Yes No Yes Yes inhibitor CYP2D6 Yes Yes No Yes Yes Yes inhibitor CYP3A4 Yes Yes Yes Yes Yes Yes inhibitor
[0179] Embodiments can additionally or alternatively include applying any suitable approaches described herein for identification, generation, application, provision, and/or other suitable usage (e.g., in therapeutic compositions, etc.) of any suitable drugs, peptides, proteins, and/or other components, such as for use to prevent attachment and/or cleavage mediated by H.pylori, and/or thus they can be used as palliative and/or as a treatment against gastric cancer and/or any other suitable gastrointestinal conditions, cancers, and/or other suitable conditions.
[0180] In embodiments, the method and/or system can include and/or otherwise function to determine, generate, provide, and/or otherwise facilitate small molecules (e.g., peptides; in form of therapeutic composition(s); etc.) which inhibit the interaction between CagA and E-cadherin (e.g., such as for diagnostics and/or treatment; etc.), which include one of the routes reported for the GC development and/or other suitable conditions.
[0181] In embodiments, the method and/or system can include and/or otherwise function to inhibit (e.g., through small molecules, drugs, therapeutic compositions; etc.) the pathway involving binding of CagA (from H.pylori) and human E-cadherin, which has been described as one of the pathways that induce gastric cancer and/or other suitable conditions.
[0182] In embodiments, the method and/or system can include and/or otherwise function to design, determine, generate, provide, and/or otherwise facilitate new peptide-like drugs that can inhibit CagA/E-cadherin interaction (e.g., Since CagA interaction with E-cadherin provokes an abnormal interaction between E-cadherin and β-catenin).
[0183] In embodiments, the method and/or system can include and/or otherwise function to determine, generate, provide, and/or otherwise facilitate peptide-like drugs that can be used for treatment and/or as a palliative drug, such as additionally or alternatively with other treatments against H. pylori, Gastric Cancer, and/or other suitable conditions.
[0184] In specific examples, the method and/or system can include a first stage (and/or performed at any time and/or frequency; etc.), which can include determining the sequence(s) of the peptide(s). In specific examples, then (and/or at any suitable time and frequency) in vitro and/or in vivo assays can be used for testing; resulting formulations of peptides and/or other suitable molecules can be used for gastric cancer diagnostics and/or treatment.
Specific Examples—Molecular Structures
[0185] First (and/or performed at any time and/or frequency; etc.), a molecular structure of ID (intracellular domain) can be modeled (e.g., homology model; etc.) using as template the crystallographic structure of E-cadherin of Mus musculus (PDB code: 1I7X), and the subsequence of P12830 from Uniprot as target; however, any suitable molecules and/or components can be used as the template and target.
TABLE-US-00014 >sp|P12830|731-882 LRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSL LVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE DD
[0186] The crystal structure of bacterial virulence protein CagA-CM (particularly the CM domain of CagA) can be obtained from Protein Data Bank (PDB code: 3EIC). However, any suitable databases can be used, and/or any suitable templates (e.g., suitable regions, suitable strains, etc.) can be used.
Specific Examples—Molecular Docking
[0187] A molecular docking can be performed to model the interaction between E-cadherin and CagA at the atomic level, such as for use in characterizing the particular binding site, of the interaction of CagA-CM in a non-specific location of CD domain protein. In a specific example, the docking showed a clear in region corresponding to “DTDPTAPPYDSL” peptide.
[0188] However, any suitable docking characterization approaches and/or suitable in silico approaches and/or other suitable approaches can be performed for modeling interaction and/or for other suitable purposes.
Specific Examples—Reengineering
[0189] Taking into account the above (and/or suitable approaches described herein), embodiments of the method and/or system can include designing inhibitors of Helicobacter pylori, such as to abolish the GC cell growth and/or oncogenic responses (e.g., based on the inhibition of Citotoxin gen A (CagA); etc.). In examples, the method and/or system can include reengineering of “DTDPTAPPYDSL” inhibitory peptide (and/or other suitable selected peptides, such as based on molecular docking characterization(s); etc.) using a docking method approach; but any suitable approach can be used for reengineering. The reengineering can include mutating any combination of and/or each position of “DTDPTAPPYDSL” peptide for the 19 (and/or other suitable number of) amino acids remaining. Thus, a control docking between the control peptide and CagA can be performed. In a specific example, the control docking resulted in a binding energy of −4.0 kcal/mol. Docking between reengineered peptides and CagA was performed. Examples of Results are described in the next table, highlighting the most favorable substitutions:
Embodiments can Additionally or Alternatively Include:
[0190] inhibitors of CagA-H. pylori, which are based on peptide DTDPTAPPYDSL, where:
Position 1: R,H,I,F,P,W,Y
Position 2: N
Position 3: N,Y
Position 4: E,L,Y
Position 5: R,L
Position 6: S
Position 7:R,E,I,L
Position 8: I,LW
Position 9: F
Position 10: F,W
Position 11: A,D,E,H,I,L,Y
Position 12: A,N,W,Y.
[0191] In some embodiment, the CagA inhibitor has the sequence of X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12; wherein: [0192] X.sub.1 is D, R, H, I, F, P, W, or Y; [0193] X.sub.2 is T or N; [0194] X.sub.3 is D, N, or Y; [0195] X.sub.4 is P, E, L, or Y; [0196] X.sub.5 is T, R, or L; [0197] X.sub.6 is A or S; [0198] X.sub.7 is P, R, E, I, or L; [0199] X.sub.8 is P, I, L, or W; [0200] X.sub.9 is F, or Y; [0201] X.sub.10 is D, F, or W; [0202] X.sub.11 is S, A, D, E, H, I, L, or Y; and [0203] X.sub.12 is L, A, N, W, or Y.
[0204] Embodiments of the present disclosure include peptides having at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or 100% identity, to the sequence of SEQ ID NO: 1-38, listed in Table 13. Embodiments of the present disclosure also include peptides having non-natural amino acid.
TABLE-US-00015 TABLE 3 peptide sequences SEQ ID No Sequence Binding energy 1 DTDPTAPPYDSL −4.0 2 RTDPTAPPYDSL −4.3 3 HTDPTAPPYDSL −4.4 4 IDTDPTAPPYDSL −4.3 5 FTDPTAPPYDSL −4.3 6 PTDPTAPPYDSL −4.3 7 WTDPTAPPYDSL −4.3 8 YTDPTAPPYDSL −4.7 9 DNDPTAPPYDSL −4.5 10 DTNPTAPPYDSL −4.2 11 DTYPTAPPYDSL −4.2 12 DTDEAPPYDSL −4.3 13 DTDLTAPPYDSL −4.3 14 DTDYTAPPYDSL −4.5 15 DTDPRAPPYDSL −4.3 16 DTDPLAPPYDSL −4.3 17 DTDPTSPPYDSL −4.3 18 DTDPTARPYDSL −4.3 19 DTDPTAEPYDSL −4.3 20 DTDPTAIPYDSL −4.4 21 DTDPTALPYDSL −4.3 22 DTDPTAPIYDSL −4.4 23 DTDPTAPLYDSL −4.4 24 DTDPTAPWYDSL −4.3 25 DTDPTAPPFDSL −4.4 26 DTDPTAPPYFSL −4.5 27 DTDPTAPPYWSL −4.3 28 DTDPTAPPYDAL −4.3 29 DTDPTAPPYDDL −4.4 30 DTDPTAPPYDEL −4.3 31 DTDPTAPPYDHL −4.3 32 DTDPTAPPYDIL −4.4 33 DTDPTAPPYDLL −4.3 34 DTDPTAPPYDYL −4.7 35 DTDPTAPPYDSA −4.2 36 DTDPTAPPYDSN −4.2 37 DTDPTAPPYDSW −4.2 38 DTDPTAPPYDSY −4.2
[0205] However, any suitable substitutions can be made, such as for improving binding energy metrics.
[0206] Embodiments of the method and/or system can additionally or alternatively include: [0207] The use of the aforementioned inhibitors (and/or suitable molecules described herein, such as molecules derivable from approaches described herein; etc.) to diagnose and/or treat GC and/or a health condition wherein H. pylori is involved, and/or any suitable conditions. [0208] The use of the specific inhibitors described herein (and/or derivable from approaches described herein; etc.) to diagnose and/or treat GC and/or a health condition wherein H. pylori is involved, and/or any suitable conditions (e.g., gastrointestinal conditions; cancer conditions; etc.). [0209] A methodology to obtain inhibitors of a protein, wherein the methodology comprises a modeling of the protein, identifying binding sites to perform docking of molecules (e.g peptides), and/or selecting those molecules as best binders to the modeled protein. [0210] One or more therapeutic compositions based on, including, and/or otherwise associated with one or more peptides, inhibitors, binding sites, and/or molecules described herein, such as for facilitating diagnosis and/or therapeutic intervention for GC, conditions associated with H. pylori, and/or any suitable conditions (e.g., gastrointestinal conditions; cancer conditions; etc.).