NICKEL CHELATION THERAPY
20220117266 · 2022-04-21
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K31/15
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/15
HUMAN NECESSITIES
International classification
Abstract
This disclosure describes compositions including dimethylglyoxime (DMG) and methods of using those compositions including, for example, to reduce the availability of nickel in the subject. In some aspects, the composition may be administered to a subject suffering from or susceptible to a bacterial infection and/or to a subject suffering from or susceptible to a amyloid-β peptide aggregation. In some aspects, this disclosure describes using DMG or a composition including DMG to disrupt a biofilm or reduce the likelihood of biofilm formation.
Claims
1. A composition comprising: a chelator wherein the chelator comprises soluble DMG; and a carrier.
2. The composition of claim 1, wherein the carrier is a pharmaceutically acceptable carrier.
3. The composition of claim 1, wherein the carrier comprises an aqueous liquid elixir.
4. The composition of claim 3, wherein the aqueous liquid elixir comprises a sugar.
5. The composition of claim 1, wherein the carrier comprises a food product.
6. The composition of claim 1, further comprising an additional active agent.
7. The composition of claim 6, wherein the additional active agent comprises a metallic ion or a compound that produces a metallic ion.
8. The composition of claim 6, wherein the additional active agent comprises a divalent cation.
9. A method for administering the composition of claim 1 to a subject.
10. The method of claim 9, wherein the subject comprises a human or an animal.
11. The method of claim 10, wherein the animal comprises a chicken.
12. The method of claim 9, wherein the composition further comprises copper.
13. The method of claim 9, wherein the subject is infected with a pathogen or susceptible to infection by a pathogen.
14. The method of claim 13, wherein the pathogen comprises a pathogen that comprises a nickel-containing enzyme, a fungus that comprises a nickel-containing enzyme, or a non-fungal eukaryotic pathogen that comprises a nickel-containing enzyme
15. The method of claim 13, wherein the pathogen comprises a multi-drug resistant pathogen.
16. The method of claim 13 wherein the pathogen comprises Acinetobacter baumannii, Enterococcus faecium, Escherichia coli, Helicobacter pylori, Haemophilus influenzae, Neisseria gonorrhoeae, Streptococcus pneumoniae, a Campylobacter species, an Enterobacter species, a Klebsiella species, a Morganella species, a Proteus species, a Providencia species, a Pseudomonas species, a Salmonella species, a Serratia species, a Shigella species, or a Staphylococcus species, or a combination thereof, Cryptococcus neoformans, Cryptococcus gattii, Coccidioides posadasii, Histoplasma capsulatum, or Paracoccidioides brasiliensis, or a combination thereof; or Pythium insidiosum, Leishmania major, Leishmania donovani, or Trypanosoma cruzi, or a combination thereof.
17. The method of claim 9, wherein the subject is suffering from or susceptible to a disease associated with Amyloid-β peptide aggregation.
18. The method of claim 17, wherein the disease is Alzheimer's, Down Syndrome, or both.
19. A method of disrupting a biofilm or preventing biofilm formation, the method comprising treating a surface with dimethylglyoxime (DMG).
20. The method of claim 19, wherein the biofilm comprises a Campylobacter species, Helicobacter pylori, a Klebsiella species, a Proteus species, a Pseudomonas species, a Salmonella species, or a Staphylococcus species, or a combination thereof.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0051] This disclosure describes compositions including dimethylglyoxime (DMG) and methods of using those compositions. In some aspects, this disclosure describes administering the composition including DMG to reduce the availability of nickel in the subject. In one aspect, this disclosure describes administering the composition to a subject suffering from or susceptible to a bacterial infection. In some embodiments, the bacterial infection may include a multi-drug resistant (for example, an antibiotic resistant) bacterium. In another aspect, this disclosure describes administering a composition including DMG to a subject suffering from or susceptible to a amyloid-β peptide aggregation. In a further aspect, this disclosure describes administering a composition including DMG to a subject suffering from or susceptible to a nickel allergy and/or an obese subject. In yet another aspect, this disclosure describes administering a composition including DMG to a subject to alter the balance of bacteria in the subject's microbiome. In some aspects, this disclosure describes using DMG or a composition including DMG to disrupt a biofilm or reduce the reduce likelihood of biofilm formation.
Metal Chelation and Bacteria
[0052] Nickel is required as a cofactor for several bacterial enzymes, including acireductone dioxygenase, [NiFe]-hydrogenase, glyoxalase I, superoxide dismutase, and urease (Benoit and Maier 2013 Nickel Ions in Biological Systems, p. 1501-1505 in Kretsinger et al. (eds.), Encyclopedia of Metalloproteins. Springer New York, N.Y., N.Y.). The nickel requirement for enzymes is associated only with bacterial (and not host) enzymes. Therefore, nickel sequestration is a possible therapeutic target to combat several pathogens (see, for example, Rowinska-Zyrek et al. 2014. Dalton Trans 43:8976-8989); see also Table 1A-Table 1B. For instance, targeting nickel trafficking pathways to inactivate both the H.sub.2-uptake [Ni—Fe]hydrogenase and the urease in the gastric pathogen Helicobacter pylori has been proposed (de Reuse et al. 2013 Front Cell Infect Microbiol 3:94; Maier 2003 Microbes Infect. 5:1159-1163).
TABLE-US-00001 TABLE 1A Ni-containing enzyme Hydrogenase Urease Glyoxalase I Aci. Dioxygenase Uses or produces Converts detoxifies converts 1,2-dihydroxy-5 H.sub.2 (number in urea to methyl-glyoxal 2017 WHO priority MDR pathogens brackets .fwdarw.number CO.sub.2 (metabolism to 3-(methyl
with Ni-containing enzymes of H.sub.2ases and NH.sub.2 byproduct)
and CO.sub.2 Priority 1: CRITICAL Carbapenem
Acinetobacter bo
mannii ✓ ✓ ✓ Carbapenem
Pseudomonas aeruginosa ✓ ✓ ✓ ✓ Carbapenem
Klebsiella pneumoniae ✓ ✓ ✓ 3rd gen. Cephalosporin
Escherichia coli ✓ (4) ✓ ✓ Enterobacteriaceae Enterobacter spp. ✓ (2) ✓ ✓ ✓ Serr
tia spp. ✓ ✓ ✓ Proteus spp. ✓ ✓ ✓ ✓ Providencia spp. ✓ ✓ ✓ ✓ Morganella spp. ✓ ✓ ✓ Priority 2: HIGH Vancomycin
Enterococcus faecium ✓ Methycillin
, Vancomycin
Staphylococcus aureus ✓ Clarythromycin
Helicobacter pylori ✓ ✓ Fluroquinolone
Campylobacter spp. ✓ Fluroquinolone
Salmonella spp. ✓ (4) ✓ ✓ Cephalosporin
, Fluroquinolone
Neisseria gonorrhoeae ✓? ✓ Priority 3: MEDIUM Penicillin
Streptococcus pneumoniae ✓ ✓ ✓ Ampicillin
Haemophilus influenzae ✓ ✓ Fluroquinolone
Shigella spp. ✓ (3) ✓ ✓ Ni-containing enzyme Comments Hyp accessory proteins are needed for hydrogenase Ure accessory proteins are needed for urease 2017 WHO priority MDR pathogens GloA .fwdarw. glyoslase (135
, very conserved) with Ni-containing enzymes MtnD .fwdarw. acireductone dioxyenase Priority 1: CRITICAL Carbapenem
Acinetobacter bo
mannii Ure; Only one Hyp6 and one HycD homolog; GloA; MntD Carbapenem
Pseudomonas aeruginosa Hyp and Ure; GloA; MtnD Carbapenem
Klebsiella pneumoniae Ure; GloA; MtnD 3rd gen. Cephalosporin
Escherichia coli Hyp; GloA; MntD Enterobacteriaceae Enterobacter spp. Hyp and Ure; GloA; MntD Serr
tia spp. Ure; GloA; MtnD Proteus spp. Hyp and Ure; GloA; MtnD Providencia spp. Hyp and Ure; GloA; MtnD Morganella spp. Hyp and Ure; GloA Priority 2: HIGH Vancomycin
Enterococcus faecium Ure accessory and structural Methycillin
, Vancomycin
Staphylococcus aureus Prot annotated as “soluble hydrogenase”, no match. Ure. Clarythromycin
Helicobacter pylori Hyp and Urea Fluroquinolone
Campylobacter spp. Hyp Fluroquinolone
Salmonella spp. Hyp; GloA; MntD Cephalosporin
, Fluroquinolone
Neisseria gonorrhoeae UreA8C in Neisseria ssp. (can't find hit in N. gonnorrhea); GloA Priority 3: MEDIUM Penicillin
Streptococcus pneumoniae Hy
8 homolog; Ure accessory; GloA; MntD Ampicillin
Haemophilus influenzae Ure accessory found; GloA Fluroquinolone
Shigella spp. Hyp and Ure accessory found; GloA
indicates data missing or illegible when filed
TABLE-US-00002 TABLE 1B Pathogen Ni-Enzyme EUKARYOTES Human fungi Cryptococcus neoformans Ure Cryptococcus gattii Ure Coccidioides posadasii Ure Histoplasma capsulatum Ure Paracoccidioides brasiliensis Ure Oomycetes Pythium insidiosum Ure Protists Leishmania major Glo-I Leishmania donovani Glo-I Trypanosoma cruzi Ard, Glo-I PROKARYOTES Actinobacteria Actinomyces naeslundii Ure Corynebacterium urealyticum Ure Mycobacterium tuberculosis Hyc, Ure Streptomyces scabies Sod Firmicutes Clostridia Glo-I Staphylococcus aureus Ure Staphylococcus epidermidis Ure Staphylococcus saprophyticus Ure Streptococcus salivarius Ure Mollicutes Ureaplasma urealyticum Ure Ureaplasma parvum Ure Ureaplasma diversum Ure Proteobacteria Alphaproteobacteria Brucella abortus Ure Brucella melitensis Ure Brucella suis Ure Betaproteobacteria Neisseria meningitides Glo-I Neisseria gonorrhoeae Glo-I Gammaproteobacteria All γ-proteobacteria Ard All γ-proteobacteria Glo-I Acinetobacter baumannii Ure Acinetobacter lwoffii Ure Actinobacillus Ure pleuropneumoniae Hyd-1 Escherichia coli Hyd-2, Hyc E. coli (Shiga-toxin producing) Ure Edwardsiella tarda Hyd Haemophilus influenzae Ure Klebsiella pneumoniae Ure Morganella morganii Ure Proteus mirabilis Hyd, Ure Providencia stuartii Ure Pseudomonas aeruginosa Glo-I Salmonella Typhimurium Hyd-1, Hyd-2, Hyd-5, Hyc Shigella flexneri Hyd Vibrio parahaemolyticus Ure Yersinia enterocolitica Ure Yersinia pestis Glo-I Deltaproteobacteria Bilophila wadsworthia Hyd Epsilonproteobacteria Campylobacter jejuni Hyd Campylobacter concisus Hyd Helicobacter hepaticus Hyd, Ure Helicobacter mustelae Ure Helicobacter pylori Hyd, Ure (Abbreviations: Ard: acireductone dioxygenase; Glo-I: Glyoxalase I; Hyc: H.sub.2-evolving hydrogenase; Hyd: H.sub.2-uptake hydrogenase; Sod: superoxide dismutase; Ure: urease.)
[0053] The nickel requirement for Cryptococcus neoformans's urease has been identified as the fungus's “Achilles' heel” (Morrow et al. 2013 mBio 4(4):e00408-13). Furthermore, the host defense protein human calprotectin sequesters nickel away from two pathogens, Staphylococcus aureus and Klebsiella pneumoniae, subsequently inhibiting their respective urease activity in bacterial culture (Nakashige et al. 2017 J Am Chem Soc 139:8828-8836). Many Enterobacteriaceae depend on nickel as a cofactor for their hydrogenase and/or urease enzymes. Escherichia coli and Salmonella species, including S. enterica serovar Typhimurium (referred to herein as S. Typhimurium), possess several Ni-containing hydrogenases (but not urease), while Klebsiella species, such as K. pneumoniae, possess a urease, as well as several hydrogenases. Molecular hydrogen (H.sub.2) use (by H.sub.2-uptake [Ni—Fe] hydrogenases Hya, Hyb and Hyd) is play a role in for S. Typhimurium virulence (Maier et al. 2004 Infect Immun 72:6294-6299; Maier et al. 2014 PLoS One 9:e110187; Lamichhane-Khadka et al. 2015. Infect Immun 83:311-316). Although not formally demonstrated, H.sub.2 metabolism may play a role in K. pneumoniae's virulence. These results and predictions highlight the potential for Ni-chelation as an antibacterial therapy (Maier and Benoit, 2019 Inorganics 2019; 7:80); Benoit et al., 2020 MMBR 00092-19).
Metal Chelation and Amyloid Beta (Aβ) Peptides
[0054] Alzheimer's disease occurs sporadically in most cases; however, a sizable number of cases can be linked to mutations in various genes. For instance, mutations in the APP gene, or in genes encoding for enzymes involved in the APP processing (e.g. PSEN1 or PSEN2), are predominantly associated with early onset Alzheimer's Disease, whereas mutations in genes encoding for enzymes related to Aβ turnover, such as the apolipoprotein E (e.g APOE), are usually associated with late onset Alzheimer's Disease (Saunders et al. Neurology 43, 1467-1472 (1993); Giri et al. Clinical interventions in aging 11, 665 (2016)). Besides genetic factors, environmental factors have been shown to play a role in AD, as revealed by a study on twins (Gatz et al. Archives of general psychiatry 63, 168-174 (2006)). Environmental factors include toxic gases, such as CO, CO.sub.2, SO.sub.2 and NO.sub.2 (Saranya et al. Biophys Chem 263, 106394 (2020)), or metals, several of which have been shown to play a role on Aβ aggregation, fibrillization, and toxicity, with potential implications on the progression of AD (Liu et al. Acc Chem Res 52, 2026-2035 (2019)). The list includes heavy metals, such as aluminum (Al) (Ricchelli et al. Cellular and Molecular Life Sciences CMLS 62, 1724-1733 (2005)), cadmium (Cd) (Notarachille et al. Biometals 27, 371-388 (2014)) and mercury (Hg) (Olivieri et al. Journal of neurochemistry 74, 231-236 (2000); Meleleo et al. Biophys Chem 266, 106453 (2020)). The list includes essential metals, such as copper (Cu) and zinc (Zn), and to a lesser extent, iron (Fe)(Kozlowski et al. Coordination Chemistry Reviews 256, 2129-2141 (2012)). The role of Cu(I), Cu(II), and Zn(II) has been well documented (Tõugu et al. Metallomics 3, 250-261 (2011); Mathys et al. Neurotoxicity of Metals, 199-216 (2017); Hureau et al. Biochimie 91, 1212-1217 (2009)). For example, both Aβ.sub.40 and Aβ.sub.42 peptides bind Cu(II) or Zn(II) with significant affinity in vitro, leading to Aβ aggregation (Ricchelli et al. Cellular and Molecular Life Sciences CMLS 62, 1724-1733 (2005); Bush et al. Science 265, 1464-1467 (1994); Chen et al. Inorganic chemistry 48, 5801-5809 (2009); Huang et al. J Biol Chem 272, 26464-26470 (1997); Atwood et al. J Biol Chem 273, 12817-12826 (1998)). Additionally, a similar effect was observed in vivo, leading to plaque build-up and toxicity in AD animal models, for instance with Cu(II) in rabbits (Sparks et al. Proc Natl Acad Sci USA 100, 11065-11069 (2003)), or with Zn(II) in mice (Lee et al. Proc Natl Acad Sci USA 99, 7705-7710 (2002)). Furthermore, post-mortem analysis revealed that respective Cu, Fe, and Zn levels in plaques of AD brains were 5.7, 2.8, and 3.1-fold higher compared to normal brains (Lovell et al. J Neurol Sci 158, 47-52 (1998)). Finally, accumulation of Cu and Zn are co-localized with Aβ peptide deposits (Miller et al. J Struct Biol 155, 30-37 (2006)). Taken together, these results have resulted in the theory known as the “metal hypothesis of AD,” that links metal homeostasis (especially that of Cu, Fe and Zn) and AD (Bush et al. Neurotherapeutics 5, 421-432 (2008)). Recent discoveries on Aβ peptides-lipid interactions have confirmed the importance of metals in the onset and progression of AD. For example, Aβ peptides can associate with cellular membranes (Sciacca et al. ACS Chemical Neuroscience 11, 4336-4350 (2020)), and Aβ-bound metals (especially Zn and Al). Additionally, Aβ peptides can blockade and disrupt Ca.sup.2+ channels, leading to neurotoxicity (Kotler et al. Chemical Society Reviews 43, 6692-6700 (2014)).
[0055] In contrast to Cu, Fe, and Zn, which are required cofactors for hundreds of enzymes and fairly abundant in animals and humans (Maret Metallomics 2, 117-125 (2010)), nickel (Ni) does not appear to be needed in mammals, as mammalian hosts do not contain known Ni-dependent enzymes (Maier et al. Inorganics 7, 80 (2019)). Furthermore, Ni levels are low, with less than 5 ppm (μg/g of ash) in most human organs, corresponding to less than 1% of the amount of Zn measured in the brain, heart, lung, or muscle, and less than 0.1% of the amount of Zn in the liver and kidney (Iyengar et al., (1978)). Even though Ni is rarely mentioned in association with Aβ peptides, a potential role for this transition metal should not be discarded.
Use of Metal Chelators at the Time of the Disclosure
[0056] At the time of this disclosure, metal chelators are already used (or are under evaluation in clinical trials) as drugs to control various human diseases, including cardiovascular diseases and Alzheimer's disease. Oral chelation is currently used to treat the hepatocellular copper inherited disorder known as Wilson disease. Furthermore, metal chelators can also be used to neutralize metal toxicity (Aaseth et al. 2015 J Trace Elem Med Biol 31:260-266; Sears 2013 Scientific World Journal 2013:219840), including nickel toxicity. For example, the chelating agent sodium diethyldithiocarbamate (DCC) has been shown to be an effective drug against nickel carbonyl poisoning (Sunderman 1990 Ann Clin Lab Sci 20:12-21). Similarly, disulfiram, a compound which is eventually metabolized in two DCC molecules, is FDA-approved to treat nickel carbonyl poisoning. For some diseases there are clear benefits to chelation therapy, but in some cases the therapies have been met with mixed results (Mathew et al. 2017 Cardiovasc Drugs Ther 31:619-625; Roberts et al. 2017 Handb Clin Neurol 142:141-156; Aaseth et al. 2015 J Trace Elem Med Biol 31:260-266). For example, some chelating chemicals have associated toxic side effects (Aaseth et al. 2015 J Trace Elem Med Biol 31:260-266; Andersen et al. 2016 J Trace Elem Med Biol 38:74-80.) Therefore, the use of “old” chelators such as ethylenediamine tetraacetate (EDTA) and 2,3-dimercaptopropanol (BAL) is now restricted, due to their toxicity (Aaseth et al. 2015 J Trace Elem Med Biol 31:260-266). The use of disulfiram is also controversial, since it has been associated with elevated nickel levels in rat brains (Baselt et al. 1982. Res Commun Chem Pathol Pharmacol 38:113-124), as well as with hepatotoxicity in humans (Kaaber et al. 1979. Contact Dermatitis 5:221-228), and elevated nickel levels in the body fluids of patients with chronic alcoholism (Hopfer et al. 1987 Res Commun Chem Pathol Pharmacol 55:101-109).
[0057] Metal chelators have been investigated to inhibit Aβ peptide aggregation with mixed outcomes (Santos et al. Coordination Chemistry Reviews 327, 287-303 (2016)). Chelators, such as ethylene glycol-bis(β-aminoethyl ether)-N,N,N′,N′-tetraacetic acid (EGTA or egtazic acid), N,N,N′,N′-tetrakis(2-pyridyl-methyl) ethylene diamine (“tpen”), and bathocuproine solubilize AR plaques from post-mortem brain tissue (Cherny et al. J Biol Chem 274, 23223-23228 (1999)). The 8-hydroxyquinoline derivatives Clioquinol and BPT-2, two copper-zinc chelators, have shown promising results in vitro (Bush et al. Neurotherapeutics 5, 421-432 (2008); Cherny et al. Neuron 30, 665-676 (2001)). The ability of 8-hydroxyquinoline derivatives Clioquinol and BPT-2 to cross the blood-brain-barrier (BBB) have been tested in clinical trials; however, the results appear inconclusive (Sampson et al. Cochrane Database of Systematic Reviews, (2014)). In another unrelated clinical trial, the rate of decline of daily living skills was significantly reduced in AD patients given desferrioxamine (sometimes called deferoxamine) intramuscular twice daily for two years (Crapper McLachlan et al. Lancet 337, 1304-1308 (1991)). This effect was initially attributed to aluminum chelation, however desferrioxamine binds preferentially to iron (also copper and zinc, albeit with lower affinity); hence it is hard to draw firm conclusions about this trial. Alternative ways to target and modulate the toxicity of metal-bound (or metal-free) Aβ species include the use of (i) glycosylated polyphenols and their esterified derivatives, which present the advantage of using natural low toxicity compounds (Korshavn et al. Sci Rep 5, 17842 (2015)); (ii) synthetic flavonoids and amino-isoflavones, which have shown promising results towards targeting metal sites (DeToma et al. Chem Sci 5, 4851-4862 (2014)); (iii) small molecules, such as N.sup.1,N.sup.1-dimethyl-N.sup.4-(pyridin-2-ylmethyl)benzene-1,4-diamine (“L2-b”) and its derivatives (Lee et al. Chemistry 23, 2706-2715 (2017); Lee et al. J Am Chem Soc 136, 299-310 (2014)); (iv) j-sheet breakers, which are small peptides (five amino-acids long) effective in reducing the Aβ.sub.1-40 aggregation, even in the presence of metal ions (Stellato et al. Biophys Chem 229, 110-114 (2017)).
Dimethylglyoxime (DMG)
[0058] As further described in Example 1, nickel-specific chelation and the inhibition of bacterial growth was achieved in vitro and in vivo using dimethylglyoxime (DMG). Two molecules of DMG are needed to coordinate one Ni(II) molecule (
[0059] DMG is also used to determine nickel levels in the environment (in soil, water, industrial effluents) (Ferancova et al. 2016 J Hazard Mater 306:50-57; Ershova et al. 2000 Fresenius J Anal Chem 367:210-211; Onikura et al. 2008 Environ Toxicol Chem 27:266-271). Additionally, DMG is used to assess possible toxic levels of nickel in various items, including jewelry (Thyssen et al. 2009. Sci Total Environ 407:5315-5318), mobile phones (Jensen et al. 2011. Contact Dermatitis 65:354-358) or surgical items (Boyd et al. 2018 Dermatol Online J 24(4)).
[0060] DMG has also been used to remove nickel from laboratory supplies, growth media, equipment, (Benoit et al. 2013 Infect Immun. 81:580-584) and from whole bacterial cells with the aim of studying roles of nickel in microbes. For example, DMG has been used in studies on maturation of Ni-binding proteins (for example, hydrogenase and/or urease) in H. pylori (Maier 2003 Microbes Infect 5:1159-1163; Seshadri et al. 2007 J Bacteriol 189:4120-4126; Saylor et al. 2018 Microbiology 164:1059-1068; Benanti et al. 2009 J Bacteriol 191:2405-2408) or in Azotobacter chroococcum (Partridge et al 1982 Biochem J 204:339-344).
[0061] In 2007, insoluble DMG (Sigma #D-1885 with formula weight of 116.12 g/mol) was tested for pathogen-inhibitory properties. The DMG was administered as ethanolic solutions, and the animals (BALB/C mice) appeared ill even when given chelator alone, exhibiting symptoms consistent with extreme constipation. Without wishing to be bound by theory, it is believed that upon stomach absorption of the ethanol, DMG came out of solution and caused intestinal compaction.
Methods of Using DMG
[0062] In one aspect, this disclosure describes a method that includes administering a chelator or a pharmaceutical composition including a chelator to a subject. In some embodiments, the chelator preferably includes dimethylglyoxime (DMG).
[0063] In some embodiments, the chelator or the pharmaceutical composition including the chelator may be administered to a subject to reduce the availability of a metal species in the subject. In some embodiments, the metal species preferably includes nickel. In some embodiments, the metal species includes copper.
[0064] In some embodiments, the chelator may be administered to a subject in an amount sufficient to reduce the availability of a metal species in the subject. In some embodiments, the chelator may be administered (including, for example, to a subject) in an amount sufficient to inhibit the growth of a pathogen. In some embodiments, the chelator may be administered to a subject in an amount sufficient to halt or slow the progression of a pathogenic infection or symptoms of a pathogenic infection within the subject. In some embodiments, the chelator may be administered to a subject suffering from or susceptible to a disease associated with amyloid-β peptide aggregation, for example Alzheimer's disease or Down syndrome. In some embodiments, the chelator may be administered to a subject suffering from or susceptible to a nickel allergy. In some embodiments, the chelator may be administered to an obese subject. In some embodiments, the chelator may be administered to a subject to alter the balance of bacteria in the subject's microbiome.
[0065] In some embodiments, the DMG preferably includes soluble DMG. In some embodiments, soluble DMG preferably includes water soluble DMG. In some embodiments, the soluble DMG includes the disodium salt DMG and/or disodium salt octahydrate DMG. In some embodiments, the soluble DMG preferably includes the disodium salt octahydrate DMG. Given the previous results with insoluble DMG including the toxicity observed in mice, the high efficacy and low toxicity of DMG described herein was particularly unexpected. Solubility is based on the vendor's definition of solubility as can be ascertained by the vendor's technical data, the Material Safety Data Sheet, the Safety Data Sheet, or by other data provided by the vendor. Additionally, the solubility may be determined by dissolving an amount of DMG in a known amount of solvent (e.g., water) and visually observing the opacity of the resulting solution. Generally, DMG is not soluble if the resulting solution has visible precipitates or is opaque. Generally, DMG is soluble if the resulting solution is clear with no visible principates. Generally, anhydrous DMG is not soluble in aqueous buffers and requires an additional non-aqueous solvent to dissolve. Generally, the disodium salt octahydrate DMG is soluble in water and aqueous buffers.
[0066] A subject may include a human or an animal. An animal may include a companion animal, a domesticated animal such as a farm animal, an animal used for research, or an animal in the wild. Companion animals include, but are not limited to, dogs, cats, hamsters, gerbils, and guinea pigs. Domesticated animals include, but are not limited to, domesticated fowl including chickens and turkeys, cattle, horses, pigs, goats, and llamas. Research animals include, but are not limited to, mice, rats, dogs, apes, and monkeys.
[0067] In some embodiments, treatment of domesticated fowl, such as chickens or turkeys, with a chelator (for example, DMG) may be particularly desirable because infection of domesticated fowl with C. jejuni is a major cause of food poisoning. In some embodiments, DMG may be co-administered with copper in domesticated fowl. As described in Example 4 and Example 5, while millimolar levels of DMG are bacteriostatic against C. jejuni, the addition of micromolar levels of copper(II) surprisingly rendered millimolar levels of DMG bactericidal towards C. jejuni. Additionally, without wishing to be bound by theory, it is believed that, because of the high levels of copper already present in the diets of many chickens, co-administration of additional copper may not be necessary to see the bactericidal effect of DMG. In some embodiments, domesticated fowl, such as chickens, are treated with a chelator (for example, DMG) without additional providing additional copper beyond the copper already present in the diet of the chickens. Example 5 demonstrates that millimolar concentrations of DMG reduces the likelihood of C. jejuni colonization in chickens.
[0068] Without wishing to be bound by theory,
Compositions Including a Chelator Active Agent
[0069] In another aspect, the present disclosure provides a composition including, for example, that includes as an active agent, a chelator as described herein, and a carrier. In some embodiments, the chelator includes DMG.
[0070] The active agent is formulated in a composition and then, in accordance with the methods of the disclosure, administered to a subject. In some embodiments, the subject is a vertebrate, particularly a mammal, such as a human patient, companion animal, or domesticated animal. In some embodiments the domesticated animal is domesticated fowl. In some embodiments, the domesticated fowl is a chicken. The composition is formulated in a variety of forms adapted to the chosen route of administration. In some embodiments, the preferred route is oral administration.
[0071] Oral administration of the DMG containing composition to a domesticated animal, particularly domesticated fowl, includes a carrier. In some embodiments, the carrier is an aqueous liquid. In some embodiments, the carrier is a food product.
[0072] The aqueous liquid carrier may include an elixir. In some embodiments, the elixir may contain 5%-40% by volume ethanol. In some embodiments, the elixir is substantially free of ethanol. In some embodiments, the elixir is essentially free of ethanol. In some embodiments, the elixir is free of ethanol. The elixir may contain additives. The elixir addictive may be a sugar. Examples of sugars include, but are not limited to, glucose (dextrose), sucrose (saccharose), lactose, maltose, galactose, mannose, trehalose, arabinose, dextrin, ribose, xylose, and combinations thereof. The sugar elixir additives may be already formulated as food products such as agave syrup, barley malt syrup, beet sugar, birch syrup, brown sugar, cane sugar, carbo sugar, coconut sugar, confectioner's sugar, corn sugar, corn syrup, date sugar, cane juice, honey, fruit juice, maltodextrin, maple sugar, maple syrup, molasses, powdered sugar, rice malt, sweet sorghum, treacle, sugar cane, or combinations thereof. The elixir additive may be a flavor enhancer. Flavor enhancers include, but are not limited to, aspartame, salt, artificial flavors, natural flavors, artificial sweeteners, or combinations thereof. In some embodiments, the aqueous liquid contains nutrient supplements including, but not limited to, electrolytes, vitamins, minerals, prebiotics, and combinations thereof.
[0073] The food product carrier may be any food product suitable for oral consumption by a subject, such as a domesticated animal. The active agent may be incorporated into the animal's diet by incorporating the active agent into the animal's feed. The active agent may be incorporated into crumbles, pellets, and mash food products. The active agent containing food product may also contain one or more of the following: a binder such as gum tragacanth, acacia, corn starch, or gelatin; an excipient such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid, and the like; a lubricant such as magnesium stearate; a sweetening agent such as sucrose, fructose, lactose, or aspartame; and a natural or artificial flavoring agent.
[0074] In some embodiments, the carrier includes an additional active agent. In some embodiments, the additional active agent preferably includes an antibacterial compound. In some embodiments, the antibacterial compound includes copper. In some embodiments, the additional active agent may include a metallic ion or an antibacterial compound that produces a metallic ion.
[0075] In some embodiments, when the antibacterial compound includes copper, the copper may include copper(I) or copper(II). In some embodiments, including, for example when a composition or compound is intended to be administered to a subject suffering from or susceptible to a Campylobacter jejuni infection, the metallic ion may preferably be Cu.sup.2+. As described in Example 4, while millimolar levels of DMG are bacteriostatic against C. jejuni, the addition of micromolar levels of copper(II) renders millimolar levels of DMG bactericidal towards C. jejuni. This effect was unexpected and was serendipitously discovered. While testing the ability of nickel to inhibit DMG-mediated growth inhibition of C. jejuni, zinc and copper were used as a control. Rather than copper having no effect of the ability of DMG to inhibit the growth of C. jejuni, an increased effect on the ability of DMG to inhibit the growth of C. jejuni was observed.
[0076] In some embodiments, the metallic ion is preferably a divalent cation. Exemplary divalent cations include copper(II) (Cu.sup.2+); cobalt(II) (Co.sup.2+); manganese(II) (Mn.sup.2+); zinc(II) (Zn.sup.2+); and tin(II) (Sn.sup.2+). In some embodiments, the divalent cation does not include nickel, or, because of their toxicity to subjects, cadmium(II) (Cd.sup.2+), mercury(II) (Hg.sup.2+) or lead(II) (Pb.sup.2+) In embodiments when the antibacterial compound produces a metallic ion, the compound may preferably be a salt or another compound that produces a metal ion upon being dissolved, for example, in water or another pharmaceutical carrier. Exemplary salts include, CuSO.sub.4, CoCl.sub.2, MnSO.sub.4, and ZnSO.sub.4 and hydrates thereof. In some embodiments one salt is used. In some embodiments, two or more salts are used.
[0077] In another aspect, the present disclosure provides a composition including, for example, a pharmaceutical composition, that includes as an active agent, a chelator as described herein, and a pharmaceutically acceptable carrier. In some embodiments, the chelator includes DMG.
[0078] The active agent is formulated in a pharmaceutical composition and then, in accordance with the method of the disclosure, administered to a subject. In some embodiments, the subject is a vertebrate, particularly a mammal, such as a human patient, companion animal, or domesticated animal, in a variety of forms adapted to the chosen route of administration. A pharmaceutical composition includes a composition suitable for oral, rectal, vaginal, topical, nasal, ophthalmic, or parenteral (including subcutaneous, intramuscular, intraperitoneal, and intravenous) administration.
[0079] The pharmaceutically acceptable carrier can include, for example, an excipient, a diluent, a solvent, an accessory ingredient, a stabilizer, a protein carrier, or a biological compound. Non-limiting examples of a protein carrier includes keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA), ovalbumin, or the like. Non-limiting examples of a biological compound which can serve as a carrier include a glycosaminoglycan, a proteoglycan, and albumin. The carrier can be a synthetic compound, such as dimethyl sulfoxide or a synthetic polymer, such as a polyalkyleneglycol. Ovalbumin, human serum albumin, other proteins, polyethylene glycol, or the like can be employed as the carrier. In some embodiments, the pharmaceutically acceptable carrier may include at least one compound that is not naturally occurring or a product of nature.
[0080] In some embodiments, the active agent may be formulated in combination with one or more additional active agents, such an antibacterial compound. Any known therapeutic agent can be included as an additional active agent. The action of the additional active agent in the combination therapy can be cumulative to the chelator or it can be complementary, for example to manage side effects or other aspects of the patient's medical condition. In one embodiment, the combination therapy includes at least one compound that is not naturally occurring or a product of nature. In some embodiments, the combination therapy includes an antibiotic including, for example, an antibiotic belonging to the β-lactam class; including, for example, penicillin derivatives, cephalosporins, or carbapenems, or combinations thereof; an antibiotic belonging to the macrolide class including, for example, erythromycin, azithromycin, or clarithromycin, or combinations thereof; an antibiotic belonging to the glycopeptide class including, for example, vancomycin; an antibiotic belonging to the fuoroquinolone class including, for example, ciprofloxacin or levofloxacin, or a combination thereof, or an antibiotic belonging to the aminoglycoside class including, for example, gentamycin, neomycin, or streptomycin, or a combination thereof, a metal or salt of a metal, or a combination thereof.
[0081] In some embodiments, the additional active agent preferably includes an antibacterial compound. In some embodiments, the antibacterial compound includes copper. In some embodiments, the additional active agent may include a metallic ion or an antibacterial compound that produces a metallic ion.
[0082] In some embodiments, when the antibacterial compound includes copper, the copper may include copper(I) or copper(II). In some embodiments, including, for example when a composition or compound is intended to be administered to a subject suffering from or susceptible to a Campylobacter jejuni infection, the metallic ion may preferably be Cu.sup.2+.
[0083] In some embodiments, the metallic ion is preferably a divalent cation. Exemplary divalent cations include copper(II) (Cu.sup.2+); cobalt(II) (Co.sup.2+); manganese(II) (Mn.sup.2+); zinc(II) (Zn.sup.2+); and tin(II) (Sn.sup.2+). In some embodiments, the divalent cation does not include nickel, or, because of their toxicity to subjects, cadmium(II) (Cd.sup.2+), mercury(II) (Hg.sup.2+) or lead(II) (Pb.sup.2+) In embodiments when the antibacterial compound produces a metallic ion, the compound may preferably be a salt or another compound that produces a metal ion upon being dissolved, for example, in water or another pharmaceutical carrier. Exemplary salts include, CuSO.sub.4, CoCl.sub.2, MnSO.sub.4, and ZnSO.sub.4 and hydrates thereof. In some embodiments one salt is used. In some embodiments, two or more salts are used.
[0084] The formulations can be conveniently presented in unit dosage form and can be prepared by any of the methods well-known in the art of pharmacy. In some embodiments, a method includes the step of bringing the active agent into association with a pharmaceutical carrier. In general, the formulations are prepared by uniformly and intimately bringing the active compound into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into the desired formulations.
[0085] Formulations of the present disclosure suitable for oral administration can be presented as discrete units such as tablets, troches, capsules, lozenges, wafers, or cachets, each containing a predetermined amount of the active agent as a powder or granules, as liposomes, or as a solution or suspension in an aqueous liquor or non-aqueous liquid such as a syrup, an elixir, an emulsion, or a draught. The tablets, troches, pills, capsules, and the like can also contain one or more of the following: a binder such as gum tragacanth, acacia, corn starch, or gelatin; an excipient such as dicalcium phosphate; a disintegrating agent such as corn starch, potato starch, alginic acid, and the like; a lubricant such as magnesium stearate; a sweetening agent such as sucrose, fructose, lactose, or aspartame; and a natural or artificial flavoring agent. When the unit dosage form is a capsule, it can further contain a liquid carrier, such as a vegetable oil or a polyethylene glycol. Various other materials can be present as coatings or to otherwise modify the physical form of the solid unit dosage form. For instance, tablets, pills, or capsules can be coated with gelatin, wax, shellac, sugar, and the like. A syrup or elixir can contain one or more of a sweetening agent, a preservative such as methyl- or propylparaben, an agent to retard crystallization of the sugar, an agent to increase the solubility of any other ingredient, such as a polyhydric alcohol, for example glycerol or sorbitol, a dye, and flavoring agent. The material used in preparing any unit dosage form is substantially nontoxic in the amounts employed. The active agent can be incorporated into preparations and devices in formulations that may or may not be designed for sustained release.
[0086] Formulations suitable for parenteral administration conveniently include a sterile aqueous preparation of the active agent, or dispersions of sterile powders of the active agent, which are preferably isotonic with the blood of the recipient. Parenteral administration of a chelator (for example, through an intravenous drip) is one form of administration. Isotonic agents that can be included in the liquid preparation include sugars, buffers, and sodium chloride. Solutions of the active agent can be prepared in water, optionally mixed with a nontoxic surfactant. Dispersions of the active agent can be prepared in water, ethanol, a polyol (such as glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, glycerol esters, and mixtures thereof. The ultimate dosage form is sterile, fluid, and stable under the conditions of manufacture and storage. The necessary fluidity can be achieved, for example, by using liposomes, by employing the appropriate particle size in the case of dispersions, or by using surfactants. Sterilization of a liquid preparation can be achieved by any convenient method that preserves the bioactivity of the active agent, preferably by filter sterilization. Preferred methods for preparing powders include vacuum drying and freeze drying of the sterile injectable solutions. The likelihood and/or extent of subsequent microbial contamination can be addressed by using various antimicrobial agents, for example, antibacterial, antiviral, antifungal agents, and combinations thereof including parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. Absorption of the active agents over a prolonged period can be achieved by including agents for delaying, for example, aluminum monostearate and gelatin.
[0087] Nasal spray formulations include purified aqueous solutions of the active agent with preservative agents and isotonic agents. Such formulations are preferably adjusted to a pH and isotonic state compatible with the nasal mucous membranes. Formulations for rectal or vaginal administration can be presented as a suppository with a suitable carrier such as cocoa butter, or hydrogenated fats or hydrogenated fatty carboxylic acids. Ophthalmic formulations are prepared by a similar method to the nasal spray, except that the pH and isotonic factors are preferably adjusted to match that of the eye. Topical formulations include the active agent dissolved or suspended in one or more media such as mineral oil, petroleum, polyhydroxy alcohols, or other bases used for topical pharmaceutical formulations. Topical formulations can be provided in the form of a bandage, wherein the formulation is incorporated into a gauze or other structure and brought into contact with the skin.
Administration
[0088] A chelator (including, for example, DMG) as the active agent, can be administered to a subject alone or in a composition that includes the active agent and a carrier. In some embodiments, the carrier is an aqueous liquid. In some embodiments, the carrier is a food product. In some embodiments, the carrier is pharmaceutically acceptable carrier. The active agent is administered to a subject such as a vertebrate, particularly a mammal, such as a human patient, companion animal, or domesticated animal, in an amount effective to produce the desired effect. In some embodiments, the domesticated animal is domesticated fowl. In some embodiments, the domesticated fowl is a chicken. A chelator can be administered in a variety of routes, including orally, parenterally, intraperitoneally, intravenously, intraarterially, transdermally, sublingually, intramuscularly, rectally, transbuccally, intranasally, liposomally, via inhalation, vaginally, intraoccularly, via local delivery by catheter or stent, subcutaneously, intraadiposally, intraarticularly, intrathecally, or in a slow-release dosage form.
[0089] A formulation or composition including the chelator can be administered as a single dose or in multiple doses. Useful dosages of the active agent can be determined by comparing their in vitro activity and the in vivo activity in animal models. Methods for extrapolation of effective dosages in mice, and other animals, to humans are known in the art.
[0090] Dosage levels of the active agent in the compositions of this disclosure can be varied to obtain an amount of the active agent which is effective to achieve the desired therapeutic response for a particular subject, composition, and mode of administration, without being toxic to the subject. The selected dosage level will depend upon a variety of factors including the activity of the particular compound of the present disclosure employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the chelator, the age, sex, weight, condition, general health, and prior medical history of the subject being treated, and like factors well known in the medical arts.
[0091] Dosages and dosing regimens that are suitable for other chelators may be suitable for therapeutic or prophylactic administration of the chelators of the present disclosure (including, for example, DMG). Dosages or dosing regimens in use for other chelators, including, for example, sodium diethyldithiocarbamate (DCC), disulfiram, ethylene diamine tetra acetate (EDTA), and 2,3-dimercaptopropanol (BAL), may serve as guideposts for developing suitable animal and human dosages and dosing regimens.
[0092] In an exemplary embodiment, the chelator (for example, DMG) may be administered to a subject in an amount of at least 5 mg/kg, at least 10 mg/kg, at least 20 mg/kg, at least 30 mg/kg, at least 40 mg/kg, at least 50 mg/kg, at least 60 mg/kg, at least 70 mg/kg, at least 80 mg/kg, at least 90 mg/kg, or at least 100 mg/kg. In exemplary embodiment, the chelator may be administered to a subject in an amount of up to 40 mg/kg, up to 50 mg/kg, up to 60 mg/kg, up to 70 mg/kg, up to 80 mg/kg, up to 90 mg/kg, up to 100 mg/kg, up to 500 mg/kg, or up to 1000 mg/kg. In an exemplary embodiment, DMG may be administered to a subject orally, intravenously, or intramuscularly.
[0093] A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the composition required. For example, the physician could start doses of the chelator employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
[0094] Administration of a chelator composition may occur before, during, and/or after other treatments. Such combination therapy may involve the administration of a chelator composition during and/or after the use of other antibacterial and/or antifungal agents. The administration a chelator composition may be separated in time from the administration of other antibacterial and/or antifungal agents by hours, days, or even weeks.
Pathogen Infections
[0095] In some embodiments, the chelator (including, for example, DMG) or pharmaceutical composition including the chelator may be administered to a subject suffering from or susceptible to an infection by a pathogen. Additionally or alternatively, a chelator (including, for example, DMG) may be used to treat or reduce the likelihood of an infection by a pathogen.
[0096] A pathogenic infection may include, for example, a bacterial infection, a fungal infection, or an infection caused by a non-fungal eukaryotic pathogen. Exemplary pathogens that may be nickel-dependent are provided in Maier and Benoit (Inorganics 2019; 7:80). In some embodiments, a pathogen that includes a nickel-containing enzyme includes a pathogen listed in Table 1A. In some embodiments, a pathogen that includes a nickel-containing enzyme includes a pathogen listed in Table 1B.
[0097] Exemplary bacterial infections include but are not limited to an infection with a bacterium that includes a nickel-containing enzyme. In some embodiments, a bacterium that includes a nickel-containing enzyme includes a multi-drug resistant pathogen. In some embodiments, a bacterium that includes a nickel-containing enzyme may include Acinetobacter baumannii, Enterococcus faecium, Escherichia coli, Helicobacter pylori, Haemophilus influenzae, Neisseria gonorrhoeae, Streptococcus pneumoniae, a Campylobacter species, an Enterobacter species, a Klebsiella species (including, for example, K. pneumoniae), a Morganella species, a Proteus species, a Providencia species, a Pseudomonas species (including, for example, Pseudomonas aeruginosa), a Salmonella species (including, for example, S. enterica serovar Typhi and S. enterica serovar Typhimurium), a Serratia species, a Shigella species, or a Staphylococcus species (including, for example, Staphylococcus aureus).
[0098] Exemplary fungal infections include but are not limited to fungi that include a nickel-containing enzyme. In some embodiments, a fungus that includes a nickel-containing enzyme may include Cryptococcus neoformans, Cryptococcus gattii, Coccidioides posadasii, Histoplasma capsulatum, or Paracoccidioides brasiliensis.
[0099] Exemplary infections caused by a non-fungal eukaryotic pathogen include but are not limited to eukaryotes that include a nickel-containing enzyme. In some embodiments, a eukaryote that include a nickel-containing enzyme may include Pythium insidiosum, Leishmania major, Leishmania donovani, or Trypanosoma cruzi.
[0100] Exemplary nickel-containing enzymes include a hydrogenase, a urease, a Glyoxalase I, a acireductone dioxygenase, a superoxide dismutase etc. In some embodiments, the bacteria may further include an accessory protein. An accessory protein involved in Ni-dependent hydrogenase maturation may include, for example, a Hyp protein (for example, HypA, HypB, HypC, HypD, HypE, HypF, or HypG) or a homolog thereof. An accessory protein involved urease activation may include, for example, a Ure protein (for example, UreD, UreF, UreG, or UreH).
[0101] In some embodiments, a chelator can also be administered prophylactically, to reduce the likelihood and/or extent of a pathogenic infection, for example a bacterial infection, a fungal infection, or an infection caused by a non-fungal eukaryotic pathogen. Treatment that is prophylactic, for instance, can be initiated before a subject manifests symptoms of a pathogenic infection. An example of a subject that is at particular risk of developing a pathogenic infection is an immunocompromised person. Treatment can be performed before, during, or after the diagnosis or development of symptoms of infection. Treatment initiated after the development of symptoms may result in decreasing the severity of the symptoms of one of the conditions, or completely removing the symptoms. A chelator can be introduced into the subject at any stage of pathogenic infection.
[0102] Administration of the chelator composition may be, for example, part of a small- or large-scale public health infection control program. The compound may, for example, be added to animal feed and/or drink as a prophylactic measure for reducing, controlling or eliminating a bacterial and/or fungal infection in a wild or domestic animal population. The compound may, for example, be administered as part of routine or specialized veterinary treatment of a companion or domesticated animal or animal population. It should be understood that administration of the compound may be effective to reduce or eliminate bacterial and/or fungal infection or the symptoms associated therewith; to halt or slow the progression of infection or symptoms within a subject; and/or to control, limit or prevent the spread of infection within a population, or movement of infection to another population.
[0103] Administration of a chelator can occur before, during, and/or after other treatments. Such combination therapy can involve the administration of a chelator during and/or after the use of other anti-bacterial, anti-fungal, or anti-non-fungal eukaryotic agents, or a combination thereof. The administration a chelator can be separated in time from the administration of other anti-bacterial, anti-fungal, non-fungal eukaryotic, agents by hours, days, or even weeks.
[0104] In some embodiments, the chelator is administered to a subject that has been diagnosed with, or is exhibiting symptoms of, or is at risk of developing, a pathogenic infection, for example a bacterial infection, a fungal infection, or an infection caused by a non-fungal eukaryotic pathogen. In another embodiment, the chelator is administered in a subject or subject population that serves, may serve, or is suspected of serving as an infection reservoir, regardless of the presence of symptoms. Administration can be, for example, part of a small or large scale public health infection control program. The chelator can, for example, be added to animal feed as a prophylactic measure for reducing, controlling, or eliminating pathogenic infection in a wild or domestic animal population. The compound can, for example, be administered as part of routine or specialized veterinary treatment of a companion or domesticated animal or animal population. It should be understood that administration of the chelator can be effective to reduce or eliminate pathogenic infection or the symptoms associated therewith; to halt or slow the progression of infection or symptoms within a subject; and/or to control, limit, or reduce the likelihood of infection spreading within a population, or movement of infection to another population.
Metal-Related Amyloid-β Peptide Aggregation
[0105] In some embodiments, the chelator or pharmaceutical composition including the chelator may be administered to a subject suffering from or susceptible to diseases associated with amyloid-β peptide aggregation. For example, in some embodiments, the subject may be suffering from or susceptible to Alzheimer's Disease (Aβ), adult Down Syndrome, or some types of cancers.
[0106] DMG inhibits in vitro Aβ peptide aggregation (See Example 2 for experimental details.) Briefly, to evaluate Aβ peptide aggregation in vitro, synthetic peptides or recombinant peptides may be used. Recombinant Aβ peptides are expressed in, and purified from, organisms such as E. coli. Synthetic Aβ peptide preparations have been associated with various problems such as presence of impurities in the preparation, incorporation of the D-form of amino-acids (e.g. D-His, D-Met, D-Arg) instead of the L-form of amino acids during synthesis. Additionally, Synthetic Aβ peptide preparations are associated with reproducibility issues in terms of quality and yield, to a point that even batch-to-batch variations have been reported (Dobeli et al. Biotechnology (NY) 13, 988-993 (1995); Zagorski et al. Methods Enzymol 309, 189-204 (1999); Finder et al. Journal of molecular biology 396, 9-18 (2010)). The expression and purification of recombinant Aβ peptides also has limitations and issues, including low yield, reduced solubility and presence of oxidized amino-acids (e.g. Met.sub.35-sulfoxide)(Finder et al. Journal of molecular biology 396, 9-18 (2010)). One major difference between synthetic and recombinant Aβ peptides that is often overlooked in the literature, is the absence and presence of metals associated with each preparation, respectively. Any protein or peptide showing natural affinity for one (or several) metal(s), as it is the case with Aβ peptides for copper or zinc ({tilde over (T)}ougu et al. Metallomics 3, 250-261 (2011)), will likely encounter and bind to the metals within the host (E. coli or other hosts). Hence, recombinant Aβ peptides are likely to be already associated with metals upon purification, in contrast to synthetic peptides. Given that both Cu and Zn enhance Aβ peptide aggregation, Cu and/or Zn-containing recombinant Aβ peptides may be “naturally” more prone to aggregation than their synthetic counterparts. This could account for differences reported in a study by Finder and coworkers, who found that recombinant Aβ.sub.42 peptides (likely metal-bound) aggregated faster and were more neurotoxic than synthetic Aβ.sub.42 peptides (likely metal-depleted) (Finder et al. Journal of molecular biology 396, 9-18 (2010)).
[0107] A commercial recombinant Aβ.sub.40 peptide preparation was subjected to ICP-MS metal analysis. Results unambiguously showed the presence of various metals, including Al, Cu, Mn, Zn, Se and Ni, the two latter elements being by far the most abundant (ppm range). Additional metal analysis of other components of the commercial kit revealed the presence of Al, Cu, Fe, Mn, and Ni, but no Se. Furthermore, components-associated Ni levels were negligible compared to the peptide-associated Ni levels. Metallic ions, more especially Cu(II) and Zn(II), enhance in vitro aggregation of both Aβ.sub.40 and Aβ.sub.42 peptides (Ricchelli et al. Cellular and Molecular Life Sciences CMLS 62, 1724-1733 (2005); Bush et al. Science 265, 1464-1467 (1994); Chen et al. Inorganic chemistry 48, 5801-5809 (2009); Huang et al. J Biol Chem 272, 26464-26470 (1997); Atwood et al. J Biol Chem 273, 12817-12826 (1998)). Based on these results Ni(II) is likely an Aβ peptide-aggregating metal.
[0108] A thioflavin-based (ThT) assay showed that Ni(II) enhances Aβ.sub.40 aggregation, whereas DMG-mediated Ni-chelation inhibits it Aβ.sub.40 aggregation. Moreover, Ni(II) was found to be more efficient than Cu(II), and less efficient than Zn(II), at promoting Aβ.sub.40 aggregation, under the conditions tested in our study. Since various parameters (such as pH and temperature) have been previously shown to have an effect on metal-induced aggregation (Atwood et al. J Biol Chem 273, 12817-12826 (1998); Mantyh et al. Journal of neurochemistry 61, 1171-1174 (1993)), the effect of pH on Ni-dependent aggregation was tested. Three buffers with similar salt content (192 mM NaCl) but various pHs (6.5, 7.5, or 8.5) were used. Acidic pH (6.5) conditions increased Ni-induced aggregation compared to the control pH (7.5), whereas Ni-induced aggregation was abolished at pH 8.5. The increased Ni-induced aggregation at acidic pH, is in agreement with previous published data from Atwood et al., who reported an increase of Aβ.sub.1-40 peptide aggregation in presence of 1 μM Ni at pH 6.6, compared to pH 7.4 (Atwood et al. J Biol Chem 273, 12817-12826 (1998)). Likewise, the same study correlated acidic pH (6.6) with enhanced aggregation, in presence of either Cu or Zn (both at 20 μM). In the present disclosure, Zn-induced aggregation was slightly higher at pH 7.5 compared to 6.5, and significantly faster compared to pH 8.5. The effect of pH on Cu-induced aggregation was negligible, but it is worth noting that the effect of Cu was very limited throughout the ThT-based assays. The effect of temperature on Ni-dependent Aβ.sub.1-40 peptide aggregation was not tested with the fluorescence-based method, as all assays were carried out at 37° C. However, Ni-Aβ40 peptide binding was also observed at 25° C., as shown by ITC. Although results obtained with both methods cannot be directly compared, Ni binding to Aβ40 peptides happens both at 25° C. and 37° C.
[0109] Since aggregation in presence of a particular metal (e.g., nickel) suggests initial metal-peptide binding, the likelihood of Ni binding to Aβ.sub.40 peptide was investigated by using ITC. The calorimetry-based method has been successfully used in the past to study Zn binding to Aβ.sub.40 peptide, both at low (10 μM) and high (70 μM) concentrations (Talmard et al. Biochemistry 46, 13658-13666 (2007)). Only the effect of Ni on low Aβ.sub.40 peptide concentration was examined, with a starting concentration of Aβ.sub.40 peptide in the sample cell at 20 μM. After Ni was injected via 20 consecutive injections, every 5 min (5 μM increments), a heat profile characteristic of independent metal-binding was observed. Although the apparent K.sub.d (4.2 μM) is similar to that reported for Zn (Talmard et al. Biochemistry 46, 13658-13666 (2007)), the apparent stoichiometry (0.7 mole of Ni per mole of Aβ.sub.40) is significantly lower than that previously reported by Drochioiu and colleagues. Drochioiu found that synthetic Aβ.sub.40 peptide displays high affinity toward nickel ions with up to three Ni.sup.2+ ions bound per Aβ.sub.40 peptide (Drochioiu et al. Biophys Chem 144, 9-20 (2009)). However, the discrepancy between the results may be due to the nature of Aβ.sub.40 peptide used, and the type of analytical method used to analyze Ni-Aβ.sub.40 peptide. In the present disclosure, purified recombinant Aβ.sub.40 peptide and ITC were used. In contrast, Drochioiu et al. used synthetic Aβ.sub.40 peptide, electrospray ion trap mass spectrometry (ESI-MS), and circular dichroism (CD). Aβ.sub.40 peptide can bind nickel with high affinity. Furthermore, results confirm that DMG inhibits Aβ.sub.40 peptide aggregation through Ni chelation (not direct contact with the peptide), since titration of the peptide with DMG did not induce any peptide conformational change, as observed with ITC.
[0110] Given the presence of Cu.sup.2+, Ni.sup.2+, Zn.sup.2+ in recombinant Aβ.sub.40 peptide, combined to their respective effect on Aβ.sub.40 peptide aggregation, metal chelation therapy towards AD constitutes a valid approach. However, the risk of chelation therapy is that removal of essential metal ions will lead to serious adverse effects (for instance, iron-deficiency anemia) as pointed out by other researchers (Bush et al. Neurotherapeutics 5, 421-432 (2008)). Hence it is preferable to use chelators with select affinity towards non-essential metals: the Ni-specific chelator DMG is therefore a good candidate. Mammalian hosts do not contain known Ni-dependent enzymes, which makes Ni-chelation therapy an attractive approach (Maier et al. Inorganics 7, 80 (2019)). On the other hand, most bacteria, including pathogenic ones, require nickel as cofactor for one or several enzymes, such as [Ni—Fe] hydrogenase(s) (Benoit et al. Microbiology and Molecular Biology Reviews 84, (2020)) or urease (Maier et al. Inorganics 7, 80 (2019)). Thus, DMG-mediated inhibition of these enzymes, as demonstrated with Salmonella Typhimurium hydrogenases or Klebsiella pneumoniae urease, leads to bacterial growth inhibition, both in the mouse and in the wax moth animal models as described in Example 1. In the present study, we showed that DMG can drastically reduce, and even abolish Aβ.sub.40 peptide aggregation. The inhibitory effect was observed in absence of supplemental metal, as well as in presence of copper, nickel or even zinc (albeit with lower efficacy).
[0111] Reinhardt and colleagues reported beneficial effects of the nickel chelator disulfiram on AD hallmarks, including inhibitory effects on Aβ.sub.42 peptide aggregation (Reinhardt et al. Scientific reports 8, 1-13 (2018)). However, this study was not aimed at establishing any link between Ni and AD. The authors found that disulfiram increased synthesis of the metalloproteinase α-secretase, resulting in secretion of the neuroprotective APP cleavage product sAPPα and thus preventing formation of the amyloidogenic βA peptides (Reinhardt et al. Scientific reports 8, 1-13 (2018)). The concentration of disulfiram shown to have inhibitory effects on peptide aggregation was significantly lower compared to DMG concentrations used in our study, however the disulfiram drug is highly toxic, even at low doses, with concentrations higher than 5 μM inducing cytotoxicity (Reinhardt et al. Scientific reports 8, 1-13 (2018)). This finding correlates with previous studies linking disulfiram with negative outcomes, such as elevated nickel levels in rat brains (Baselt et al. Res Commun Chem Pathol Pharmacol 38, 113-124 (1982)), elevated nickel levels in body fluids of patients with chronic alcoholism (Baselt et al. Res Commun Chem Pathol Pharmacol 38, 113-124 (1982); Hopfer et al. Res Commun Chem Pathol Pharmacol 55, 101-109 (1987)), as well as hepatotoxicity in humans (Kaaber et al. Contact Dermatitis 5, 221-228 (1979); Kaaber et al. Derm Beruf Umwelt 35, 209-211 (1987)).
[0112] DMG may inhibit Ni-requiring microorganisms. There may be a link between pathogens and AD, known as the “infection hypothesis of AD” (Itzhaki et al. J Alzheimers Dis 51, 979-984 (2016); Fulop et al. Front Aging Neurosci 10, 224 (2018); Honjo et al. Alzheimer's & Dementia 5, 348-360 (2009)). The list of pathogens potentially linked to AD includes viral, fungal and bacterial species. Among bacteria directly or indirectly associated with AD, one can find Helicobacter pylori (Malaguarnera et al. European Journal of Internal Medicine 15, 381-386 (2004); Kountouras et al. Cognitive and behavioral neurology 23, 199-204 (2010)), E. coli (Zhan et al. Neurology 87, 2324-2332 (2016)) and Salmonella Typhimurium (Kumar et al. Sci Transl Med 8, 340ra372 (2016)), all of which require Ni as cofactor for one or several enzymes (Maier et al. Inorganics 7, 80 (2019)). In the case of H. pylori, another protein is relevant to the pathogen/AD link. The gastric pathogen produces abundant amounts (2% of total protein) of a small histidine-rich protein (Hpn) that has been shown to develop amyloid-like fibrils in vitro (Ge et al. Biochimica et Biophysica Acta (BBA)—Molecular Cell Research 1813, 1422-1427 (2011)). The continuous production of Hpn by the bacterium during decades of chronic gastric infection could result in leakage of the protein, first into the bloodstream and eventually into the brain, potentially triggering AD, as hypothesized by Ge and Sun (Ge et al. Medical hypotheses 77, 788-790 (2011)). More generally, an antimicrobial role for Aβ peptides (as part of the brain's ancient immune system) has been proposed, as part of a “new amyloidogenesis model” (Moir et al. Alzheimer's & Dementia 14, 1602-1614 (2018)). The model is based on findings by Kumar and colleagues, who reported (Kumar et al. Sci Transl Med 8, 340ra372 (2016)) that bacterial infection of the brains of transgenic mice result in accelerated Aβ plaque deposition, closely colocalizing with the invading bacteria (in this case, Salmonella) (Kumar et al. Sci Transl Med 8, 340ra372 (2016)).
[0113] Without wishing to be bound by theory, Ni may affect the onset and the progression of AD through two different mechanisms, as depicted in our proposed model (
[0114] In some embodiments, a chelator can be administered prophylactically, to reduce the likelihood and/or extent of amyloid-β peptide aggregation. Treatment that is prophylactic, for instance, can be initiated before a subject manifests symptoms of amyloid-β peptide aggregation and/or dementia. An example of a subject that is at particular risk of developing an amyloid-β peptide aggregation is a person with a family history of Alzheimer's Disease or the presence of a genetic mutation associated with Alzheimer's Disease. Treatment can be performed before, during, or after the diagnosis or development of symptoms of dementia. Treatment initiated after the development of symptoms may result in decreasing the severity of the symptoms of one of the conditions, or completely removing the symptoms. A chelator can be introduced into the subject at any stage of dementia.
[0115] Administration of a chelator can occur before, during, and/or after other treatments. Such combination therapy can involve the administration of a chelator during and/or after the use of other anti-dementia drugs, anti-Alzheimer's drugs, and/or drugs that reduce the likelihood and/or extent of amyloid-β peptide aggregation. The administration a chelator can be separated in time from the administration of other agents by hours, days, or even weeks.
[0116] In some embodiments, the chelator is administered to a subject that has been diagnosed with, or is exhibiting symptoms of, or is at risk of developing amyloid-β peptide aggregation. It should be understood that administration of the chelator can be effective to reduce or eliminate amyloid-β peptide aggregation or the symptoms associated therewith and/or to halt or slow the progression of amyloid-β peptide aggregation or symptoms within a subject.
Alteration of a Subject's Microbiome and/or Obesity
[0117] In some embodiments, the chelator or pharmaceutical composition including the chelator may be administered to a subject suffering from or susceptible to a nickel allergy. In some embodiments, the subject may be obese. In some embodiments, the chelator or pharmaceutical composition including the chelator may be administered to a subject to alter the balance of bacteria in the subject's microbiome.
[0118] Recent studies have isolated nickel-resistance bacteria from the human microbiome (Lusi et al. 2017 New Microbe and New Infect 19: 67-70) and have shown that obese individuals with a nickel allergy have altered metabolisms compared to non-allergic, weight-matched individuals (Watanabe et al. 2018 PLoS ONE 13(8): e0202683). These finding suggest that chelation of nickel in nickel-allergic individuals and/or individuals with nickel-resistance bacteria in their microbiome may provide a therapeutic benefit for those individuals including, for example, by altering the balance of bacteria in their microbiome and/or the individual's metabolism. The human intestinal microbiota (the intestinal microbiome) impacts many areas of human health, while some of the commensal bacteria in the gut use nickel as a component of enzymes. Therefore, alteration of nickel levels via nickel chelation is expected to alter intestinal microbiome content, potentially providing health benefits.
[0119] Administration of a chelator can occur before, during, and/or after other treatments. Such combination therapy can involve the administration of a chelator during and/or after the use of other treatments for nickel allergy. In an exemplary embodiment, DMG may be administered with another chelator including, for example, EDTA. The administration of a chelator can be separated in time from the administration of another agent by hours, days, or even weeks.
Inhibition or Disruption of Biofilms
[0120] In some embodiments, the chelator or a composition including the chelator may be used to reduce the likelihood and/or extend of biofilm formation. Treatment of a surface initiated after the development of a biofilm may result in the death of some of the bacterial cells within the biofilm or all of the bacterial cells within the biofilm. Treatment of a surface initiated before the development of a biofilm may result in a reduction of the likelihood of biofilm formation or slowing the growth of a biofilm.
[0121] In some embodiments, the biofilm may include a Campylobacter species (including, for example, C. jejuni and/or C. concisus), Helicobacter pylori, a Klebsiella species, (including, for example, Klebsiella pneumoniae), a Proteus species, a Pseudomonas species (including, for example, Pseudomonas aeruginosa), a Salmonella species (including, for example, S. Typhimurium), or a Staphylococcus species (including, for example, Staphylococcus aureus), or a combination thereof. In some embodiments, the biofilm may include catheter-associated bacteria and/or medical tubing-associated bacteria.
[0122] In some embodiments, the biofilm may be present on a medical device including, for example, a catheter, medical tubing, and/or an indwelling device. Additional specific examples of medical devices on which a biofilm may be present include but are not limited to a nasogastric tube, a urinary catheter, a central venous catheter, an umbilical line, an endotracheal tube, a contact lens, a heart valve, a prosthetic device, etc. In some embodiments, a medical device and/or a surface of a medical device may be pre-treated to reduce the likelihood of biofilm formation or to slow the growth of a biofilm.
[0123] In some embodiments, treatment of a surface includes application and/or deposition of the chelator to the surface; ionic binding of the chelator to the surface; or incorporation of the chelator to a polymeric matrix bound to the surface.
[0124] Bacterial biofilms often prevent or reduce clearance by antibiotics and enable persistent infections in patients. Yonezawa et al. 2013 PLoS One 8:e73301; Davies D. 2003 Nature Reviews Drug discovery 2:114; Vuotto et al. 2017 Journal of Applied Microbiology 123:1003-1018; Stewart 2015 Microbiology Spectrum 3(3). Data described in Example 3 indicates that DMG has biofilm-inhibitory properties against multidrug resistant Salmonella and Klebsiella strains, as well as against the gastric pathogen Helicobacter pylori.
[0125] In some embodiments, a composition including the chelator may include an additional active agent, such an antibacterial compound. In some embodiments the surface being treated with the chelator or a composition including the chelator may preferably include an additional active agent preferably includes an antibacterial compound.
[0126] In some embodiments, the additional active agent preferably includes an antibacterial compound. In some embodiments, the antibacterial compound includes copper. In some embodiments, the additional active agent may include a metallic ion or an antibacterial compound that produces a metallic ion.
[0127] In some embodiments, when the antibacterial compound includes copper, the copper may include copper(I) or copper(II). In some embodiments, including, for example when the chelator or a composition including the chelator is being used to reduce the likelihood and/or extent of biofilm formation including Campylobacter jejuni or to disrupt a biofilm including C. jejuni, the metallic ion may preferably be Cu.sup.2+. As described in Example 4, while millimolar levels of DMG are bacteriostatic against C. jejuni, the addition of micromolar levels of copper (II) renders millimolar levels of DMG bactericidal towards C. jejuni.
Exemplary Aspects
[0128] The invention is defined in the claims. However, below there is provided a non-exhaustive listing of non-limiting exemplary aspects. Any one or more of the features of these aspects may be combined with any one or more features of another example, embodiment, or aspect described herein.
Aspect 1. Aspect 1 is composition comprising: a chelator wherein the chelator comprises soluble DMG; and a carrier.
Aspect 2. Aspect 2 is the composition of Aspect 1, wherein the carrier is a pharmaceutically acceptable carrier.
Aspect 3. Aspect 3 is the composition of Aspect 1-2, wherein the carrier comprises an aqueous liquid elixir.
Aspect 4. Aspect 4 is the composition of Aspects 1-3, wherein the aqueous liquid elixir comprises a sugar.
Aspect 5. Aspect 5 is the composition of Aspects 1-4, wherein the carrier comprises a food product.
Aspect 6. Aspect 6 is the composition of Aspects 1-5, further comprising an additional active agent.
Aspect 7. Aspect 6 is the composition of Aspects 1-6, wherein the additional active agent comprises a metallic ion or a compound that produces a metallic ion.
Aspect 8. Aspect 8 is the composition of Aspects 1-7, wherein the additional active agent comprises a divalent cation.
Aspect 9. Aspect 9 is a method for administering the composition of Aspects 1-8 to a subject.
Aspect 10. Aspect 10 is the method of Aspect 9, wherein the subject comprises a human or an animal.
Aspect 11. Aspect 11 is the method of Aspects 9-10, wherein the animal comprises a chicken.
Aspect 12. Aspect 12 is the method of Aspects 9-11, wherein the composition further comprises copper.
Aspect 13. Aspect 13 is the method of Aspects 9-12, wherein the subject is infected with a pathogen or susceptible to infection by a pathogen.
Aspect 14. Aspect 14 is the method of Aspects 9-13, wherein the pathogen comprises a nickel-containing enzyme, a fungus that comprises a nickel-containing enzyme, or a non-fungal eukaryotic pathogen that comprises a nickel-containing enzyme Aspect 15. Aspect 15 is the method of Aspects 9-14, wherein the pathogen comprises a multi-drug resistant pathogen.
Aspect 16. Aspect 16 is the method of Aspects 9-15, wherein the pathogen comprises
[0129] Acinetobacter baumannii, Enterococcus faecium, Escherichia coli, Helicobacter pylori, Haemophilus influenzae, Neisseria gonorrhoeae, Streptococcus pneumoniae, a Campylobacter species, an Enterobacter species, a Klebsiella species, a Morganella species, a Proteus species, a Providencia species, a Pseudomonas species, a Salmonella species, a Serratia species, a Shigella species, or a Staphylococcus species, or a combination thereof;
[0130] Cryptococcus neoformans, Cryptococcus gattii, Coccidioides posadasii, Histoplasma capsulatum, or Paracoccidioides brasiliensis, or a combination thereof; or
[0131] Pythium insidiosum, Leishmania major, Leishmania donovani, or Trypanosoma cruzi, or a combination thereof.
Aspect 17. Aspect 17 is the method of Aspects 9-16, wherein the subject is suffering from or susceptible to a disease associated with amyloid-β peptide aggregation.
Aspect 18. Aspect 18 is the method of Aspects 9-17, wherein the disease is Alzheimer's, Down Syndrome, or both.
Aspect 19. Aspect 19 is the method of Aspects 9-18, wherein the method comprises treating or preventing β-Amyloid peptide aggregation in a subject, the method comprising administering dimethylglyoxime (DMG) to the subject.
Aspect 20. Aspect 20 is the method of Aspects 9-19, wherein the DMG comprises soluble DMG.
Aspect 21. Aspect 21 is the method of Aspects 9-20, wherein the soluble DMG comprises disodium salt DMG, or disodium salt octahydrate DMG, or both.
Aspect 22. The method of Aspects 9-21, wherein the subject is suffering from or susceptible to Alzheimer's Disease or Down Syndrome or both.
Aspect 23. The method of Aspects 9-22, wherein DMG is administered in combination with another anti-dementia therapy.
Aspect 24. The method of Aspects 9-23, wherein DMG is administered orally or intravenously.
Aspect 25. The method of Aspects 9-24, wherein the method comprises administering DMG orally, and wherein the DMG is presented as a capsule.
Aspect 26. The method of Aspects 9-25, wherein the DMG comprises soluble DMG.
Aspect 27. Aspect 27 is the method of Aspects 9-26, wherein the method comprises disrupting a biofilm or preventing biofilm formation, the method comprising treating a surface with dimethylglyoxime (DMG).
Aspect 28. Aspect 28 is the method of Aspects 9-27, wherein the biofilm comprises a Campylobacter species, Helicobacter pylori, a Klebsiella species, a Proteus species, a Pseudomonas species, a Salmonella species, or a Staphylococcus species, or a combination thereof.
[0132] The present disclosure is illustrated by the following examples. It is to be understood that the particular examples, materials, amounts, and procedures are to be interpreted broadly in accordance with the scope and spirit of the invention as set forth herein.
EXAMPLES
Example 1—Nickel Chelation Therapy as an Approach to Combat Multi-Drug Resistant Enteric Pathogens
Results and Discussion
The Nickel-Specific Chelator DMG Inhibits Growth of Various Enterobacteriaceae.
[0133] The inhibitory effect of DMG on bacterial growth was tested on three strains: MDR K. pneumoniae (ATCC BAA2472), MDR S. Typhimurium (ATCC 700408), and S. Typhimurium (ATCC 14028), the last of which is a mouse colonizing strain (Gunn et al. 2000 Infect. Immun. 68:6139-6146). Cells were inoculated at a starting OD.sub.600 of 0.005 (approximately 5×10.sup.6 CFU/mL) and grown for 24 hours at 37° C. under aerobic conditions with vigorous shaking in presence of defined concentrations of DMG, as indicated, and the growth yield (CFU/mL) was determined after serial dilutions and plating (
Sublethal DMG Levels Abolish S. Typhimurium Hydrogenase Activity.
[0134] To study the effect of Ni-chelation on hydrogenase activity in S. Typhimurium, cells from strain 14028 were grown for six hours on blood-based media containing increasing concentrations of DMG, under H.sub.2-enriched microaerobic atmosphere; these conditions (blood medium and H.sub.2) have been previously shown to be favorable for the expression of all three S. Typhimurium respiratory hydrogenases (Maier et al. 2004 Infect Immun 72:6294-6299). Hydrogenase assays were carried out on whole cells using an amperometric method, as previously described (Maier et al. 2004 Infect Immun 72:6294-6299; Lamichhane-Khadka et al. 2015 Infect Immun 83:311-316). While addition of 0.1 mM DMG to the medium had no effect on the (combined) H.sub.2-uptake hydrogenase activity, supplementation of the growth medium with either 0.5 mM, 1 mM, or 5 mM DMG significantly decreased hydrogenase activity, and addition of 10 mM DMG abolished hydrogenase activity (Table 2). The addition of 50 μM NiCl.sub.2 to a medium containing 1 mM DMG restored some hydrogenase activity (50% increase compared to the 1 mM DMG medium). Taken together, these results indicate that DMG inhibits hydrogenase activity in S. Typhimurium, probably through Ni-chelation. H.sub.2-uptake hydrogenase activity is required for colonization in a murine model. Hence, the inhibitory effect of DMG on hydrogenase activity observed herein suggests the Ni-chelator could inhibit S. Typhimurium growth in animals.
Sublethal DMG Levels Inhibit MDR Klebsiella pneumoniae Urease.
[0135] To study the effect of Ni-chelation on urease activity in MDR K. pneumoniae BAA-2472, cells were grown overnight in LB broth supplemented with sublethal concentrations of DMG, cells were harvested, broken, and urease assays were performed on cell-free extracts (Table 3). Supplementation of the growth medium with 1 mM or 2 mM DMG significantly decreased urease activity in MDR K. pneumoniae, while addition of 5 mM completely inhibited the urease activity in the pathogenic strain. Thus, similar to hydrogenase inhibition, it appears DMG-mediated Ni chelation can be used to efficiently block urease activity in Klebsiella. This confirms previous results from Nakashige and coworkers, who showed that calprotectin-driven chelation of nickel led to urease inhibition in K. pneumoniae (Nakashige et al. 2017 J. Am. Chem. Soc. 139:8828-8836). Urease is used in nitrogen metabolism by K. pneumoniae; when tested in a competition experiment with the wild-type strain, an isogenic urease mutant failed to colonize mouse intestines (Maroncle et al. 2006 Res Microbiol 157:184-193). Thus, the inhibition of K. pneumoniae urease by DMG, as shown in the present study, is anticipated to have a major (inhibitory) impact on the in vivo colonization of the pathogen.
TABLE-US-00003 TABLE 2 Effect of DMG chelation on hydrogenase activity in S. Typhimurium 14028. DMG (mM) .sup.a NiCl.sub.2 (mM) Hydrogenase activity .sup.b 0 14.7 ± 2.8 0.1 14.0 ± 2.7 0.5 4.6 ± 1.2 1 3.9 ± 0.9 1 0.05 6.9 ± 1.7 5 0.8 ± 0.1 10 ND .sup.a DMG was added to a blood-based medium, and cells were grown for six hours under H.sub.2-enriched microaerobic conditions before being harvested. .sup.b nmoles H.sub.2 oxidized per minute per 10.sup.9 cells Values shown are the mean ± standard deviation for 6 independent replicates. Results beginning with 0.5 mM of DMG are significantly less than without DMG (P < 0.01%, Student's t-test).
TABLE-US-00004 TABLE 3 Effect of DMG chelation on urease activity in K. pneumoniae BAA-2472 DMG (mM).sup.a Urease activity.sup.b 0 0.17 ± 0.03 1 0.05 ± 0.01 2 0.03 ± 0.01 5 ND.sup.c .sup.aDMG was added to LB broth, cells were grown overnight, and urease assays were performed on cell-free extracts using the phenol-hypochlorite method of Weatherburn et al. 1967 Analytical Chemistry 39:971-974. .sup.bUrease activity is expressed in μmoles of NH.sub.3 produced per minute per mg of total protein. .sup.cND, not detected (<0.001) Values shown are the mean ± standard deviation for at least three independent biological replicates, with assays done in triplicate. Urease activities measured for all DMG-supplemented conditions are significantly lower compared to the no-DMG control (p < 0.01%, Student’s t-test).
High Levels of DMG are not Toxic for Mice or Wax Moth Larvae.
[0136] While in vitro DMG-mediated inhibition of Salmonella and K. pneumoniae strains appear promising, the relatively high (millimolar) concentrations of DMG required to inhibit these pathogens' growth could impede DMG's in vivo use, due to toxicity concerns. A series of experiments were conducted to evaluate the toxicity of DMG on two animal models, Mus musculus (mice) and Galleria mellonella (greater wax moth). Mice (BALB/c) have been used (typhoid fever-mouse model) to study S. Typhimurium virulence (Maier et al. 2014 PLoS One 9:e11018710; Lamichhane-Khadka et al. 2015 Infect Immun. 83:311-316; Gunn et al. 2000 Infect Immun. 68:6139-6146), and wax moth larvae have been proven to be a reliable model for studying virulence of many pathogens, including K. pneumoniae (Shi et al. 2018 BMC Microbiol. 18:94; Esposito et al. 2018. Front. Microbiol. 9:1463; Insua et al. 2013 Infect. Immun. 81:3552-3565) and S. Typhimurium (Scalfaro et al. 2017 FEMS Microbiol. Lett. 364; 43; Kurstak et al. 1968 Can. J. Microbiol. 14:233-237; Bender et al. 2013 PLoS One 8:e73287; Viegas et al. 2013 Appl. Environ. Microbiol. 79:6124-6133). Mice were subjected to the following DMG treatment: two daily doses of 0.2 mL DMG at 50 mM (˜6.1 mg DMG per day), for four consecutive days. These animals displayed no clear toxicity symptoms (for example, no apparent change in health or behavior compared to the no DMG group control). In another experiment, mice received a daily dose of 0.1 mL 40 mM DMG (˜1.2 mg per day) for 4 days, 0.2 mL of 40 mM DMG (˜2.4 mg per day) for four days, and then two days of 0.2 mL of 100 mM DMG (˜6.1 mg per day). Again, these mice displayed no toxicity symptoms over this course of chelator administration, or for the next three days after cessation of chelator administration (mice were then euthanized). Thus, orally delivered DMG does not appear to be toxic to mice (under the conditions described herein). By comparison, EDTA and its derivatives have been shown to be quite toxic to animals (for a review, see Lanigan et al. 2002 Int J Toxicol 21 Suppl 2:95-142). For example, the acute oral LD.sub.50 of Disodium EDTA was found to be 400 mg/kg (Brendel et al. 1953 J Am Pharm Assoc Am Pharm Assoc 42:123-124); this corresponds to approximately 8 mg of Na.sub.2-EDTA for mice with an average weight of 20 g. The Ni-chelator disulfiram is even more toxic, with an oral LD.sub.50 of disulfiram for mice reported to be as low as 1.013 mg/kg: this corresponds to approximately 20 μg per mouse. Thus, although no formal toxicity study (for example, LD.sub.50) was conducted with DMG, these results suggest oral DMG is less toxic in mice than Na.sub.2-EDTA, and far less toxic that disulfiram. The toxicity of DMG was also assessed in wax moth larvae. Injection of 5 μL of increasing concentrations of DMG (ranging from 25 mM to 400 mM) into the rear proleg of G. mellonella was not detrimental to the larvae, since 70% to 100% of larvae in each group (n=10 for each group) were still alive 72 hours after injection.
Orally-Administered DMG can be Detected in Mouse Livers.
[0137] Since water soluble DMG had never been used in animals prior to this study, the intestinal absorption and catabolism of orally delivered DMG in mice was unknown. Therefore, Nuclear Magnetic Resonance (NMR) was used to detect the presence of DMG in liver samples of mice that had been given a daily oral dose (6.1 mg) of aqueous DMG for 2 to 3 days. Although NMR signals from DMG could not be detected in the aqueous supernatant from liver homogenate, diagnostic signals assigned to the methyl carbon (12.0 ppm) and protons (2.04 ppm), and to the oxime carbon (157.8 ppm) were observed in the chloroform extracts of the same supernatant (
Oral Delivery of DMG Attenuates Salmonella Virulence in Mice.
[0138] The in vivo efficacy of DMG against S. Typhimurium was assessed in mice, using the mouse-adapted S. Typhimurium strain 14028, as previously described (Gunn et al. 2000 Infect Immun 68:6139-6146). In this typhoid fever-mouse model, the outcome of oral infection with S. Typhimurium is reproducible, typically resulting in a 100% mortality rate within a week (Maier et al. 2004. Infect Immun 72:6294-6299; Maier et al. 2014. PLoS One 9:e11018; Lamichhane-Khadka et al. 2015. Infect Immun 83:311-316). This mortality was confirmed herein: oral infection of mice with 10.sup.6 bacterial cells (and no DMG) led to 100% mortality within six days, in three independent experiments (see
[0139] An additional experiment was performed to evaluate the effect of DMG on bacterial loads in key organs (liver and spleen) which are typically colonized in the typhoid fever-mouse model. Two groups (n=8 each) of mice were inoculated with S. Typhimurium 14028; one group was orally given DMG (3 mg) three times (24 hours and 30 minutes before infection, and 24 hours post infection) while the other group did not receive any DMG. The bacterial burden in livers and spleens was determined three days after infection (
Injection of DMG Reduces Virulence of MDR Enterobacteriaceae in the Galleria mellonella Insect Model.
[0140] Attempts to establish a reliable K. pneumoniae infection model in mice failed, so an alternate animal model was chosen. As discussed above, the wax moth (G. mellonella) larva model has been already used to study virulence of both K. pneumoniae and S. Typhimurium, and high levels of DMG (5 μL of a 400 mM aqueous solution; approximately 0.61 mg) appear to be innocuous, as determined in this study. Injection of larvae with approximately 10.sup.6 CFUs of either K. pneumoniae and S. Typhimurium resulted in 100% mortality within 16 hours (
[0141] In conclusion, the in vitro and in vivo results presented herein suggest that the growth of Enterobacteriaceae, including that of multi-drug resistant species of K. pneumoniae and S. Typhimurium, can be inhibited by the Ni-chelator DMG. The observed phenotype could be attributable to inhibition of important Ni-enzymes such as hydrogenase and/or urease. Other effects of DMG on cellular metabolism should not be ruled out, however. While full growth inhibition of the pathogens required moderate to elevated levels of DMG, it is worth noting such levels of Ni-chelator appear to be innocuous when tested on two well defined animal models, including, for example, mice and wax moth larvae. These results suggest DMG-mediated chelation should be considered an alternate therapy method, especially when dealing with the ever-growing threat of MDR bacterial species.
Experimental Procedures
[0142] Bacterial strains. The MDR strain of K. pneumoniae subsp. pneumoniae used in this study was ATCC BAA-2472, a New Delhi metallo-beta-lactamase (NDM-1) positive strain, resistant to aminoglycosides, macrolides, fluoroquinolones, and most β-lactams, including ertapenem. S. Typhimurium ATCC 14028 was used for mouse colonization experiments. S. Typhimurium ATCC 700408 is a MDR strain, resistant to ampicillin, chloramphenicol, streptomycin, sulfonamides, tetracycline, among others.
[0143] Chemicals. Different batches of DMG were used in this study (all from Sigma-Aldrich, St Louis, Mo.). For Salmonella hydrogenase inhibition experiments, DMG D1885 (anhydrous) was used. For growth inhibition experiments, DMG D160105 (disodium salt) was used. For all other experiments, including animal studies, DMG 40400 (disodium salt, octahydrate) was used. (See Table 4.)
[0144] Growth conditions. All strains were routinely grown on LB agar plates or in LB broth. For DMG-growth inhibition study, S. Typhimurium strains ATCC 14028 and ATCC 700408 were grown in M9 minimal medium (M9 minimal salts, 0.4% glucose, 2 mM MgSO.sub.4, 0.1 mM CaCl.sub.2), and 1 μg/mL thiamine, pH 7.2). K. pneumoniae was grown in “W-U” medium, modified from Bender et al. 1977 129:1001-1009, containing 60 mM K.sub.2HPO.sub.4, 33 mM KH.sub.2PO.sub.4, 0.4 mM MgSO.sub.4, 0.4% Glucose, and 5 mM urea (instead of KNO.sub.3), pH 7.4. Briefly, overnight cultures of S. Typhimurium and K. pneumoniae were harvested, spun at 14,000 rpm for five minutes, washed once with either M9 (S. Typhimurium) or W-U (K. pneumoniae) and resuspended in either M9 (S. Typhimurium) or W-U (K. pneumoniae). Cells were inoculated to an OD.sub.600 of 0.005 in M9 or W-U media, in presence of increasing concentrations of DMG (2.5 mM, 5 mM, 7.5 mM, or 10 mM). Cells were incubated for 24 hours at 37° C. with shaking at 250 rpm, then serially diluted in PBS and 5 μL of each dilution was spotted in triplicate on LB plate. Colony forming units (CFU) were counted after 16 hours at 37° C. Each growth experiment was done at least three times.
[0145] Amperometric hydrogenase assays. The hydrogenase activity of S. Typhimurium ATCC strain 14028 was assayed by using an amperometric method, as previously described (Lamichhane-Khadka et al. 2015 Infect Immun 83:311-316). Briefly, cells were grown on blood agar media for six hours under a H.sub.2-enriched microaerobic atmosphere (Maier et al. 2004 Infect Immun 72:6294-6299), supplemented with only DMG (0.1 mM, 0.5 mM, 1 mM, 5 mM, or 10 mM) or 1 mM DMG and 50 μM NiCl.sub.2. Cells were suspended in phosphate-buffered saline (PBS) to a final concentration of 8×10.sup.8, per mL and added to a sealed amperometric dual-electrode chamber, with constant stirring; 100 μL of H.sub.2-saturated phosphate-buffered saline was added to the chamber and the disappearance of H.sub.2 was recorded over time. Hydrogenase activity is expressed in nmoles of H.sub.2 oxidized per minute per 10.sup.8 cells.
[0146] Urease assays. K. pneumoniae cells were grown overnight at 37° C. in LB (control) or LB supplemented with 1, 2, or 5 mM DMG at 37° C. with shaking at 200 rpm. Cells were pelleted at 6,000 rpm for 30 minutes and washed three times with PBS (pH 7.4). Cells were standardized to an optical density (OD.sub.600) of 4.5, added to sterile glass beads (0.1 mm diameter, Biospec Products, Bartlesville, Okla.) at a 100% w/v ratio, and frozen at −80° C. The bead and cell mixture was thawed at room temperature and vortexed at 3,200 rpm for six minutes with one minute intervals on ice. The mixture was pelleted at 14,000 rpm for two minutes and the cell-free supernatant was assayed for urease activity using the phenol-hypochlorite method (Weatherburn et al. 1967. Analytical Chemistry 39:971-974). Protein concentration was determined using the BCA protein kit (Thermo Fisher Pierce, Rockford, Ill., USA). Urease activity is expressed as μmoles of NH.sub.3 produced per minute per mg of total protein.
[0147] Mouse experiments—Chelator toxicity. A group of eight mice were subjected to the following DMG treatment: two daily doses of 0.2 mL DMG at 50 mM (46.1 mg DMG per day) for four consecutive days. These animals displayed no obvious toxicity symptoms. In another experiment, mice received a daily dose of 0.1 mL 40 mM DMG (˜1.2 mg per day) for 4 days, 0.2 mL of 40 mM DMG (˜2.4 mg per day) for four days, and then 0.2 mL of 100 mM DMG (˜6.1 mg per day) for two days. Again, these mice displayed no toxicity symptoms over this course of chelator administration, or for the next three days after cessation of chelator administration (mice were then euthanized).
[0148] Mouse experiments—Detection of DMG in liver samples. A group of eight mice was used for this experiment: two mice were given 0.2 mL of 100 mM DMG (˜6.1 mg per day) for two days and then euthanized, and two mice were given the same dose for three days and then euthanized; the remaining four mice were used as no DMG-control. Mice were sacrificed by CO.sub.2 asphyxiation and cervical dislocation. Livers were quickly removed and homogenized in 2 mL sterile deionized water using a tissue homogenizer (“Tissue Tearor” model 985370, Biospec products, Bartlesville, Okla., USA). Homogenized liver samples were spun at 16,800×g for six min, and supernatants were collected before being passaged through a 0.45 μm filter unit. Filtered supernatants were subjected to NMR analysis. Since preliminary NMR experiments failed to detect DMG in individual liver samples from DMG-treated mice, these four samples were pooled, concentrated, and also extracted with chloroform for additional NMR analysis. Liver samples from no-DMG treated mice were similarly processed and used as negative controls.
[0149] Mouse experiments—Infection Experiments. The in vivo efficacy of DMG against S. Typhimurium was assessed by using the typhoid fever-mouse model, as previously described (Gunn et al. 2000 Infect Immun 68:6139-6146). Female BALB/c mice (Charles River, Boston, Mass.) were orally inoculated individually with the S. Typhimurium strain ATCC 14028, following previously described methods (Maier et al. 2004 Infect Immun 72:6294-6299; Maier et al. 2014 PLoS One 9:e110187; Lamichhane-Khadka R et al. 2015 Infect Immun 83:311-316). Briefly, S. Typhimurium cells grown overnight in LB were harvested, washed, and suspended in sterile PBS to a final OD of OD.sub.600 0.01 (approximately 10.sup.7 CFU/mL) and 0.1-mL volumes (10.sup.6 bacterial cells) were introduced orally into each mouse. A dose of 3 mg of DMG, corresponding to either 0.1 mL of a 100 mM or 0.2 mL of a 50 mM DMG aqueous solution, respectively, was orally given to mice belonging to one group, while the other group of mice (control) was only given sterile H.sub.2O. The DMG treatment was performed six hours post-infection, then (once) every 24 hours post-infection, for three to nine days, as described for each experiment (three independent experiments, with n=4 to n=8 mice for each experiment). The mice were observed twice daily, and morbidity was recorded. In addition, a fourth independent experiment was performed to determine organ (liver and spleen) bacterial burdens. In this experiment, two groups of eight mice each were inoculated with S. Typhimurium 14028. One group was treated for three days with one daily dose of DMG (3 mg), at 24 hours and 0.5 hours before infection, and 24 hours post infection. Infection with S.T. 14028 was done as described above. Mice were euthanized 72 hours after infection. Livers and spleens were removed and homogenized in sterile PBS. Dilutions of the homogenate were plated on bismuth sulfite agar plates (BD DIFCO, Becton Dickinson, Franklin Lakes, N.J.), a selective medium for Salmonella species. Colony forming units (CFU) were counted after overnight incubation of the plates at 37° C.
[0150] Galleria mellonella (wax moth) experiments. Wax moth larvae were obtained from local pet stores, from two different suppliers: the bug company (Ham Lake, Minn.; www.ebugco.com) and Timberline (Marion, Ill.; www.timberlinefresh.com). Larvae were stored in wood shavings at 4° C. in the dark and used within two weeks after purchase. Only larvae weighing 300±50 mg were selected for the experiments. Groups of ten larvae were used for each experiment. The site of injection (last right or left proleg) was disinfected with ethanol 70% (vol/vol) before and after each injection. A 10 μL-Hamilton syringe fitted with a 30.5-gauge needle (Becton Dickinson, Franklin Lakes, N.J.) was used to inject 5 μL. After injection, larvae were kept in 9.2-cm Petri dishes at 37° C. in the dark with no food. Larvae were monitored daily for up to days and mortality (as defined by change of pigmentation and absence of response following physical stimulation) was recorded. Chelator toxicity: the following concentrations of DMG were tested (n=10 for each): 5, 10, 25, 50, 75, 100, 125, 150, 200, 250, 300, 350, 400 mM. Each solution was freshly prepared in 0.8% sterile NaCl, and 5 μL of each solution was injected in the last right proleg. A control with no chelator (0.8% NaCl only) was included in the study. Infection experiment: 5 μL of DMG (250 mM) was injected in the last right proleg of each larva, then approximately 5×10.sup.5 bacteria (either MDR K.p., or MDR S.T.) were injected in the last left proleg five to ten minutes after DMG inoculation. Bacterial suspensions were prepared as follows: cells were grown overnight in 5 mL of Mueller Hinton broth, harvested, washed once, and resuspended in sterile 0.8% NaCl to a final OD.sub.600 of 0.1 (approximately 10.sup.8 CFU/mL, as determined by CFU counts on serially diluted samples). Death rates were compared to those obtained after injection of NaCl only, DMG (250 mM) only, MDR K.p. only, or MDR S. T. only, respectively.
[0151] Nuclear magnetic resonance. All data were collected on a Bruker Avance Neo 800 MHz equipped with a 1.7 mM cryoprobe at 25° C. Standard proton spectra (without and with water suppression) and two-dimensional one-bond and multiple-bond proton-carbon correlated spectra (HSQC and HMBC) were collected using Bruker pulse library sequences, zg, zgpr, hsqcetgpsp2.2, and hmbcetgpl3nd, respectively. Data were processed with MNOVA software (Mestrelab Research, Spain). Initial NMR samples were prepared from aqueous liver, spleen, and blood preparations of individual mice, by adding 5 μL of D20 to a 50 μL aliquot from each sample. Since the HSQC spectrum showed no detectable DMG, the two sets of liver samples (with DMG, no DMG) were then separately pooled, lyophilized and 100 μL D20 was added to the residue. Once again, no DMG was detected in the aqueous sample. The two concentrated liver DMG samples were then extracted twice with 1 mL chloroform. The organic phase was separated and dried. 50 μL of CDCl.sub.3 was added to the residue and used for NMR analysis (see
TABLE-US-00005 TABLE 4 Reference Label Chemical FW Concentration used Number (Manufacturer) Solubility formula (g/mol) mM mg/mL D-1885 Dimethylglyoxime Non water soluble C.sub.4H.sub.8N.sub.2O.sub.2 116.12 0.1-10 0.011-0.11 (ALDRICH) 50 mg/mL in warm ethanol D-160105 Dimethylglyoxime, High Water solubility C.sub.4H.sub.6N.sub.2O.sub.2, 160.1 2.5-20 mM 0.4-3.2 disodium salt hydrate, 97% ~190 g/L or ~1.2M (SB) 2Na (SIGMA-ALDRICH) 40400 Dimethylglyoxime, High water solubility C.sub.4H.sub.6N.sub.2O.sub.2, 304.2 50 mM 15.2 disodium salt octahydrate, >97% ~366 g/L or ~1.2M (SB) 2Na, 8 H.sub.2O 100 mM 30.4 100 mM 30.4 200 mM 60.8 (FLUKA-SIGMA-ALDRICH) 25-125 mM 7.6-38.1 2.5-10 mM 0.76-3.0 2.5-20 mM 0.76-6.1 Reference Label Vol. Quantity cmpd DMG only Experiment/ Number (Manufacturer) used (mg) (mg) Application D-1885 Dimethylglyoxime NA NA NA S.T. hydrogenase (ALDRICH) inhibition D-160105 Dimethylglyoxime, NA NA NA Bacterial (Hp, Kp, ST) disodium salt hydrate, 97% growth inhibition (SIGMA-ALDRICH) 40400 Dimethylglyoxime, 0.2 mL 3.04 mg 1.16 mg Mice/ST inhibition disodium salt octahydrate, >97% 0.1 mL 3.04 mg 1.16 mg Mice/ST inhibition 0.2 mL 6.08 mg 2.32 mg Mice/NMR 0.1 mL 6.08 mg 2.32 mg Mice/NMR (FLUKA-SIGMA-ALDRICH) 5 μL 38-190 μg 14-72 μg Wax moth larvae NA NA NA Kp urease inhibition NA NA NA Growth inhibition (Kp, ST)
Example 2—Effect of Metals and DMG-Chelation on Amyloid-β Peptides
Commercial Recombinant Aβ.SUB.40 .Peptide Contains Metals, Including Copper, Zinc, and Nickel.
[0152] Most Ab peptide preparations used for in vitro aggregation studies are synthetic (e.g. chemically synthesized) or recombinant peptides (e.g. expressed in prokaryotic or eukaryotic organisms). To determine what type of metals is associated with commercial human recombinant Aβ peptide, a Aβ.sub.40 peptide preparation was subjected to a twenty-element ICP-MS analysis (Table 5). Aluminum, copper, manganese and zinc were among the metals found in the Aβ.sub.40 peptide preparation, whereas iron was not detected. Surprisingly, the most abundant element associated with the recombinant Aβ.sub.40 peptide was selenium, followed by nickel (1 mg mg of Ni per g of A 40 peptide, corresponding to 0.073 moles of Ni per mole of peptide). Taken together, these results suggest that the recombinant Aβ.sub.40 peptide used in this study is already metal-bound upon commercialization; metals may be acquired during bacterial expression in the host (E. coli), during the purification process, or both. To our knowledge, it is the first time nickel is found in a commercial recombinant Aβ.sub.40 peptide purified preparation, suggesting the peptide (or aggregated peptides) can naturally coordinate the transition metal nickel, in addition to other metals such as aluminum, copper, manganese, selenium and zinc. The metal content of all the other kit components, including TBS, thioflavin and NaOH (used to resuspend the peptide) was also analyzed by ICP-MS (
TABLE-US-00006 TABLE 5 ICP-MS metal analysis of commercial recombinant Aβ.sub.40-peptide. Metal/Aβ40 ratio μg metal per mmole metal per Element g of Aβ.sub.40 peptide.sup.a mole of Aβ.sub.40 peptide.sup.b Lithium (.sup.7Li) ND ND Beryllium (.sup.9Be) ND ND Aluminum (.sup.27Al) 65.7 10.5 Vanadium (.sup.51V) 1.03 0.09 Chromium (.sup.52Cr) 15 1.25 Manganese (.sup.55Mn) 1.06 0.08 Iron (.sup.56Fe) ND ND Cobalt (.sup.59Co) ND ND Nickel (.sup.60Ni) 1,005 72.5 Copper (.sup.65Cu) 22.8 1.55 Zinc (.sup.66Zn) 45.7 3.07 Arsenic (.sup.75As) ND ND Selenium (.sup.82Se) 27,784 1,470 Rubidium (.sup.85Rb) ND ND Strontium (.sup.88Sr) 3.6 0.18 Cadmium (.sup.111Cd) ND ND Cesium (.sup.133Cs) ND ND Barium (.sup.137Ba) 32.5 1.03 Lead (.sup.207Pb) 0.25 0.005 Uranium (.sup.238U) ND ND ND, not detected (below detection limit) .sup.abackground (water) subtracted-values. .sup.bcalculated with theoretical molecular mass of 4330 Da.
[0153] Addition of nickel enhances Aβ.sub.40 peptide aggregation. To determine the effect of nickel on Aβ.sub.40 peptide aggregation, a thioflavin-(ThT)-based aggregation kit was used in absence or presence of supplemental Ni(II) (
TABLE-US-00007 TABLE 6 Recombinant human Aβ.sub.40 aggregation rate as a function of DMG and/or metal. Relative Aβ.sub.40 aggregation rate (% control) Supplemental Supplemental DMG (μM) metal (μM) 0 100 500 1000 A None (0) 100 33 ± 2 ND ND Ni (10) 252 ± 8 58 ± 11 ND ND Zn (10) 505 ± 29 457 ± 39 ND ND Cu (10) 103 ± 19 54 ± 12 ND ND B None (0) 100 15 ± 14 <1 <1 Ni (100) 567 ± 61 410 ± 91 <1 <1 Zn (100) 1423 ± 258 1468 ± 56 833 ± 156 328 ± 63 C None (0) 100 48 ± 8 15 ± 5 21 ± 10 Cu (100) 77 ± 2 66 ± 15 49 ± 8 40 ± 3
[0154] Addition of DMG inhibits Aβ.sub.40 peptide aggregation. Addition of 100 mM of the Ni-specific chelator DMG in absence of supplemented metal severely reduced Aβ.sub.40 peptide aggregation, by 40 to 85% depending on experiments (Table 6). Furthermore, addition of 500 mM or 1000 mM DMG led to partial or full inhibition of the aggregation; in the latter case, we measured flat or even decreasing average fluorescence rates (reported as <1% of control, Table 6). Hence this dose-dependent inhibitory effect suggests that (i) DMG is able to pull metals away from the Aβ.sub.40 peptide and (ii) the Aβ.sub.40 peptide aggregation observed in absence of supplemented metals is likely due to the intrinsic presence of metallic ions (including Ni.sup.2+) within the recombinant peptide preparation, since the addition of the chelator leads to inhibition. When increasing amounts of DMG were added to the reaction mixture in presence of 100 mM Ni.sup.2+, Cu.sup.2+ or Zn.sup.2+, results with mixed outcomes were obtained. Complete inhibition was observed in presence of Ni (
[0155] Effect of pH on Aβ.sub.40 peptide aggregation in presence of metals or DMG. To study the effect of pH on Aβ.sub.40 peptide aggregation (in presence of metals or DMG), additional thioflavin-based aggregation experiments were conducted at pH 6.5, 7.5 or 8.5, with 25 mM Aβ.sub.40, in absence or presence of NiSO.sub.4 (25 mM), CuSO.sub.4 (25 mM), ZnSO.sub.4 (10 mM), or DMG (100 mM) (
[0156] Nickel binding to human recombinant Aβ.sub.40 peptide is confirmed by isothermal titration calorimetry. Isothermal titration calorimetry (ITC) has been already used to analyze copper or zinc binding to various Aβ peptides, including Ab.sub.40 (Talmard et al. Biochemistry 46, 13658-13666 (2007); Sacco et al. JBIC Journal of Biological Inorganic Chemistry 17, 531-541 (2012); Hatcher et al. The journal of physical chemistry B 112, 8160-8164 (2008)). In the current study, we used ITC to determine whether nickel can bind the Aβ.sub.40 peptide. The peptide (same used in ThT-based aggregation assays) was present in the sample cell at a concentration of 20 μM. Twenty injections of NiSO.sub.4 (1 mM solution, 5 μM increments in sample cell) were performed every 5 min under constant stirring (350 rpm) at 25° C., and the heat release was measured (
[0157] DMG-metal complexes can be detected by FTICR-MS. Aqueous solutions containing only DMG, or DMG in combination with Ni, Cu, Fe, Se or Zn salts were analyzed using FTICR-MS. In absence of added metal, two monomeric isoforms were detected, corresponding to either DMG, H.sup.+ (117.06585 m/z) or DMG, Na.sup.+ (139.04780 m/z) (
[0158] Analysis of DMG in brain samples using FTICR-MS and NMR. The fact that DMG inhibits Aβ.sub.40 peptide aggregation in vitro suggests it might be able to do the same in vivo, however DMG would first need to cross the blood brain (BBB). To determine whether DMG can localize to the mouse brain, we used FTICR-MS (see above) and Nuclear Magnetic Resonance (NMR). NMR was successfully used to detect DMG in the livers of mice subjected to daily oral doses (6.1 mg) of aqueous DMG for 3 days (Benoit et al. Sci Rep 9, 13851 (2019)). In the present study, the same treatment was administered (e.g. one daily oral delivery for 3 days), brain samples were processed and analyzed by NMR and FTICR-MS and compared to brain samples from (no DMG) control mice. Unfortunately, both methods failed to identify DMG (whether by itself or metal-chelated) in brain samples.
Experimental Procedures
[0159] Chemicals. The water-soluble form (2Na, 8H.sub.2O) of DMG was used in this study (ref #40400, Honeywell-Fluka, Muskegon, Mich., USA). All metals (CuSO.sub.4, FeSO.sub.4, Na.sub.2SeO.sub.3, NiCl.sub.2, NiSO.sub.4, ZnSO.sub.4) were from Sigma-Aldrich (Saint Louis, Mo., USA).
[0160] Amyloid Beta metal analysis. Metal levels for 20 elements (Li, Be, Al, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, As, Se, Rb, Sr, Cd, Cs, Ba, Pb, U) were determined by inductively coupled plasma mass spectrometry (ICP-MS). Briefly, 0.5 mg of lyophilized human recombinant Ab.sub.40 peptide (expressed in E. coli, purified and manufactured by rPeptides, Watkinsville, Ga.) was resuspended in ultrapure water to a final concentration of 5 mg/mL, digested overnight with concentrated trace metal grade nitric acid, heated for 2 h at 95° C. and subjected to ICP-MS using a Thermo X-Series II ICP-MS (Center for Applied Isotope Studies, University of Georgia, Athens, Ga.). The same treatment and analysis were performed on three other kit components: TBS 10× (reaction buffer), Thioflavin stock (400 μM) and NaOH (10 mM, used to resuspend the Ab.sub.40 peptide).
[0161] Amyloid Beta aggregation. The effect of metals, DMG, and/or pH on human recombinant aggregation was monitored using a thioflavin T (ThT)-based kit, following the manufacturer's recommendation (kit #A-1180-1, rPeptides, Watkinsville, Ga., USA). This kit contained human recombinant Aβ.sub.40 peptide (>97% pure, as determined by manufacturer's HPLC) with the following sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (SEQ ID NO:1), as provided by the manufacturer. Briefly, standard assays were conducted in triplicate in black polystyrene 96-well plates, in presence of Tris Buffer Saline (TBS) pH 7.4, or TBS pH 8.5, or 2-(N-morpholino)ethanesulfonic acid (MES) buffer saline pH 6.5, Th-T (20 or 40 μM), and human recombinant Aβ.sub.40 peptide (25 or 40 μM), with or without DMG (100, 500, or 1000 μM), CuSO.sub.4, NiSO.sub.4 or ZnSO.sub.4 (10, 25, or 100 μM). The aggregation of Aβ.sub.40, was shown by the increase in fluorescence (lex=440 nm/lem=485 nm) over time, was followed for 60 min or 120 min, with reading every three or five min, using a Synergy MX reader (Biotek, Winooski, Vt.). A ThT-only background control (no Aβ.sub.40 peptide) was included in triplicate in all experiments and subtracted from all readings. The aggregation rate, defined as the increase in fluorescence per min (RFU/min), was calculated by using the formula [A.sub.(440,485) at T.sub.40min)−A.sub.(440,485) at T.sub.20min]/20. These time points (20 to 40 min) were chosen because they constantly displayed the best linearity in every assay. Results shown are expressed as (mean and standard deviation of) percentages; they represent the ratio of aggregation rate (RFU/min) for a given (DMG, metal) condition, compared to the aggregation rate obtained for the control (Aβ.sub.40 peptide, no DMG, no metal added, set as 100% for each experiment).
[0162] Isothermal Titration Calorimetry. Binding assays of Aβ.sub.40 peptide and Ni or DMG were performed using a Nano ITC calorimeter (TA instruments, New Castle, Del.). Briefly, 1 mg of lyophilized Aβ.sub.40 peptide (#A-1157-2, rPeptides) was resuspended with 1% NH.sub.4OH to a concentration of 250 μM, sonicated for 15-20 sec, before being diluted to a final concentration of 20 μM Aβ.sub.40 using ddH.sub.2O and TBS 10×, pH 7.4 (working buffer: NH.sub.4OH 0.2%, TBS 1×, pH 7.4 (“NTBS”)). A volume of 500 μL was loaded onto the ITC sample cell, and the injection syringe was filled with 50 μL of either NTBS buffer (control), 1 mM NiSO.sub.4, or 1 mM DMG. All samples were degassed for 15 min at 25° C. before use. Titration was initiated using a program for 20 injections (2.38 μL each, every 5 min) with continuous stirring (350 rpm) at constant temperature (25° C.). ITC data were analyzed using NanoAnalyze 1.2 software (TA Instruments). Data obtained with the control experiment (Aβ.sub.40 peptide in sample cell, buffer in syringe) were subtracted from each experiment to account for any injection-related heat change. The Ni-Aβ.sub.40 experiment was done in triplicate, with a representative data set shown in figures.
[0163] Analysis of DMG and DMG-metal complexes in commercial preparations. Aqueous solutions of DMG (0.5 mg/mL or 1.6 mM), with or without Cu, Fe, Ni, Se or Zn solutions (0.16 mM each) were analyzed by Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FTICR-MS), using a Bruker Solari X ESI/MALDI-12T FT-ICR high precision mass spectrometer (Proteomics and Mass Spectrometry Facility, University of Georgia). The pH of all aqueous DMG solutions, with or without metal, was approximately 11. All samples were mixed (1:1) with methanol prior to injection.
[0164] Detection of DMG and DMG-metal complexes in mouse brains. A group of 6 (C57/BL) mice was used for this experiment: 3 mice were given 0.2 mL of 100 mM DMG (˜6.1 mg) every day for three days and 3 mice were used as (no DMG) controls. Mice were euthanized by CO.sub.2 asphyxiation and cervical dislocation. Brains were quickly removed and frozen at −80° C. Upon thawing, brains were cut into pieces and homogenized in 2 mL sterile deionized water, incubated for 1 h at 90° C., sonicated for 20 sec and spun down (16,800×g for 6 min). Supernatants were passaged through a 0.45 m filter unit and analyzed by FTICR-MS (see above) and Nuclear Magnetic Resonance (NMR), as previously described (Benoit et al. Sci Rep 9, 13851 (2019)).
Example 3—Dimethylglyoxime Inhibition of Biofilms
Methods
[0165] Growth conditions. Salmonella enterica serovar Typhimurium (S. Typhimurium) ATCC 700408 and Klebsiella pneumoniae ATCC BAA2472 were grown overnight in Luria-Bertani (LB) broth aerobically at 37° C. with shaking. Helicobacter pylori 43504 was grown on Brucella agar plates supplemented with 10% defibrinated sheep blood (BA) under microaerophilic conditions (4% 02, 10% CO.sub.2, and 86% N.sub.2) at 37° C.
[0166] Biofilm inhibition assay. S. Typhimurium and K. pneumoniae cultures were adjusted to an optical density (OD.sub.600) of 0.1 in fresh LB broth. H. pylori culture was adjusted to an OD.sub.600 of 0.15 in brain heart infusion (BHI) supplemented with 0.4% β-cyclodextran. S. Typhimurium, K. pneumoniae, and H. pylori cultures at the above cell densities were added to non-tissue culture treated polystyrene 96 well plates (Falcon) along with dimethylglyoxime disodium salt hydrate (Na.sub.2DMG) at various concentrations. Plates containing S. Typhimurium and K. pneumoniae were incubated at 37° C. aerobically without shaking for 18 hours. Plates containing H. pylori were incubated at 37° C. microaerobically without shaking for 48 hours. After incubation with (Na.sub.2DMG) a crystal violet biofilm assay was performed as previously described with modifications (Kwasny et al. 2010. Current Protocols in Pharmacology 50:13A. 8.1-13A. 8.23). Briefly, supernatant was removed from the wells. Next, adherent cells were gently washed with phosphate-buffered saline (PBS) and allowed to air dry for 15 minutes. Cells were then heat fixed for one hour at 60° C. before staining with 0.5% crystal violet for 5 minutes. After the crystal violet was thoroughly washed from the wells with distilled deionized water, cells were air dried for 15 minutes. Acetic acid (33%) was then added to the wells to solubilize the crystal violet. The crystal violet-acetic acid solution was transferred to a clean 96 well plate and the OD.sub.600 was measured.
[0167] Antibiofilm assay. H. pylori culture at OD.sub.600=0.15 was added to a non-tissue culture treated polystyrene 96 well plate (Falcon) and incubated at 37° C. micro-aerobically without shaking for 48 hours. After the initial incubation, the supernatant was removed from the wells and BHI+0.4% β-cyclodextran was added back to the wells with or without Na.sub.2DMG at various concentrations. The plate was then incubated an additional 24 hours. Then, the crystal violet biofilm assay was performed as above.
Results
[0168] In all three species tested (S. Typhimurium, K. pneumoniae, and H. pylori), DMG was able to inhibit biofilm formation (
Example 4—Effect of DMG (Alone or in Combination with Metal Ions) on Campylobacter Species
[0169] This Example shows that DMG (at millimolar levels) is bactericidal against Campylobacter concisus. This Example further shows that while DMG (at millimolar levels) is bacteriostatic against Campylobacter jejuni, DMG at millimolar levels is bactericidal against C. jejuni when combined with micromolar levels of copper (Cu.sup.2+).
[0170] C. concisus has been found throughout the entire human oral-gastrointestinal tract. The bacterium is associated with various ailments and diseases, such as gingivitis, periodontitis, inflammatory bowel disease, including Crohn's disease. There is no known animal reservoir.
[0171] C. jejuni is one of the most common causes of food poisoning in Europe and in the United States. The CDC estimates a total of 1.5 million infections every year and the European Food Safety Authority estimates approximately nine million cases of human campylobacteriosis per year in the European Union. People are usually infected by eating raw or undercooked poultry, or eating something that touched the raw or undercooked poultry. People may also be infected by eating seafood, meat, and produce; by contact with animals (C. jejuni is commonly found in animal feces); or by drinking untreated water. Food poisoning caused by Campylobacter species can be severely debilitating, however it is rarely life-threatening. Nevertheless, it can subsequently lead to Guillain-Barre syndrome (GBS), an auto-immune disease targeting the nerves and eventually causing paralysis.
[0172] Fluoroquinolone-resistant Campylobacter species are classified as “Priority 2: high” in the WHO's list of MDR pathogens (see Table 1A). All Campylobacter species have at least one Ni-containing hydrogenase (for instance C. jejuni), and some have two (for instance C. concisus). In the case of C. concisus, one of the hydrogenase complexes has been shown to be essential (Benoit et al. 2018 Sci. Rep. 8(1):14203). Hence, inhibiting the Ni-containing catalytic site of C. concisus (with DMG) was expected to have inhibitory effects on C. concisus growth and survival. As further described, below, however, the combined effect of DMG and Cu.sup.2+ on C. jejuni was unexpected.
Methods
[0173] Growth conditions. C. concisus (strain 13826, ATCC BAA-1457) was routinely grown on Brucella agar supplemented with 10% defibrinated sheep blood (BA plates) or Brain Heart Infusion (BHI) plates supplemented with 10% fetal calf serum (FCS), under H.sub.2-enriched microaerobic conditions (10% H.sub.2, 5% CO.sub.2, 2-10% 02, balance N.sub.2) at 37° C. C. jejuni (strain 81-176, ATCC BAA-2151) was either grown on BA plates or on BHI plates under microaerobic conditions (10% CO.sub.2, 4% O.sub.2, 86% N.sub.2) at 37° C. DMG (sodium salt, octahydrate) was used by itself or in combination with various divalent cations (Cobalt (II), CoCl.sub.2; Copper(II), CuSO.sub.4; Manganese(II), MnSO.sub.4; Nickel(II), NiSO.sub.4; Zinc(II), ZnSO.sub.4)
[0174] Growth inhibition assays: solid (Petri dish) plates experiments. C. concisus or C. jejuni cells were grown as described above, harvested, and resuspended in sterile NaCl (8 g/L) to an optical density at 600 nm (OD.sub.600) of 0.1 or 1; an OD.sub.600 of 1 corresponds approximately to 1×10.sup.9 cells/mL to 5×10.sup.9 cells/mL (for C. concisus) and 5×10.sup.9 cells/mL to 1×10.sup.10 cells/mL (for C. jejuni). Cells were serially (10-fold) diluted from 10.sup.−1 to 10.sup.−6 or 10.sup.−7 in NaCl (8 g/L) and 5 μL of each dilution was spotted on BA plates (for C. concisus) or BHI plates (for C. jejuni), containing various concentrations of DMG (0.5, 1, 2.5 or 5 mM), with or without various added metals (CoCl.sub.2, CuSO.sub.4, MnSO.sub.4, NiSO.sub.4, ZnSO.sub.4) at the following final concentrations: 1 μM, 5 μM, 10 μM, 20 μM, 50 μM, 100 μM, 500 μM. Plates with metals only were also used as controls. Colony-forming units (CFUs) were counted after 24 hours of growth at 37° C., under atmospheric conditions described above. The number of CFUs for each (DMG and metal) condition was compared to the number of CFUs obtained for the control condition (defined as plain BA, plain BHI-FCS, or plain BHI medium, without any DMG or added metal). Also, the size of the colonies was monitored. DMG concentrations were considered bacteriostatic when the number of CFUs was equal to the number of CFUs of the control, but the size of each CFU was significantly smaller compared to the control. DMG concentrations were considered bactericidal when the number of CFUs was at least three logs less than the number of CFUs obtained for the control.
[0175] Growth inhibition assays: liquid (96-well) plates experiments. This type of experiment can only be conducted with C. jejuni since the gas requirement for C. concisus (H.sub.2-enriched microaerobic) is not compatible with the use of 96-well plates. C. jejuni cells were grown as described above, harvested, and resuspended in sterile NaCl (8 g/L) to an OD.sub.600 of 0.1, corresponding approximately to 5×10.sup.8 to 1×10.sup.9 cells/mL. A checkboard type of loading plan allows for screening of up to eight DMG concentrations (0 mM, 0.062 mM, 0.125 mM, 0.25 mM, 0.5 mM, 1 mM, 2 mM, and 4 mM) against 11 metal ions concentrations (0 μM, 2 μM, 4 μM, 8 μM, 16 μM, 32 μM, 64 μM, 128 μM, 256 μM, 512 μM, and 1024 μM). Wells were serially (2-fold) diluted in each direction (horizontal and vertical) to introduce all combinations. Wells with no DMG or metal compounds served as (positive) growth controls, and wells with no bacteria served as background (negative growth) controls. A typical protocol and loading plan are described in Table 7. The starting inoculum was at OD.sub.600 of 0.05, which corresponds approximately to 2.5×10.sup.8 cells/mL to 5×10.sup.8 cells/mL. After 24 hours incubation under microaerobic conditions at 37° C., OD.sub.600 was recorded using a 96 well-plate reader (Microtek). The minimal inhibitory concentration (MIC) for DMG (or metal) is defined as the lowest concentration that inhibits cell growth (for example, OD.sub.600 at T=24 hours is the same or lower than 0.05) The minimal bactericidal concentration (MBC) was determined as follows: at the end of the MIC assay (24 hours), 5 μL of each well showing no or low growth was spotted on BHI and incubated at 37° C. overnight. Resulting growth (or lack of growth) was examined after overnight culturing; the lowest concentration that inhibits 99.9% of the original culture was defined as MBC. MIC and MBC were determined based on tests (plates) done in triplicate.
Results
[0176] Effect of DMG on C. concisus: Millimolar Levels of DMG are Bactericidal.
[0177] C. concisus recoveries on solid plates. After dilution and spotting on BA plates with no DMG or 2 mM DMG or 4 mM DMG, cells were incubated under H.sub.2-enriched microaerobic conditions for 24 hours at 37° C. and CFUs were counted (
Effect of DMG on C. jejuni: Millimolar Levels of DMG are Bacteriostatic, but Addition of Micromolar Levels of Copper (II) Renders Millimolar Levels of DMG Bactericidal Towards C. jejuni.
[0178] C. jejuni recoveries on solid plates. After dilution and spotting on BHI plates with no DMG, or various concentrations of DMG with or without supplemental CuSO.sub.4 or other metals (see methods), cells were incubated under microaerobic conditions for 24 hours at 37° C. and CFUs were counted (
[0179] The bactericidal effect of the DMG/metal combination is specific to Cu(II). For instance, while a DMG (2 mM)/Cu (0.5 mM) combination is bactericidal, there was no noticeable effect on C. jejuni growth when 0.5 mM of CoCl.sub.2, MnSO.sub.4, NiSO.sub.4, or ZnSO.sub.4 was added to the medium in combination with 2 mM DMG.
[0180] C. jejuni liquid (96-well checkboard assays) growth inhibition experiments. After 24 hours incubation under microaerobic conditions at 37° C., the OD.sub.600 was recorded in each well using a 96 well-plate reader. Table 8 shows an example of results obtained with various DMG and CuSO.sub.4 concentrations (three plates combined). In this case, the minimal inhibitory concentration (MIC), as defined in the Methods section, corresponds to the following combinations of DMG (in mM) and CuSO.sub.4 (in M): 4 and 8; 2 and 64; 1 and 256 (see Table 9).
[0181] After the OD.sub.600 was recorded, 5 μL of each well showing no or low growth was spotted on BHI and incubated at 37° C. overnight to determine the minimal bactericidal concentration (MBC), as defined in the Methods section.
[0182] As observed with the solid plate experiment, the bactericidal effect of DMG/metal combination is specific to Cu(II). Other metals did not confer the same potency in combination with DMG, therefore the DMG/Cu combination is the most efficient (e.g., bactericidal) against C. jejuni. Table 9 summarizes the MIC/MBC obtained for C. jejuni, with DMG and either CoCl.sub.2, MnSO.sub.4, NiSO.sub.4, or ZnSO.sub.4.
TABLE-US-00008 TABLE 7 C. jejuni 81-176 against DMG and CuSO.sub.4, checkerboard strategy. Final CuSO.sub.4 concentration (μM) Final 0 2 4 8 16 32 64 128 256 512 1024 1024 DMG (mM) 1 2 3 4 5 6 7 8 9 10 11 12 4 A no Cu no cell 2 B no Cu no cell 1 C no Cu no cell 0.5 D no Cu no cell 0.25 E no Cu no cell 0.125 F no Cu no cell 0.062 G no Cu no cell 0 H no Cu/ no no no no no no no no no no Blank no DMG DMG DMG DMG DMG DMG DMG DMG DMG DMG DMG 1 Add 100 uL of MH everywhere (A1-H12) 2 Add 100 uL of 16 mM DMG (240 ul 200 mM DMG•8H2O in 2760 uL MH) in rows A1-A12 3 Serially (2-fold) dilute DMG from row A (A1-A12) to row G (G1-G12). Discard 100 uL after row G. 4 Volume should be 100 uL everywhere and DMG concentration should be 8 mM (row A) to 0.125 mM (row G), no DMG in row H 5 Add 100 uL of 4.096 mM CuSO4 (61.5 uL 200 mM CuSO4 in 3 mL MH) in columns 11 (A11-H11) and 12 (A12-H12). Column 12: no cell control (metal-only OD.sub.60 6 Serially (2-fold) dilute metal from column 11 (A11-H11) to column 2 (A2-H2). Discard 100 uL after column 2. 7 Volume: 100 uL everywhere, except in 12 (200 uL); CuSO4 concentration: 2048 uM (Column 12) to 2 uM (Column 2), no Cu in column 1. 8 Add 100 uL of bacteria (C. jejuni) at OD 0.1 everywhere except in column 12. Starting OD should be 0.05 everywhere. 9 Final concentrations: DMG concentration range from 4 to 0.062 mM, CuSO4 conc. range from 1.024 mM to 0.002 mM (1,024 uM to 2 uM) 10 Incubate C. jejuni in CO.sub.2 incubator (4% O.sub.2, 10% CO.sub.2, balance N.sub.2) for 24 h 11 Measure OD.sub.600 at 24 h. Blank with A12. Use Column 12 to withdraw Cu-and DMG-Cu absorbance.
indicates data missing or illegible when filed
TABLE-US-00009 TABLE 8 3 plates combined Final CuSO.sub.4 concentration (uM) No cell Final 0 2 4 8 16 32 64 128 256 512 1024 1024 DMG (mM) 1 2 3 4 5 6 7 8 9 10 11 12 4 A 0.19 0.26 0.15 0.04 0.00 0.00 0.01 0.01 0.02 0.02 0.04 0.04 2 B 0.24 0.34 0.25 0.26 0.24 0.17 0.01 0.01 0.01 0.02 0.04 0.04 1 C 0.20 0.27 0.23 0.21 0.37 0.24 0.19 0.10 0.02 0.02 0.04 0.04 0.5 D 0.22 0.31 0.25 0.23 0.34 0.21 0.19 0.20 0.29 0.14 0.09 0.04 0.25 E 0.26 0.31 0.24 0.37 0.33 0.25 0.22 0.24 0.24 0.27 0.30 0.04 0.125 F 0.25 0.31 0.27 0.31 0.33 0.26 0.23 0.24 0.27 0.34 0.47 0.04 0.062 G 0.31 0.37 0.31 0.33 0.34 0.24 0.22 0.24 0.35 0.34 0.47 0.04 0 H 0.23 0.29 0.23 0.31 0.38 0.26 0.27 0.23 0.38 0.28 0.43 0.04
TABLE-US-00010 TABLE 9 MIC/MBC for DMG-metal combinations, C. jejuni strain 81-176 DMG concentration (mM) Metal 0 0.5 1 2 4 CO.sup.2+ >1024/>1024 >1024/>1024 >1024/>1024 /1024 256/512 CU.sup.2+ >1024/>1024 1024/>1024
/512
/128
/16 Ni.sup.2+ >1024/>1024 >1024/>1024 >1024/>1024 >1024/>1024 >1024/>1024 Zn.sup.2+ 512/>1024 512/>1024 512/>1024 512/>1024 512/>1024 First number, bold: MIC (μM)/ second number, italic: MBC (μM)
Example 5
[0183] This Example shows that DMG inhibits C. jejuni colonization in some chickens in the presence of added copper. This Example further shows that DMG inhibits C. jejuni colonization in some chickens in the absence of added copper.
[0184] Since chickens are natural hosts for C. jejuni, and chicken meat is one of the main sources of campylobacteriosis in humans, it was important to test the efficacy of DMG alone or in combination with copper in this animal model. Two independent trials were conducted, as described in
TABLE-US-00011 TABLE 10 C. jejuni colonization of chickens subjected to various drinking treatments. Chickens C. jejuni Ad libitum Total Colonized Cj-free** Average CFUs per oral treatment (n=) (n=) (n=) g of cecum (x10.sup.8) Experiment 1 Water 5 5 0 3.56 CuSO.sub.4 (0.2 mM) 4 4 0 5.95 CuSO.sub.4 (0.2 mM) 6 4 2 1.12 DMG (10 mM) Experiment 2 Water 6 6 0 6.73 DMG (15 mM) 7 6 1 2.38 CuSO.sub.4 (0.2 mM) 5 5 0 1.99 DMG (15 mM) * ad libitum oral treatment: chickens had free access to the indicated drinking treatment, starting two days before C. jejuni inoculation, and until the day of harvest (9 days p.i. for experiment 1; 8 days p.i. for experiment 2). **Cj-free: no C. jejuni was recovered from cecum content (detection limit = 200 CFUs per g of cecum).
[0185] The complete disclosure of all patents, patent applications, and publications, and electronically available material (including, for instance, nucleotide sequence submissions in, for example, GenBank and RefSeq, and amino acid sequence submissions in, for example, SwissProt, PIR, PRF, PDB, and translations from annotated coding regions in GenBank and RefSeq) cited herein are incorporated by reference. In the event that any inconsistency exists between the disclosure of the present application and the disclosure(s) of any document incorporated herein by reference, the disclosure of the present application shall govern. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.
TABLE-US-00012 Sequence Listing Free Text Aβ.sub.40 peptide SEQ ID NO: 1 DAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGVV