DUAL-VECTOR SYSTEM FOR TREATING HEARING IMPAIRMENT AND USE THEREOF
20230242942 · 2023-08-03
Assignee
- EYE & ENT HOSPITAL OF FUDAN UNIVERSITY (Shanghai, CN)
- SHANGHAI REFRESHGENE THERAPEUTICS CO., LTD. (Shanghai, CN)
Inventors
- Yilai SHU (Shanghai, CN)
- Huawei LI (Shanghai, CN)
- Rui ZHOU (Shanghai, CN)
- Qingqiao TAN (Shanghai, CN)
- Honghai TANG (Shanghai, CN)
- Hui Wang (Shanghai, CN)
- Kaiyu GAO (Shanghai, CN)
Cpc classification
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2800/40
CHEMISTRY; METALLURGY
C12N2750/14151
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
C07K14/4705
CHEMISTRY; METALLURGY
International classification
Abstract
A dual-vector system for expressing an OTOF protein includes two nucleotide sequences, where a first nucleotide sequence includes two ITR sequences and a gene expression cassette inserted between the ITR sequences; a second nucleotide sequence includes two ITR sequences and a gene expression cassette inserted between the ITR sequences; the gene expression cassette of the first nucleotide sequence includes a promoter, an N-terminal coding sequence of OTOF, an N-terminal coding sequence of intein, and a polyA; and the gene expression cassette of the second nucleotide sequence includes a promoter, a C-terminal coding sequence of Intein, a C-terminal coding sequence of OTOF, and a polyA. The present disclosure further provides an adeno-associated virus packaged by the vector. The vector and the virus can recover hearing of bilateral ears by a unilateral ear administration in the field of deafness gene therapy large gene dual-vector delivery.
Claims
1. A dual-vector system for expressing an OTOF protein, comprising a first nucleotide sequence and a second nucleotide sequence, wherein the first nucleotide sequence comprises two first ITR sequences and an expression cassette inserted between the two first ITR sequences; the second nucleotide sequence comprises two second ITR sequences and an expression cassette inserted between the two second ITR sequences; the expression cassette of the first nucleotide sequence comprises a promoter, an N-terminal coding sequence of OTOF, an N-terminal coding sequence of intein, and a polyA; the expression cassette of the second nucleotide sequence comprises a promoter, a C-terminal coding sequence of intein, a C-terminal coding sequence of OTOF, and a polyA; and an OTOF cleavage site is arranged into an OTOF amino acid sequence, the N-terminal coding sequence of the OTOF is a nucleotide coding sequence from an N-terminal of the OTOF amino acid sequence to the OTOF cleavage site, and the C-terminal coding sequence of OTOF is a nucleotide coding sequence from an amino acid next to the OTOF cleavage site to a C-terminal of the OTOF amino acid sequence.
2. The dual-vector system for expressing the OTOF protein according to claim 1, wherein the OTOF amino acid sequence is shown in SEQ ID NO: 1 or SEQ ID NO: 2.
3. The dual-vector system for expressing the OTOF protein according to claim 1, wherein the OTOF cleavage site comprises a preceding amino acid of a serine, a threonine, or a cysteine in the OTOF amino acid sequence.
4. The dual-vector system for expressing the OTOF protein according to claim 1, wherein the promoter of the expression cassette of the first nucleotide sequence or the second nucleotide sequence comprises a CAG promoter, a CMV promoter, a CBA promoter, a UbC promoter, an SFFV promoter, an EF1α promoter, a PGK promoter, or promoters for encoding genes Myo7A, Myo15, Atoh1, POU4F3, Lhx3, Myo6, α9AchR, α10AchR, and OTOF; the polyA of the expression cassette of the first nucleotide sequence or the second nucleotide sequence comprises AATAAA and variants of the AATAAA, the variants of the AATAAA comprises ATTAAA, AGTAAA, CATAAA, TATAAA, GATAAA, ACTAAA, AATATA, AAGAAA, AATAAT, AAAAAA, AATGAA, AATCAA, AACAAA, AATCAA, AATAAC, AATAGA, AATTAA, or AATAAG; and each ITR sequence of the two first ITR sequences and the two second ITR sequences is derived from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, or AAV9.
5. The dual-vector system for expressing the OTOF protein according to claim 1, wherein the expression cassette of the first nucleotide sequence or the second nucleotide sequence further comprises an expression regulatory element or a tag element.
6. The dual-vector system for expressing the OTOF protein according to claim 1, wherein the intein is derived from MxeGyrA, pabPolIII, MjaKlbA, SspDnaB, SceVMA, SspDnaE, NpuDnaE, AvaDnaE, CraDnaE, CspDnaE, CwaDnaE, MchtDnaE, OliDnaE, TerDnaE, gp41-1, gp41-8, IMPDH-1, or RmaDnaB.
7. The dual-vector system for expressing the OTOF protein according to claim 1, wherein the first nucleotide sequence is an expression cassette inserting the first nucleotide sequence in a plasmid comprising an ITR and between the two first ITR sequences; and the second nucleotide sequence is an expression cassette inserting the second nucleotide sequence in a plasmid comprising an ITR and between the two second ITR sequences.
8. The dual-vector system for expressing the OTOF protein according to claim 7, wherein the plasmid comprising the ITR is a pAAV, pAAV-CMV, pX601, pX551 or pAAV-MCS plasmid.
9. The dual-vector system for expressing the OTOF protein according to claim 1, wherein an 827th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and an NpuDnaE Intein is used; after the N-terminal coding sequence of the OTOF and an N-terminal coding sequence of the NpuDnaE Intein are connected and fused, the first nucleotide sequence is constructed with a pAAV-CMV plasmid as a vector; and after a C-terminal coding sequence of the NpuDnaE Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; or a 930th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and the NpuDnaE Intein is used; after the N-terminal coding sequence of the OTOF and the N-terminal coding sequence of the NpuDnaE Intein are connected and fused, the first nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; and after the C-terminal coding sequence of the NpuDnaE Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; or a 1,130th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and the NpuDnaE Intein is used; after the N-terminal coding sequence of the OTOF and the N-terminal coding sequence of the NpuDnaE Intein are connected and fused, the first nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; and after the C-terminal coding sequence of the NpuDnaE Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; or an 827th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and a RmaDnaB Intein is used; after the N-terminal coding sequence of the OTOF and a N-terminal coding sequence of the RmaDnaB Intein are connected and fused, the first nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; and after a C-terminal coding sequence of the RmaDnaB Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; or a 930th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and the RmaDnaB Intein is used; after the N-terminal coding sequence of the OTOF and the N-terminal coding sequence of the RmaDnaB Intein are connected and fused, the first nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; and after the C-terminal coding sequence of the RmaDnaB Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; or a 954th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and the RmaDnaB Intein is used; after the N-terminal coding sequence of the OTOF and the N-terminal coding sequence of the RmaDnaB Intein are connected and fused, the first nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; and after the C-terminal coding sequence of the RmaDnaB Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; or a 1,130th amino acid of the OTOF amino acid sequence shown in SEQ ID NO: 2 is used as the OTOF cleavage site and the RmaDnaB Intein is used; after the N-terminal coding sequence of the OTOF and the N-terminal coding sequence of the RmaDnaB Intein are connected and fused, the first nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector; and after the C-terminal coding sequence of the RmaDnaB Intein and the C-terminal coding sequence of the OTOF are connected and fused, the second nucleotide sequence is constructed with the pAAV-CMV plasmid as a vector.
10. A packaging vector system for an adeno-associated virus, wherein the packaging vector system comprises the dual-vector system for expressing the OTOF protein according to claim 1, a vector carrying AAV rep and cap genes, and a helper virus vector, and the vector carrying the AAV rep and cap genes and the helper virus vector are packaged into AAV vectors.
11. The packaging vector system for the adeno-associated virus according to claim 10, wherein the vector carrying the AAV rep and cap genes is selected from the group consisting of AAV1, AAV2, AAV5, AAV8, AAV9, Anc80, PHP.eB, AAV-DJ, and AAVrh.10 vectors; and the helper virus vector is a pHelper plasmid.
12. A packaging method for an adeno-associated virus, wherein the packaging vector system for the adeno-associated virus according to claim 10 is transferred into a host cell for packaging.
13. The packaging method for the adeno-associated virus according to claim 12, wherein the host cell is selected from the group consisting of a Hela-S3 cell, a HEK-293 cell, a HEK-293T cell, a HEK-293FT cell, a A549 cell, and a Sf9 cell.
14. The adeno-associated virus obtained by the packaging method according to claim 12.
15. A method of a use of the dual-vector system for expressing the OTOF protein according to claim 1 or an adeno-associated virus in preparing a drug or a preparation for treating a deafness disease or a hearing impairment or a hearing dysfunction, wherein the adeno-associated virus is obtained by transferring a packaging vector system for the adeno-associated virus into a host cell for packaging, and the packaging vector system for adeno-associated virus comprises the dual-vector system for expressing the OTOF protein, a vector carrying AAV rep and cap genes, and a helper virus vector, and the vector carrying the AAV rep and cap genes and the helper virus vector are packaged into AAV vector.
16. A drug or a preparation for treating a deafness disease or a hearing impairment or a hearing dysfunction prepared from the dual-vector system for expressing the OTOF protein according to claim 1 or an adeno-associated virus, wherein the adeno-associated virus is obtained by transferring a packaging vector system for the adeno-associated virus into a host cell for packaging, and the packaging vector system for adeno-associated virus comprises the dual-vector system for expressing the OTOF protein, a vector carrying AAV rep and cap genes, and a helper virus vector, and the vector carrying the AAV rep and cap genes and the helper virus vector are packaged into AAV vectors.
17. The drug or the preparation according to claim 16, wherein the drug or the preparation further comprises one or more of a neutral salt buffer, an acidic salt buffer, an alkaline salt buffer, glucose, mannose, mannitol, a protein, a polypeptide, an amino acid, an antibiotic, a chelating agent, an adjuvant, a preservative, a nanoparticle, a liposome, and a positive lipid particle.
18. The drug or the preparation according to claim 16, wherein an injection administration is performed through a round window, an oval window, a semicircular canal, and an alveus communis of a cochlea; and a lifetime single administration or a multiple administration is performed with a total dose of 1×10.sup.9-1×10.sup.13 virus genomes.
19. The packaging vector system for the adeno-associated virus according to claim 10, wherein the OTOF amino acid sequence is shown in SEQ ID NO: 1 or SEQ ID NO: 2.
20. The packaging vector system for the adeno-associated virus according to claim 10, wherein the OTOF cleavage site comprises a preceding amino acid of a serine, a threonine, or a cysteine in the OTOF amino acid sequence.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0059] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
DETAILED DESCRIPTION OF THE EMBODIMENTS
[0099] To make the objective, technical solutions and advantages of the present application clearer and more comprehensible, the present application will be further described below in detail in conjunction with specific examples. It should be understood that the specific examples described herein are merely intended to explain the patent, rather than to limit the present disclosure.
[0100] The present disclosure realizes a high-efficiency expression of an OTOF protein in a host by a method of combining dual vectors (or AAV dual vectors) delivery and intein recombination, further realizes the recovery of a deafness disease or hearing impairment or hearing dysfunction, and simultaneously achieves a technical effect of recovering hearing of bilateral ears by a unilateral ear administration.
[0101] The present disclosure utilizes an intein recombination method to express the OTOF protein. The related OTOF regions are: isoform 5 (NM_001287489.2) with a translated amino acid sequence of NP_001274418.1; and isoform 1 (NM_194248.3) with a translated amino acid sequence of NP_919224.1.
[0102] In some examples of the present disclosure, a target protein required for recovering or improving deafness is OTOF shown in SEQ ID NO: 1 or SEQ ID NO: 2. The target protein may further be a sequence with a similarity of 65%-100%, such as 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, and 65% to any one of SEQ ID NO: 1 or 2. And, the protein may further have a suitable truncated protein, such as a protein with a length of 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, and 60% of the full-length protein of any one of SEQ ID NO: 1 or 2. The protein may be appropriately inserted, such as a protein with a length of 101%, 102%, 103%, 104%, 105%, 110%, 115%, 120%, 125%, 130%, 135%, and 140% of a full-length protein. Related sequences have been listed in Table 1.
TABLE-US-00001 TABLE 1 OTOF sequences and corresponding relationships SEQ ID NO: NCBI number Feature 3 CCDS1725.1 Isoform 1, nucleotide sequence 1 NP_919224.1 Isoform 1, amino acid sequence 4 CCDS74497.1 Isoform 5, nucleotide sequence 2 NP_001274418.1 Isoform 5, amino acid sequence
[0103] In addition to the nucleotide sequence of SEQ ID NO: 3 or 4 corresponds the amino acid sequence of SEQ ID NO: 1 or 2, the amino acid sequence may be codons optimized. The corresponding CAI may be 0.65-1.0, such as 1.0, 0.99, 0.98, 0.97, 0.96, 0.95, 0.90, 0.85, 0.80, 0.75, 0.70 or 0.65.
[0104] In addition to the OTOF protein sequences from human as described above, the OTOF protein sequences may also be selected from other animals, such as mice (protein sequences NP_001273350.1, NP_001300696.1, NP_001093865.1 or NP_114081.2), rats (protein sequence NP_001263649.1), pigs (protein sequence XP_020943388.1), monkeys (protein sequences XP_014967378.2, XP_014967379.2, XP_028687700.1, XP_014967380.2 or XP_028687701.1), and a sequence with a similarity of 65%-100%, such as 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, and 65%.
[0105] Intein may splice a protein and function after or simultaneously with a protein translation to covalently link two different proteins. The earliest intein is found in fungi. It is predicted that the number of intein genes present in viruses, bacteria, archaea, and eukaryotic microorganisms is more than 600 by comparison and analysis of the sequences. Most inteins are complete proteins. In a small fraction of the inteins, an N-terminal and a C-terminal are separate, each linked to a portion of a protein, and subjected to recombination after the protein translation, and can form a complete protein through a nucleophilic chemical reaction and allosterism. In the present application, preferably, the N-terminal and the C-terminal of the intein are separated. The intein may be selected from inteins of MxeGyrA, pabPolIII, MjaKlbA, SspDnaB, SceVMA, SspDnaE, NpuDnaE, AvaDnaE, CraDnaE, CspDnaE, CwaDnaE, MchtDnaE, OliDnaE, TerDnaE, gp41-1, gp41-8, IMPDH-1, RmaDnaB, etc. Parts of intein amino acid sequences used in the examples of the present disclosure are shown in Table 2:
TABLE-US-00002 TABLE 2 Part of intein amino acid sequences Name Sequence Npu Npu CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNN Dna DnaE- GNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDH E N KFMTVDGQMLPIDEIFERELDLMRVDNLPN Npu IKIATRKYLGKQNVYDIGVERDHNFALKNGFIASN DnaE- C Rma Rma CLAGDTLITLADGRRVPIRELVSQQNFSVWALNPQT DNA DnaB- YRLERARVSRAFCTGIKPVYRLTTRLGRSIRATANH B N RFLTPQGWKRVDELQPGDYLALPRRIPTAS Rma AAACPELRQLAQSDVYWDPIVSIEPDGVEEVFDLTV DnaB- PGPHNFVANDIIAHN C
[0106] In the present disclosure, when the target protein is assembled into two vectors by using an intein recombination method. The OTOF is divided into an N-terminal and a C-terminal by taking a cleavage site as a boundary and the cleavage is performed as follows: 1) the OTOF can be packaged into an AAV and 2) a first amino acid at the C-terminal is serine, threonine or cysteine. The N-terminal of the intein is subjected to a fusion expression to the C-terminal of the N-terminal of the OTOF protein, and the C-terminal of the intein is subjected to a fusion expression to the N-terminal of the C-terminal of the OTOF protein.
[0107] Preferably, the OTOF protein is split into two segments with lengths of the N-terminal and the C-terminal approximately equivalent, or the length of the N-terminal/C-terminal of 0.3-3, such as the length of the N-terminal/C-terminal of 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.2, 1.5, 1.7, 1.8, 2.0, 2.0, 2.5, or 3.0.
[0108] More preferably, the splitting of the C-terminal of the N-terminal of the OTOF protein comprises but is not limited to cases listed in Table 3 of example 1.
[0109] More preferably, for the amino acid sequence of the OTOF protein shown in SEQ ID NO: 1 or 2, the N-terminal and the C-terminal are split into 1-827th amino acids and 828-1,997th amino acids, 1-930th amino acids and 931-1,997th amino acids, 1-954th amino acids and 955-1,997th amino acids, and 1-1,130th amino acids and 1,131-1,997th amino acids.
[0110] In the present disclosure, when the intein method is used to assemble the target protein into two vectors, that is, a dual-vector system for expressing an OTOF protein is constructed. The dual-vector system comprises two nucleotide sequences.
[0111] A first nucleotide sequence comprises two ITR sequences and an expression cassette inserted between the ITR sequences, and a second nucleotide sequence comprises two ITR sequences and an expression cassette inserted between the ITR sequences; the ITR is a sequence used for recognizing an adeno-associated protein and packaging DNA, and involved in recovery and replication of an adeno-associated virus genome; and preferably, the ITR sequence is derived from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, and an ITR sequence having a similarity of 65%-100%, such as 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, and 65% of the sequences described above.
[0112] The N-terminal of the intein is subjected to fusion expression to the C-terminal of the N-terminal of the OTOF protein and the obtained sequence is constructed into the expression cassette of the first nucleotide sequence, such that the expression cassette of the first nucleotide sequence comprises a promoter, an N-terminal coding sequence of OTOF, an N-terminal coding sequence of intein, and a polyA.
[0113] The C-terminal of the intein is subjected to fusion expression to the N-terminal of the C-terminal of the OTOF protein and the obtained sequence is constructed into the expression cassette of the second nucleotide sequence, such that the expression cassette of the second nucleotide sequence comprises a promoter, a C-terminal coding sequence of intein, a C-terminal coding sequence of OTOF, and a polyA.
[0114] The first nucleotide sequence and the second nucleotide sequence can both construct the N-terminal or C-terminal sequence of the OTOF in no particular order.
[0115] In the present disclosure, the above-mentioned promoter refers to a related sequence capable of promoting transcription of a downstream target protein, is generally used for recruiting transcription factors, is a sequence capable of expressing the target protein in a specific space and time, and comprises but is not limited to the following promoters: a promoter for a RNA polymerase II or a promoter for a RNA polymerase III. The promoter may also be classified as a broadly expressing promoter, such as a CMV promoter, a CAG promoter, etc. The promoter may also be a tissue specific promoter. Preferably, the promoter is highly expressed in an ear. Furthermore, the promoter is highly expressed at a cochlea or a vestibule. Furthermore, the promoter is highly expressed at the cochlea. The tissue specific promoter may be derived from a part or all of a sequence 1-10,000 bp upstream of a transcription initiation site of an OTOF gene and a sequence with a similarity of 65%-100%, such as 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, and 65%. Preferably, the promoter suitable for the present disclosure comprises but is not limited to a CAG promoter, a CMV promoter, a CBA promoter, a UbC promoter, an SFFV promoter, an EF1α promoter, a PGK promoter, or promoters corresponding to genes Myo7A, Myo15, Atoh1, POU4F3, Lhx3, Myo6, α9AchR, α10AchR, OTOF, etc.
[0116] PolyA refers to an adenine modification of a tail end during an mRNA maturation and can make the mRNA more stable. The PolyA sequence in the present disclosure comprises AATAAA and variants thereof, comprising ATTAAA, AGTAAA, CATAAA, TATAAA, GATAAA, ACTAAA, AATATA, AAGAAA, AATAAT, AAAAAA, AATGAA, AATCAA, AACAAA, AATCAA, AATAAC, AATAGA, AATTAA or AATAAG, etc.
[0117] The first or second nucleotide sequence may further comprise 1 or several regulatory elements, such as 2, 3, 4, 5, etc.; and the first and second regulatory elements may or may not be identical. The regulatory element comprises but is not limited to the following regulatory element: (1) the regulatory element is used for regulating an expression of a target protein, e.g., an IRES, for initiating translation of a downstream gene and the IRES is a sequence capable of initiating the protein translation within mRNA, such as the IRES can be derived from FMDV, EMCV, HRV, HIV, HAV, HCV, PV and other viruses; (2) the regulatory element is used for expressing miRNA and siRNA sequences; (3) the regulatory element is an intron; (4) the regulatory element is a localization sequence to localize the expression of the target protein to the nucleus, cytoplasm or various organelles, and secrete the target protein outside the cell; (5) the regulatory element is a sequence accelerating protein degradation, e.g., a PEST sequence; (6) the regulatory element may also be a part of a kozak sequence which is GNCNCN, e.g. GCCACC; (7) the regulatory element is an enhancer which refers to a sequence capable of enhancing gene expression, such as a CMV enhancer, an SV40 virus enhancer or an adenovirus enhancer, may be an upstream or a downstream of the target gene as well as within the gene, may or may not contain tissue specificity, and may or may not transcribe eRNA; and (8) the regulatory element may be a WPRE.
[0118] The first or second nucleotide sequence may further comprise 1 or several tags, such as 2, 3, 4, 5, etc.; and the first and second tags may or may not be identical. The tag may be, such as FLAG, HA, MYC, a fluorescent protein, a luciferase, etc., and may also be used to improve properties of a protein, such as an SUMO protein, ubiquitin, GST, etc.
[0119] The first or second nucleotide sequence constructed above may be a plasmid and a linear or circular nucleic acid in other forms, can co-express the N-terminal and C-terminal of the target protein to a cell, a tissue, an organ, and an individual, preferably a cochlea of the scope of the patent through proper selection of expression and regulatory elements, Preferably, the present disclosure uses an ITR-containing plasmid including pAAV, pAAV-CMV, pX601, pX551, pAAV-MCS, etc. to load a target gene expression cassette, followed by AAV packaging.
[0120] When the constructed first and second nucleotide sequences are virus vectors, the sequences may be used for AAV packaging in any forms. The first and second nucleotide sequences are respectively transferred into a host cell together with a vector carrying AAV rep and cap genes and a helper virus vector to be packaged to obtain an adeno-associated virus; and the host cell is a cell line capable of performing virus replication and with a stable inheritance, and comprises but is not limited to cells such as Hela-S3, HEK-293, HEK-293T, HEK-293FT, A549, Sf 9, etc.; and preferably, the host cell is HEK-293 or HEK-293Tcells. The packaged AAV sample may contain an empty virus with the content of 0%-99%, such as 0%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, and 95%, preferably 0%-50%.
[0121] The virus obtained by the packaging method is a pair of adeno-associated viruses respectively packaged with an N-terminal coding sequence of OTOF and an N-terminal coding sequence of intein, and a C-terminal coding sequence of intein and a C-terminal coding sequence of OTOF. The pair of adeno-associated viruses may co-express the N-terminal and C-terminal of the target protein to a cell, a tissue, an organ, and an individual. Intein may splice a protein and function after or simultaneously with a protein translation to covalently link two different proteins to obtain a full-length functional OTOF protein. The adeno-associated virus is suitable for a variety of mammalian cells, such as human, murine, dog, pig, rabbit, hamster, sheep, cat, horse or non-human primate cells. The adeno-associated virus can be used in ear, inner ear, cochlear, and inner ear hair cells, or cells not related to the ear. The cells may be in vitro, in vivo, or ex vivo.
[0122] Therefore, the dual vectors or adeno-associated virus may be used in preparation of a drug for a deafness disease or hearing impairment or hearing dysfunction. The deafness disease or hearing impairment or hearing dysfunction is caused by a gene mutation including an OTOF gene and the mutation comprises but is not limited to a base substitution, a frameshift mutation, a deletion mutation, an insertion mutation, etc.
[0123] A preparation or formula prepared from the dual vectors or adeno-associated virus may be a powder or a solution. The preparation or formula may comprise a common solvent and buffer, such as a common drug carrier and an adjuvant, comprising a neutral salt buffer, an acidic salt buffer, an alkaline salt buffer, glucose, mannose, mannitol, a protein, a polypeptide, an amino acid, an antibiotic, a chelating agent, an adjuvant or a preservative. The buffer comprises a phosphate buffer, a Tris buffer, and an HEPES buffer. The preparation or formula may further be contained in other vectors, such as a nanoparticle, a liposome, a positive lipid particle, etc. The solution may simulate components of a perilymph: NaCl at a concentration of 20-200 mM, KCl at a concentration of 1-5 mM, CaCl.sub.2) at a concentration of 0.1-10 mM, glucose at a concentration of 1-10 mM and HEPES at a concentration of 2-50 mM, with a pH of 6-9. The solution is finally sterile, can be dissolved in water, and can also be glycerol, ethanol, polyalcohol, oil, etc. The solution may be in a form ready for use or may be diluted for use.
[0124] The present disclosure uses the following administration modes: in the present disclosure, the adeno-associated virus obtained from the dual vectors or final packaging may be delivered to an ear by various methods, and may be delivered to the ear from areas of a round window, an oval window, a semicircular canal, an alveus communis, etc. with or without the use of auxiliary tools. The administration is one-time administration or multiple administrations according to protein expression and hearing recovery, the delivery dose may be 1-200 μL of AAV containing 1×10.sup.9-1×10.sup.13 virus genomes, for example, delivering 1-2 L of AAV containing 1×10.sup.9, 1×10.sup.10 or 1×10.sup.11 virus genomes in a mouse and delivering 10-100 μL of viruses containing 1×10.sup.9-1×10.sup.13 virus genomes in human. The adeno-associated virus may be delivered in an unilateral ear or bilateral ear manner. The unilateral ear delivery is preferred in the present disclosure to finally realize an effect of recovering bilateral hearing.
[0125] The present disclosure will be further described below in conjunction with specific examples.
Example 1 Selection of Intein Cleavage Site of OTOF (SEQ ID NO: 1 or 2)
[0126] A cleavage site was arranged on an OTOF amino acid sequence, an N-terminal coding sequence of OTOF was a nucleotide coding sequence from an N-terminal of the OTOF amino acid sequence to the cleavage site, and a C-terminal coding sequence of OTOF was a nucleotide coding sequence from an amino acid next to the cleavage site to a C-terminal of the OTOF amino acid sequence. The N-terminal of the OTOF was connected and fused with an N-terminal of intein and a C-terminal of the intein was connected and fused with the C-terminal of the OTOF. There were many choices for cleavage sites of the OTOF, some of which were listed in Table 3.
TABLE-US-00003 TABLE 3 Part of cleavage sites applicable to OTOF shown in SEQ ID NO: 1 or 2 Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-10-Intein 1-28-Intein 1-31-Intein 1-53-Intein 1-54-Intein 1-69-Intein 1-73-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 11-1,997; 29-1,997; 32-1,997; 54-1,997; 55-1,997; 70-1,997; 74-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-159-Intein 1-166-Intein 1-173-Intein 1-176-Intein 1-185-Intein 1-219-Intein 1-221-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 160-1,997; 167-1,997; 174-1,997; 177-1,997; 186-1,997; 220-1,997; 222-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-307-Intein 1-319-Intein 1-323-Intein 1-329-Intein 1-335-Intein 1-345-Intein 1-359-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 308-1,997; 320-1,997; 324-1,997; 330-1,997; 336-1,997; 346-1,997; 360-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-520-Intein 1-541-Intein 1-563-Intein 1-580-Intein 1-586-Intein 1-587-Intein 1-599-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 521-1,997; 542-1,997; 564-1,997; 581-1,997; 587-1,997; 588-1,997; 600-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-715-Intein 1-753-Intein 1-767-Intein 1-775-Intein 1-784-Intein 1-785-Intein 1-796-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 716-1,997; 754-1,997; 768-1,997; 776-1,997; 785-1,997; 786-1,997; 797-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-970-Intein 1-976-Intein 1-977-Intein 1-980-Intein 1-992-Intein 1-1,040-Intein 1-1,130-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 971-1,997; 977-1,997; 978-1,997; 981-1,997; 993-1,997; 1,041-1,997; 1,131-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,258-Intein 1-1,259-Intein 1-1,260-Intein 1-1,262-Intein 1-1,289-Intein 1-1,323-Intein 1-1,329-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,259-1,997; 1,260-1,997; 1,261-1,997; 1,263-1,997; 1,290-1,997; 1,324-1,997; 1,330-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,416-Intein 1-1,442-Intein 1-1,455-Intein 1-1,468-Intein 1-1,475-Intein 1-1,485-Intein 1-1,533-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,417-1,997; 1,443-1,997; 1,456-1,997; 1,469-1,997; 1,476-1,997; 1,486-1,997; 1,534-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,724-Intein 1-1,756-Intein 1-1,757-Intein 1-1,781-Intein 1-1,808-Intein 1-1,812-Intein 1-1,815-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,725-1,997; 1,757-1,997; 1,758-1,997; 1,782-1,997; 1,809-1,997; 1,813-1,997; 1,816-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-37-Intein 1-112-Intein 1-275-Intein 1-293-Intein 1-374-Intein 1-491-Intein 1-602-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 38-1,997; 113-1,997; 276-1,997; 294-1,997; 375-1,997; 492-1,997; 603-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-926-Intein 1-930-Intein 1-994-Intein 1-1,003-Intein 1-1,064-Intein 1-1,161-Intein 1-1,208-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 927-1,997; 931-1,997; 995-1,997; 1,004-1,997; 1,065-1,997; 1,162-1,997; 1,209-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,958-Intein 1-1,838-Intein 1-1,878-Intein 1-1,952-Intein 1-1,984-Intein 1-1,869-Intein 1-1,903-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,959-1,997; 1,839-1,997; 1,879-1,997; 1,953-1,997; 1,985-1,997; 1,870-1,997; 1,904-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-8-Intein 1-23-Intein 1-46-Intein 1-79-Intein 1-96-Intein 1-98-Intein 1-109-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 9-1,997; 24-1,997; 47-1,997; 80-1,997; 97-1,997; 99-1,997; 110-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-285-Intein 1-291-Intein 1-331-Intein 1-342-Intein 1-387-Intein 1-394-Intein 1-433-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 286-1,997; 292-1,997; 332-1,997; 343-1,997; 388-1,997; 395-1,997; 434-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-585-Intein 1-588-Intein 1-596-Intein 1-631-Intein 1-635-Intein 1-687-Intein 1-695-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 586-1,997; 589-1,997; 597-1,997; 632-1,997; 636-1,997; 688-1,997; 696-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-995-Intein 1-1,001-Intein 1-1,005-Intein 1-1,050-Intein 1-1,083-Intein 1-1,182-Intein 1-1,215-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 996-1,997; 1,002-1,997; 1,006-1,997; 1,051-1,997; 1,084-1,997; 1,183-1,997; 1,216-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,337-Intein 1-1,361-Intein 1-1,385-Intein 1-1,427-Intein 1-1,435-Intein 1-1,443-Intein 1-1,476-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,338-1,997; 1,362-1,997; 1,386-1,997; 1,428-1,997; 1,436-1,997; 1,444-1,997; 1,477-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,599-Intein 1-1,616-Intein 1-1,643-Intein 1-1,658-Intein 1-1,687-Intein 1-1,719-Intein 1-1,740-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,600-1,997; 1,617-1,997; 1,644-1,997; 1,659-1,997; 1,688-1,997; 1,720-1,997; 1,741-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-91-Intein 1-110-Intein 1-126-Intein 1-137-Intein 1-145-Intein 1-155-Intein 1-158-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 92-1,997; 111-1,997; 127-1,997; 138-1,997; 146-1,997; 156-1,997; 159-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-224-Intein 1-233-Intein 1-237-Intein 1-246-Intein 1-256-Intein 1-286-Intein 1-290-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 225-1,997; 234-1,997; 238-1,997; 247-1,997; 257-1,997; 287-1,997; 291-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-365-Intein 1-366-Intein 1-434-Intein 1-467-Intein 1-471-Intein 1-472-Intein 1-501-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 366-1,997; 367-1,997; 435-1,997; 468-1,997; 472-1,997; 473-1,997; 502-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-601-Intein 1-619-Intein 1-647-Intein 1-671-Intein 1-683-Intein 1-685-Intein 1-686-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 602-1,997; 620-1,997; 648-1,997; 672-1,997; 684-1,997; 686-1,997; 687-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-844-Intein 1-854-Intein 1-866-Intein 1-872-Intein 1-900-Intein 1-918-Intein 1-950-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 845-1,997; 855-1,997; 867-1,997; 873-1,997; 901-1,997; 919-1,997; 951-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,168-Intein 1-1,169-Intein 1-1,219-Intein 1-1,223-Intein 1-1,224-Intein 1-1,236-Intein 1-1,239-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,169-1,997; 1,170-1,997; 1,220-1,997; 1,224-1,997; 1,225-1,997; 1,237-1,997; 1,240-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,334-Intein 1-1,348-Intein 1-1,367-Intein 1-1,387-Intein 1-1,388-Intein 1-1,390-Intein 1-1,394-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,335-1,997; 1,349-1,997; 1,368-1,997; 1,388-1,997; 1,389-1,997; 1,391-1,997; 1,395-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,543-Intein 1-1,549-Intein 1-1,554-Intein 1-1,585-Intein 1-1,598-Intein 1-1,612-Intein 1-1,646-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,544-1,997; 1,550-1,997; 1,555-1,997; 1,586-1,997; 1,599-1,997; 1,613-1,997; 1,647-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-710-Intein 1-768-Intein 1-770-Intein 1-771-Intein 1-797-Intein 1-827-Intein 1-882-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 711-1,997; 769-1,997; 771-1,997; 772-1,997; 798-1,997; 828-1,997; 883-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,250-Intein 1-1,254-Intein 1-1,457-Intein 1-1,591-Intein 1-1,619-Intein 1-1,678-Intein 1-1,863-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,251-1,997; 1,255-1,997; 1,458-1,997; 1,592-1,997; 1,620-1,997; 1,679-1,997; 1,864-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-120-Intein 1-123-Intein 1-148-Intein 1-226-Intein 1-229-Intein 1-230-Intein 1-258-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 121-1,997; 124-1,997; 149-1,997; 227-1,997; 230-1,997; 231-1,997; 259-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-466-Intein 1-484-Intein 1-511-Intein 1-530-Intein 1-542-Intein 1-546-Intein 1-579-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 467-1,997; 485-1,997; 512-1,997; 531-1,997; 543-1,997; 547-1,997; 580-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-750-Intein 1-787-Intein 1-819-Intein 1-878-Intein 1-887-Intein 1-904-Intein 1-954-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 751-1,997; 788-1,997; 820-1,997; 879-1,997; 888-1,997; 905-1,997; 955-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,242-Intein 1-1,243-Intein 1-1,263-Intein 1-1,269-Intein 1-1,281-Intein 1-1,288-Intein 1-1,311-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,243-1,997; 1,244-1,997; 1,264-1,997; 1,270-1,997; 1,282-1,997; 1,289-1,997; 1,312-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,501-Intein 1-1,523-Intein 1-1,557-Intein 1-1,568-Intein 1-1,575-Intein 1-1,590-Intein 1-1,596-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,502-1,997; 1,524-1,997; 1,558-1,997; 1,569-1,997; 1,576-1,997; 1,591-1,997; 1,597-1,997; Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid Amino acid 1-1,752-Intein 1-1,775-Intein 1-1,783-Intein 1-1,819-Intein 1-1,828-Intein 1-1,859-Intein 1-1,864-Intein N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, N-terminal, Intein Intein Intein Intein Intein Intein Intein C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal C-terminal amino acid amino acid amino acid amino acid amino acid amino acid amino acid 1,753-1,997; 1,776-1,997; 1,784-1,997; 1,820-1,997; 1,829-1,997; 1,860-1,997; 1,865-1,997; Amino acid Amino acid Amino acid 1-1,914-Intein 1-1,941-Intein 1-1,959-Intein N-terminal, N-terminal, N-terminal, Intein Intein Intein C-terminal C-terminal C-terminal amino acid amino acid amino acid 1,915-1,997; 1,942-1,997; 1,960-1,997;
Example 2 Construction of First/Second Nucleotide Sequence by Using pAAV-CMV Plasmid Containing ITR Sequence
[0127] In an amino acid sequence of an OTOF protein shown in SEQ ID NO: 2, a 827th amino acid residue was used as a cleavage site (S1), a 930th amino acid residue was used as a cleavage site (S2), and a 1,130th amino acid residue was used as a cleavage site (S4) respectively; and NpuDnaE was used as intein and a pAAV-CMV plasmid (
[0128] the pAAV-CMV plasmid was digested with BstBI and HindIII, and a plasmid fragment was recovered from the gel. A gene synthesis method was utilized to synthesize a gene fragment 1 (an encoding gene of 1-827th amino acids of OTOF and an N-terminal of NpuDnaE intein), a gene fragment 2 (an encoding gene of a C-terminal of NpuDnaE intein and a 828-1,997th amino acids of OTOF), a gene fragment 3 (an encoding gene of 1-930th amino acids of OTOF and the N-terminal of NpuDnaE intein), a gene fragment 4 (an encoding gene of the C-terminal of NpuDnaE intein and 931-1,997th amino acids of OTOF), a gene fragment 5 (an encoding gene of 1-1,130th amino acids of OTOF and an N-terminal of NpuDnaE intein), and a gene fragment 6 (an encoding gene of the C-terminal of NpuDnaE intein and 1,131-1,997th amino acids of OTOF), and the gene fragments were digested by BstBI and HindIII. The digested pAAV-CMV plasmid was respectively ligated with the digested gene fragments 1-6 by using a T4 ligase system. After the ligation, 2 μL of the ligation product was added to 50 μL of DH5 α competent cells, the cells were ice-bathed for 30 min, heat-shocked for 1 min, and immediately placed on ice for 1 min, 200 μL of an LB liquid medium was added, the mixture was incubated at 37° C. for 30 min, and 200 μL of the bacterial solution was evenly applied to an ampicillin-resistant solid LB medium and incubated overnight at 37° C. 5 monoclones were picked and cultured in a shaker, and sequenced correctly. The following 6 plasmids were obtained for subsequent examples:
[0129] pAAV-CMV-OTOF-N-S1-Npu-N-intein plasmid (plasmid map shown in
[0130] pAAV-CMV-Npu-C-intein-OTOF-C-S1 plasmid (plasmid map shown in
[0131] pAAV-CMV-OTOF-N-S2-Npu-N-intein plasmid (plasmid map shown in
[0132] pAAV-CMV-Npu-C-intein-OTOF-C-S2 plasmid (plasmid map shown in
[0133] pAAV-CMV-OTOF-N-S4-Npu-N-intein plasmid (plasmid map shown in
[0134] pAAV-CMV-Npu-C-intein-OTOF-C-S4 plasmid (plasmid map shown in
[0135] pAAV-CMV-OTOF-N-S1-Npu-N-intein and pAAV-CMV-Npu-C-intein-OTOF-C-S1;
[0136] pAAV-CMV-OTOF-N-S2-Npu-N-intein and pAAV-CMV-Npu-C-intein-OTOF-C-S2; pAAV-CMV-OTOF-N-S4-Npu-N-intein and pAAV-CMV-Npu-C-intein-OTOF-C-S4; and the above plasmid transcription products all contained covalently linked OTOF (a part) and NpuDnaE intein (a part). Transcription products were listed in Table 4.
TABLE-US-00004 TABLE 4 Transcription and translation products of different N-terminals and C-terminals of Npu fused OTOF Transcription and No. Name of plasmid translation product 1 pAAV-CMV-OTOF-N-S1-Npu-N- OTOF 1-827-NpuDnaE intein intein N-terminal 2 pAAV-CMV-Npu-C-intein-OTOF- NpuDnaE intein C C-S1 terminal-OTOF 828-1,997 3 pAAV-CMV-OTOF-N-S2-Npu-N- OTOF 1-930-NpuDnaE intein intein N-terminal 4 pAAV-CMV-Npu-C-intein-OTOF- NpuDnaE intein C C-S2 terminal-OTOF 931-1,997 5 pAAV-CMV-OTOF-N-S4-Npu-N- OTOF 1-1130-NpuDnaE intein intein N-terminal 6 pAAV-CMV-Npu-C-intein-OTOF- NpuDnaE intein C C-S4 terminal-OTOF 1131-1,997
Example 3 Construction of First/Second Nucleotide Sequence by Using pAAV-CMV Plasmid Containing ITR Sequence
[0137] In an amino acid sequence of an OTOF protein shown in SEQ ID NO: 2, a 827th amino acid residue was used as a cleavage site (S1), a 930th amino acid residue was used as a cleavage site (S2), a 954th amino acid residue was used as a cleavage site (S3), and a 1,130th amino acid residue was used as a cleavage site (S4) respectively; and RmaDnaB intein was used and a pAAV-CMV plasmid (
[0138] the pAAV-CMV plasmid was digested with BstBI and HindIII, and a plasmid fragment was recovered from the gel. A gene synthesis method was utilized to synthesize a gene fragment 7 (an encoding gene of 1-827th amino acids of OTOF and an N-terminal of RmaDnaB intein as shown in SEQ ID NO: 5 (further comprising a part of sequence connected with the plasmid)), a gene fragment 8 (an encoding gene of a C-terminal of RmaDnaB intein and a 828-1,997th amino acids of OTOF as shown in SEQ ID NO: 6 (further comprising a part of sequence connected with the plasmid)), a gene fragment 9 (an encoding gene of 1-930th amino acids of OTOF and the N-terminal of RmaDnaB intein as shown in SEQ ID NO: 7 (further comprising a part of sequence connected with the plasmid)), a gene fragment 10 (an encoding gene of the C-terminal of RmaDnaB intein and 931-1,997th amino acids of OTOF as shown in SEQ ID NO: 8 (further comprising a part of sequence connected with the plasmid)), a gene fragment 11 (an encoding gene of 1-954th amino acids of OTOF and the N-terminal of RmaDnaB intein), a gene fragment 12 (an encoding gene of the C-terminal of RmaDnaB intein and 955-1,997th amino acids of OTOF), a gene fragment 13 (an encoding gene of 1-1,130th amino acids of OTOF and the N-terminal of RmaDnaB intein), and a gene fragment 14 (an encoding gene of the C-terminal of RmaDnaB intein and 1,131-1,997th amino acids of OTOF), and the gene fragments were digested by BstBI and HindIII. The digested pAAV-CMV plasmid was respectively ligated with the digested gene fragments 7-14 by using a T4 ligase system. After the ligation, 2 μL of the ligation product was added to 50 μL of DH5α competent cells, the cells were ice-bathed for 30 min, heat-shocked for 1 min, and immediately placed on ice for 1 min, 200 μL of an LB liquid medium was added, the mixture was incubated at 37° C. for 30 min, and 200 μL of the bacterial solution was evenly applied to an ampicillin-resistant solid LB medium and incubated overnight at 37° C. 5 monoclones were picked and cultured in a shaker, and sequenced correctly. The following 8 plasmids were obtained for subsequent examples:
[0139] pAAV-CMV-OTOF-N-S1-Rma-N-intein plasmid (plasmid map shown in
[0140] pAAV-CMV-Rma-C-intein-OTOF-C-S1 plasmid (plasmid map shown in
[0141] pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid (plasmid map shown in
[0142] pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid (plasmid map shown in
[0143] pAAV-CMV-OTOF-N-S3-Rma-N-intein plasmid (plasmid map shown in
[0144] pAAV-CMV-Rma-C-intein-OTOF-C-S3 plasmid (plasmid map shown in
[0145] pAAV-CMV-OTOF-N-S4-Rma-N-intein plasmid (plasmid map shown in
[0146] pAAV-CMV-Rma-C-intein-OTOF-C-S4 plasmid (plasmid map shown in
[0147] pAAV-CMV-OTOF-N-S1-Rma-N-intein and pAAV-CMV-Rma-C-intein-OTOF-C-S1; pAAV-CMV-OTOF-N-S2-Rma-N-intein and pAAV-CMV-Rma-C-intein-OTOF-C-S2;
[0148] pAAV-CMV-OTOF-N-S3-Rma-N-intein and pAAV-CMV-Rma-C-intein-OTOF-C-R3;
[0149] pAAV-CMV-OTOF-N-S4-Rma-N-intein and pAAV-CMV-Rma-C-intein-OTOF-C-S4; and the above plasmid transcription products all contained covalently linked OTOF (a part) and RmaDna intein (a part). Transcription products were listed in Table 5.
TABLE-US-00005 TABLE 5 Transcription and translation products of different N-terminals and C-terminals of Rma fused OTOF Transcription and No. Name of plasmid translation product 1 pAAV-CMV-OTOF-N-S1-Rma-N- OTOF 1-827- RmaDnaB intein intein N-terminal 2 pAAV-CMV-Rma-C-intein-OTOF- RmaDnaB intein C C-S1 terminal-OTOF 828-1,997 3 pAAV-CMV-OTOF-N-S2-Rma-N- OTOF 1-930- RmaDnaB intein intein N-terminal 4 pAAV-CMV-Rma-C-intein-OTOF- RmaDnaB intein C C-S2 terminal-OTOF 931-1,997 5 pAAV-CMV-OTOF-N-S3-Rma-N- OTOF 1-954-RmaDnaB intein intein N-terminal 6 pAAV-CMV-Rma-C-intein-OTOF- RmaDnaB intein C C-S3 terminal-OTOF 955-1,997 7 pAAV-CMV-OTOF-N-S4-Rma-N- OTOF 1-1130- RmaDnaB intein intein N-terminal 8 pAAV-CMV-Rma-C-intein-OTOF- RmaDnaB intein C C-S4 terminal-OTOF 1,131-1,997
Example 4 Construction of Different Recombinant Plasmids by OTOF Shown in SEQ ID NO: 2
[0150] According to the method similar to example 2 and example 3, a full-length plasmid capable of expressing an OTOF protein was constructed: a pAAV-CMV-OTOF-FL plasmid (including a CMV promoter, OTOF isoform 5 (SEQ TD NO: 4), and bGH PolyA, and a map is shown in
[0151] According to the method similar to example 2 and example 3, a plasmid for DNA recombination was constructed:
[0152] a pAAV-CMV-OTOF-N-AK plasmid (including a CMV promoter, a 1-930th amino acid coding sequence of OTOF, an SD sequence, and an AK sequence, and a map is shown in
[0153] a pAAV-CMV-OTOF-N-AP plasmid (including a CMV promoter, a 1-930th amino acid coding sequence of OTOF, an SD sequence, and an AK sequence, and a map is shown in
[0154] a pAAV-CMV-OTOF-N-TS plasmid (including a CMV promoter, a 1-930th amino acid coding sequence of OTOF, and an SD sequence, and a map is shown in
[0155] AK and AP are sequences for DNA recombination after adeno-associated viruses after entering cells. After the DNA recombination, trans-splicing was performed through an SA-SD sequence, a complete mRNA was formed, and a full-length functional OTOF protein was expressed. pAAV-CMV-OTOF-N-TS and pAAV-TS-OTOF-C-PolyA adeno-associated viruses were recombined through ITR, trans-splicing was performed through an SA-SD sequence, a complete mature mRNA was formed, and a full-length functional OTOF protein was expressed.
Example 5 Preparation of Adeno-Associated Viruses
[0156] 8 plasmids constructed by the method of the present disclosure in example 3 and 6 plasmids constructed in example 4 respectively along with a pHelper plasmid and a pRC plasmid of PHP.eB at a molar ratio of 1:1:1 were co-transfected into HEK-293T cells with a PEI transfection reagent (1 μg of the plasmids were added into about every million cells), the cells were cultured by using a DMEM medium containing 10% fetal bovine serum at a 5% carbon dioxide incubator at 37° C. for 3 days, the cells were washed once with a PBS buffer, the cells were collected, and repeatedly frozen and thawed for five times, a solid NaCl was added to make a final concentration 500 mM, the cells were centrifuged at 10,000 g for half an hour, the obtained supernatant was taken and filtered with a 0.45-μm filter membrane, the filtrate was purified by using an iodixanol method, and a part of the sample was taken and concentrated to obtain an adeno-associated virus with a virus titer of 1±0.2×10.sup.13 virus genomes/ml, a solvent of a 0.01% poloxamer PBS buffer, and an empty shell rate of about 50%. Specific experimental systems were shown in Table 6 below. The viruses will be named according to the names of the plasmids later, for example, number 1 is an adenovirus packaged by pAAV-CMV-OTOF-N-S1-Rma-N-intein, a pHelper plasmid, and a PHP.eB and named a pAAV-CMV-OTOF-N-S1-Rma-N-intein adeno-associated virus.
[0157] A preparation method of the 0.01% poloxamer PBS buffer was as follows: (1) a PBS buffer was prepared: 137 mM of NaCl, 2.7 mM of KCl, 10 mM of Na.sub.2IPO.sub.4, 2 mM of KH.sub.2PO.sub.4 and the balance water; and (2) according to a mass-to-volume ratio, poloxamer F68 was added to the PBS buffer prepared in step (1) to make a final concentration of 0.01%.
[0158] The 0.01% poloxamer PBS buffer related in the present disclosure was all prepared by using the method.
TABLE-US-00006 TABLE 6 Transfection system Helper virus Vector carrying Number GOI plasmid vector AAV rep and cap genes 1 pAAV-CMV-OTOF-N-S1-Rma-N-intein pHelper plasmid PHP.eB 2 pAAV-CMV-Rma-C-intein-OTOF-C-S1 pHelper plasmid PHP.eB 3 pAAV-CMV-OTOF-N-S2-Rma-N-intein pHelper plasmid PHP.eB 4 pAAV-CMV-Rma-C-intein-OTOF-C-S2 pHelper plasmid PHP.eB 5 pAAV-CMV-OTOF-N-S3-Rma-N-intein pHelper plasmid PHP.eB 6 pAAV-CMV-Rma-C-intein-OTOF-C-S3 pHelper plasmid PHP.eB 7 pAAV-CMV-OTOF-N-S4-Rma-N-intein pHelper plasmid PHP.eB 8 pAAV-CMV-Rma-C-intein-OTOF-C-S4 pHelper plasmid PHP.eB 9 pAAV-CMV-OTOF-N-AK pHelper plasmid PHP.eB 10 pAAV-AK-OTOF-C-PloyA pHelper plasmid PHP.eB 11 pAAV-CMV-OTOF-N-AP pHelper plasmid PHP.eB 12 pAAV-AP-OTOF-C-PloyA pHelper plasmid PHP.eB 13 pAAV-CMV-OTOF-N-TS pHelper plasmid PHP.eB 14 pAAV-TS-OTOF-C-PolyA pHelper plasmid PHP.eB
Example 6 Recombination of Plasmids Constructed in Examples 2 and 3 in Cells (at a Plasmid Ratio of 1:1)
[0159] 7 pairs of plasmids constructed in examples 2 and 3 and pAAV-CMV-OTOF-FL constructed in example 4 were respectively transfected into HEK-293T cells cultured in a six-well plate (the number of cells per well was about 1×10.sup.6, 2 μg of the plasmids were added into 100 μL of Opti-MEM to be mixed to obtain a plasmid premix, 4 μL of PEI was added into 100 μL of Opti-MEM to be mixed to obtain a PEI premix, the plasmid premix and the PEI premix were mixed, and the obtained mixture was put still for 10 min and dropped onto the cultured HEK-293T cells), the cells were cultured for 48 h, a cell culture medium was absorbed, 200 μL of a cell lysis buffer (1% triton-X 100, 50 mM of Tris-Hcl, and 1 mM of PMSF, pH=7.4) was added, the cells were placed on ice for 10 min, a cell lysate was collected and centrifuged at 12,000 g and 4° C. for 10 min, and a supernatant was kept. ¼ volume of a 5× loading buffer (0.25 M of Tris HCl, 10% SDS, 0.05% bromophenol blue, 50% glycerin, and 0.25 M DTT) was added into the supernatant and the mixture was heated at 90° C. for 10 min to obtain a protein sample. 50 μL of the protein sample was subjected to a polyacrylamide gel electrophoresis. After the protein was transferred from gel to a PVDF membrane, aiming at an OTOF N-terminal antibody (article No. A20266, abclonal) or a C-terminal antibody (article No. PA5-52935, Invitrogen), the protein was incubated at a normal temperature for 2 h and incubated with the corresponding HRP coupled secondary antibody for 1 h. An ECL reagent was added for imaging. The results were shown in
[0160] The amount of transfection plasmids was summarized in Table 7.
TABLE-US-00007 TABLE 7 Amount of plasmid transfection Lane Name of recombinant plasmid Amount 1 (NpuS1) pAAV-CMV-OTOF-N-S1-Npu-N-intein 1 μg pAAV-CMV-Npu-C-intein-OTOF-C-S1 1 μg 2 (NpuS2) pAAV-CMV-OTOF-N-S2-Npu-N-intein 1 μg pAAV-CMV-Npu-C-intein-OTOF-C-S2 1 μg 3 (NpuS4) pAAV-CMV-OTOF-N-S4-Npu-N-intein 1 μg pAAV-CMV-Npu-C-intein-OTOF-C-S4 1 μg 4 (RmaS1) pAAV-CMV-OTOF-N-S1-Rma-N-intein 1 μg pAAV-CMV-Rma-C-intein-OTOF-C-S1 1 μg 5 (RmaS2) pAAV-CMV-OTOF-N-S2-Rma-N-intein 1 μg pAAV-CMV-Rma-C-intein-OTOF-C-S2 1 μg 6 (RmaS3) pAAV-CMV-OTOF-N-S3-Rma-N-intein 1 μg pAAV-CMV-Rma-C-intein-OTOF-C-S3 1 μg 7 (RmaS4) pAAV-CMV-OTOF-N-S4-Rma-N-intein 1 μg pAAV-CMV-Rma-C-intein-OTOF-C-S4 1 μg 8 (FL) pAAV-CMV-OTOF-FL 2 μg
Example 7 Recombination of S2 Plasmids at Ratio of 1:2, Etc. In Cells
[0161] A pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid respectively at a mass ratio of 1:1 (1 μg, 1 μg), 1:2 (0.65 μg, 1.35 μg), 1:3 (0.5 μg, 1.5 μg), and 1:4 (0.4 μg, 1.6 μg), and 2 μg of pAAV-CMV-OTOF-FL were transfected into HTEK-293T cells cultured in a six-well plate (the number of cells per well was about 1×10.sup.6, 2 μg of the plasmids were added into 100 μL of Opti-MEM to be mixed to obtain a plasmid premix, 4 μL of PEI was added into 100 μL of Opti-MEM to be mixed to obtain a PEI premix, the plasmid premix and the PEI premix were mixed, and the obtained mixture was put still for 10 min and dropped onto the cultured HTEK-293T cells), the cells were cultured for 48 h, a cell culture medium was absorbed, 200 μL of a cell lysis buffer (1% triton-X 100, 50 mM of Tris-Hcl, and 1 mM of PMSF, pH=7.4) was added, the cells were placed on ice for 10 min, a cell lysate was collected and centrifuged at 12,000 g and 4° C. for 10 min, and a supernatant was kept. ¼ volume of 5× loading buffer (0.25 M of Tris HCl, 10% SDS, 0.0500 bromophenol blue, 50% glycerin, and 0.25 M DTT) was added into the supernatant and the mixture was heated at 90° C. for 10 min to obtain a protein sample. 50 μL of the protein sample was subjected to a polyacrylamide gel electrophoresis. After the protein was transferred from gel to a PVDF membrane, aiming at an OTOF N-terminal antibody (A20266, abelonal) or a C-terminal antibody (PA5-52935, Invitrogen), the protein was incubated at a normal temperature for 2 h and incubated with the corresponding HRP coupled secondary antibody for 1 h. An ECL reagent was added for imaging. The results were shown in
Example 8 Recombination of S2 Plasmids at Different Ratios of 1:2.5, Etc. In Cells
[0162] A pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid respectively at a mass ratio of 1:2 (0.65 μg, 1.35 μg), 1:2.5 (0.55 μg, 1.45 μg), 1:3 (0.5 μg, 1.5 μg), and 1:3.5 (0.4 μg, 1.6 μg), and 2 μg of pAAV-CMV-OTOF-FL were transfected into HEK-293T cells cultured in a six-well plate (the number of cells per well was about 1×10.sup.6, 2 μg of the plasmids were added into 100 μL of Opti-MEM to be mixed to obtain a plasmid premix, 4 μL of PEI was added into 100 μL of Opti-MEM to be mixed to obtain a PEI premix, the plasmid premix and the PEI premix were mixed, and the obtained mixture was put still for 10 min and dropped onto the cultured HEK-293T cells), the cells were cultured for 48 h, a cell culture medium was absorbed, 200 μL of a cell lysis buffer (1% triton-X 100, 50 mM of Tris-Hcl, and 1 mM of PMSF, pH=7.4) was added, the cells were placed on ice for 10 min, a cell lysate was collected and centrifuged at 12,000 g and 4° C. for 10 min, and a supernatant was kept. ¼ volume of a 5× loading buffer (0.25 M of Tris HCl, 10% SDS, 0.05% bromophenol blue, 50% glycerin, and 0.25 M DTT) was added into the supernatant and the mixture was heated at 90° C. for 10 min to obtain a protein sample. 50 μL of the protein sample was subjected to a polyacrylamide gel electrophoresis. After the protein was transferred from gel to a PVDF membrane, aiming at an OTOF N-terminal antibody (A20266, abclonal) or a C-terminal antibody (PA5-52935, Invitrogen), the protein was incubated at a normal temperature for 2 h and incubated with the corresponding HRP coupled secondary antibody for 1 h. An ECL reagent was added for imaging. The results were shown in
Example 9 Recombination of S1 Plasmids at Ratio of 1:2, Etc. In Cells
[0163] A pAAV-CMV-OTOF-N-S1-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S1 plasmid respectively at a mass ratio of 1:1 (1 μg, 1 μg), 1:2 (0.65 μg, 1.35 μg), 1:3 (0.5 μg, 1.5 μg), and 1:4 (0.4 μg, 1.6 μg), and 2 μg of pAAV-CMV-OTOF-FL were transfected into HEK-293T cells cultured in a six-well plate (the number of cells per well was about 1×10.sup.6, the N-terminal plasmid and C-terminal plasmid at the ratio were added into 100 μL of Opti-MEM to be mixed to obtain a plasmid premix, 4 μL of PEI was added into 100 μL of Opti-MEM to be mixed to obtain a PEI premix, the plasmid premix and the PEI premix were mixed, and the obtained mixture was put still for 10 min and dropped onto the cultured HEK-293T cells), the cells were cultured for 48 h, a cell culture medium was absorbed, 200 μL of a cell lysis buffer (1% triton-X 100, 50 mM of Tris-Hcl, and 1 mM of PMSF, pH=7.4) was added, the cells were placed on ice for 10 min, a cell lysate was collected and centrifuged at 12,000 g and 4° C. for 10 min, and a supernatant was kept. ¼ volume of a 5× loading buffer (0.25 M of Tris HCl, 10% SDS, 0.05% bromophenol blue, 50% glycerin, and 0.25 M DTT) was added into the supernatant and the mixture was heated at 90° C. for 10 min to obtain a protein sample. 50 μL of the protein sample was subjected to a polyacrylamide gel electrophoresis. After the protein was transferred from gel to a PVDF membrane, aiming at an OTOF N-terminal antibody (A20266, abclonal) or a C-terminal antibody (PA5-52935, Invitrogen), the protein was incubated at a normal temperature for 2 h and incubated with the corresponding HRP coupled secondary antibody for 1 h. An ECL reagent was added for imaging. The results were shown in
Example 10 Transfection Efficiency of Different Culture Time
[0164] A pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid respectively at a mass ratio of 1:2.5 (0.55 μg, 1.45 μg) were transfected into HEK-293T cells cultured in a six-well plate (the number of cells per well was about 1×10.sup.6, 2 μg of the plasmids were added into 100 μL of Opti-MEM to be mixed to obtain a plasmid premix, 4 μL of PEI was added into 100 μL of Opti-MEM to be mixed to obtain a PEI premix, the plasmid premix and the PEI premix were mixed, and the obtained mixture was put still for 10 min and dropped onto the cultured HEK-293T cells), the cells were cultured for 2, 4, 6, 8, 12, 24, 48 and 72 h respectively, a cell culture medium was absorbed, 200 μL of a cell lysis buffer (1% triton-X 100, 50 mM of Tris-Hcl, and 1 mM of PMSF, pH=7.4) was added, the cells were placed on ice for 10 min, a cell lysate was collected and centrifuged at 12,000 g and 4° C. for 10 min, and a supernatant was kept. ¼ volume of 5× loading buffer (0.25 M of Tris HCl, 10% SDS, 0.05% bromophenol blue, 50% glycerin, and 0.25 M DTT) was added into the supernatant and the mixture was heated at 90° C. for 10 min to obtain a protein sample. 50 μL of the protein sample was subjected to a polyacrylamide gel electrophoresis. After the protein was transferred from gel to a PVDF membrane, aiming at an OTOF N-terminal antibody (A20266, abclonal) or a C-terminal antibody (PA5-52935, Invitrogen), the protein was incubated at a normal temperature for 2 h and incubated with the corresponding HRP coupled secondary antibody for 1 h. An ECL reagent was added for imaging. The results were as shown in
Example 11 Comparison of OTOF Intein Recombination and OTOF DNA Recombination
[0165] The viruses packaged in example 5 were added into 400 μL of a serum-free DMEM medium (shown in Table 8) in pairs, the materials were mixed evenly, the mixture was added into HEK-293T cells in a 6-well plate (about 1×10.sup.6 cells and the culture medium was absorbed before the viruses were added), and after the cells were incubated for 4 h, 1.6 mL of DMEM medium containing 10% fetal bovine serum was added. After the cells were cultured for two days, a cell culture medium was absorbed, 200 μL of a cell lysis buffer (1% triton-X 100, 50 mM of Tris-Hcl, and 1 mM of PMSF, pH=7.4) was added, the cells were placed on ice for 10 min, a cell lysate was collected and centrifuged at 12,000 g and 4° C. for 10 min, and a supernatant was kept. ¼ volume of a 5× loading buffer (0.25 M of Tris HCl, 10% SDS, 0.05% bromophenol blue, 50% glycerin, and 0.25 M DTT) was added into the supernatant and the mixture was heated at 90° C. for 10 min to obtain a protein sample. 50 μL of the protein sample was subjected to a polyacrylamide gel electrophoresis. After the protein was transferred from gel to a PVDF membrane, aiming at an OTOF antibody (article No. A20266, abclonal), the protein was incubated after diluted at a ratio of 1:3,000 and with the corresponding HRP coupled secondary antibody for 1 h. An ECL reagent was added for imaging. The experiment was repeated for three times. Grey statistics for full-length bands were performed. The results were shown in
TABLE-US-00008 TABLE 8 Protein and nucleic acid recombination system Number Adeno-associated viruses Viral load 1 pAAV-CMV-OTOF-N-S1-Rma-N-intein 1 × 10.sup.11 virus genomes pAAV-CMV-Rma-C-intein-OTOF-C-S1 1 × 10.sup.11 virus genomes 2 pAAV-CMV-OTOF-N-S2-Rma-N-intein 1 × 10.sup.11 virus genomes pAAV-CMV-Rma-C-intein-OTOF-C-S2 1 × 10.sup.11 virus genomes 3 pAAV-CMV-OTOF-N-S3-Rma-N-intein 1 × 10.sup.11 virus genomes pAAV-CMV-Rma-C-intein-OTOF-C-S3 1 × 10.sup.11 virus genomes 4 pAAV-CMV-OTOF-N-S4-Rma-N-intein 1 × 10.sup.11 virus genomes pAAV-CMV-Rma-C-intein-OTOF-C-S4 1 × 10.sup.11 virus genomes 5 pAAV-CMV-OTOF-N-AK 1 × 10.sup.11 virus genomes pAAV-AK-OTOF-C-PloyA 1 × 10.sup.11 virus genomes 6 pAAV-CMV-OTOF-N-AP 1 × 10.sup.11 virus genomes pAAV-AP-OTOF-C-PloyA 1 × 10.sup.11 virus genomes 7 pAAV-CMV-OTOF-N-TS 1 × 10.sup.11 virus genomes pAAV-TS-OTOF-C-PloyA 1 × 10.sup.11 virus genomes
Example 12 Construction of Otof Gene-Deficient Mice
[0166] Otof.sup.−/− gene mutant mice were constructed on the basis of 12952/SvPasCrl strain mice by a CRISPR/Cas9 method. Otof.sup.−/− model mice carrying a homozygous mutation with an OTOF gene frameshift caused by an Otof gene NM_001100395.1:c.2503_2504insA. The results were shown in
Example 13 Unilateral Ear Administration and Effect of S1 Intein in Infant Mice
[0167] A pAAV-CMV-OTOF-N-S1-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S1 plasmid were respectively along with a pHelper plasmid and a pRC plasmid of PHP.eB at a molar ratio of 1:1:1 were co-transfected into HEK-293T cells with a PEI transfection reagent (1 μg of the plasmids were added into about every million cells), the cells were cultured by using a DMEM medium containing 10% fetal bovine serum at a 5% carbon dioxide incubator at 37° C. for 3 days, washed once with a PBS buffer, collected, and repeatedly frozen and thawed for five times, a solid NaCl was added to make a final concentration 500 mM, the cells were centrifuged at 10,000 g for half an hour, the obtained supernatant was taken and filtered with a 0.45-μm filter membrane, a gradient iodixanol solution was prepared and added into a centrifuge tube (5 mL of 60% iodixanol, 5 mL of 40% iodixanol, 6 mL of 25% iodixanol, and 8 mL of 15% iodixanol), the sample was added to an uppermost layer and centrifuged at 350,000 g for 1 h, and a virus layer of 40% and 60% of an interface was sucked. The viruses were centrifuged with a 50 Kda ultrafiltration tube at 10,000 g and treated with a 0.01% poloxamer PBS buffer for 5 times, after a virus titer was measured by using a qPCR method, the tilter was adjusted, finally the viruses with the virus titer of 1±0.2×10.sup.13 virus genomes/ml, namely pAAV-CMV-OTOF-N-S1-Rma-N-intein PHP. eB AAV and pAAV-CMV-Rma-C-intein-OTOF-C-S1 PHP. eB AAV were obtained, and the solvent is the 0.01% poloxamer PBS buffer.
[0168] The above constructed adeno-associated viruses were administered to the P0/P1 Otof.sup.−/− gene mutant mice constructed in example 12, specifically, the right cochlea was injected through the round window, and each mouse was administrated with 2×10.sup.10 virus genomes each time (1×10.sup.10 virus genomes of the two AAVs respectively), and an ABR index of the mice was detected to confirm the hearing recovery of the mice. The results after one month were shown in
Example 14 Unilateral Ear Administration and Effect of S2 Intein in Infant Mice
[0169] A pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid were respectively along with a pHelper plasmid and a pRC plasmid of PHP.eB at a molar ratio of 1:1:1 were co-transfected into HEK-293T cells with a PEI transfection reagent (1 μg of the plasmids were added into about every million cells), the cells were cultured by using a DMEM medium containing 10% fetal bovine serum at a 5% carbon dioxide incubator at 37° C. for 3 days, washed once with a PBS buffer, collected, and repeatedly frozen and thawed for five times, a solid NaCl was added to make a final concentration 500 mM, the cells were centrifuged at 10,000 g for half an hour, the obtained supernatant was taken and filtered with a 0.45-μm filter membrane, a gradient iodixanol solution was prepared and added into a centrifuge tube (5 mL of 60% iodixanol, 5 mL of 40% iodixanol, 6 mL of 25% iodixanol, and 8 mL of 15% iodixanol), the sample was added to an uppermost layer and centrifuged at 350,000 g for 1 h, and a virus layer of 40% and 60% of an interface was sucked. The viruses were centrifuged with a 50 Kda ultrafiltration tube at 10,000 g and treated with a 0.01% poloxamer PBS buffer for 5 times, after a virus titer was measured by using a qPCR method, the tilter was adjusted, finally the adeno-associated viruses with the virus titer of 1±0.2×10.sup.13 virus genomes/ml and an empty shell rate of about 50%, namely pAAV-CMV-OTOF-N-S2-Rma-N-intein PHP.eB AAV and pAAV-CMV-Rma-C-intein-OTOF-C-S2 PHP.eB AAV were obtained, and the solvent is the 0.01% poloxamer PBS buffer.
[0170] The above constructed adeno-associated viruses were administered to the P0/P1 Otof.sup.−/− gene mutant mice constructed in example 12, specifically, the right cochlea was injected through the round window, and each mouse was administrated with 2×10.sup.10 virus genomes (1×10.sup.10 virus genomes of the two AAVs respectively), and an ABR index of the mice was detected to confirm the hearing recovery of the mice. The results after one month were shown in
Example 15 Safety Observation of Administration Group
[0171] After the cochlea of 6-8-week-old wild-type CD-1 mice was injected with the AAVs constructed in examples 13 and 14 of the present disclosure through the round window, the daily activities, hair smoothness and food intake of the mice were observed within 3 months. No significant differences in the daily activities, hair smoothness and food intake were found between an administration group and a control group without AAV injection. Besides, no difference was found in hearing between the administration group and the control group. The cochlea of the mice on the 28th and 91st was dissected and inner ear hair cells were subjected to immunofluorescence staining. There was no significant difference in the number of hair cells between the administration group and the control group.
Example 16 Unilateral Ear Administration and Effect of Low-Dose Drug
[0172] A pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid were respectively along with a pHelper plasmid and a pRC plasmid of PHP.eB at a molar ratio of 1:1:1 were co-transfected into HEK-293T cells with a PEI transfection reagent (1 μg of the plasmids were added into about every million cells), the cells were cultured by using a DMEM medium containing 10% fetal bovine serum at a 5% carbon dioxide incubator at 37° C. for 3 days, washed once with a PBS buffer, collected, and repeatedly frozen and thawed for five times, a solid NaCl was added to make a final concentration 500 mM, the cells were centrifuged at 10,000 g for half an hour, the obtained supernatant was taken and filtered with a 0.45-μm filter membrane, a gradient iodixanol solution was prepared and added into a centrifuge tube (5 mL of 60% iodixanol, 5 mL of 40% iodixanol, 6 mL of 25% iodixanol, and 8 mL of 15% iodixanol), the sample was added to an uppermost layer and centrifuged at 350,000 g for 1 h, and a virus layer of 40% and 60% of an interface was sucked. The viruses were centrifuged with a 50 Kda ultrafiltration tube at 10,000 g and treated with a 0.01% poloxamer PBS buffer for 5 times, after a virus titer was measured by using a qPCR method, the tilter was adjusted, and finally the viruses with the virus titer of 1±0.2×10.sup.13 virus genomes/ml, namely pAAV-CMV-OTOF-N-S2-Rma-N-intein PIP.eB AAV and pAAV-CMV-Rma-C-intein-OTOF-C-S2 PHP.eB AAV were obtained. The solvent is the 0.01% poloxamer PBS buffer.
[0173] The above constructed adeno-associated viruses were administered to the Otof.sup.−/− gene mutant mice constructed in example 12, specifically, the right cochlea was injected through the round window, and each mouse was administrated with 5×10.sup.9 virus genomes each time (2.5×10.sup.9 virus genomes of the two AAVs respectively), and an ABR index of the mice was detected to confirm the hearing recovery of the mice. The results after one month were shown in
Example 17 In-Vivo Protein Immunofluorescence Assay after Administration
[0174] The mice 1 month after administration in example 14 were sacrificed, and the cochlear tissue was peeled off and soaked overnight with 4% paraformaldehyde at 4° C. and decalcified with a 10% EDTA solution for three days. Before staining, the tissue was incubated with a 0.3% Triton X-100 PBS buffer for 10 min and blocked with 10% donkey blood for one hour at a room temperature. The tissue was incubated with anti-OTOF antibodies PA5-52935 (C-terminal) or ab53233 (N-terminal) overnight at 4° C. and washed three times with 0.1% Triton X-100 PBS for 10 min each time. After the tissue was incubated with a corresponding fluorescent secondary antibody and DAPI for 1 hour, the tissue was washed three times with 0.1% Triton X-100 PBS for 10 min each time. Finally, imaging was performed with a confocal fluorescence microscopy. The results were as follows:
[0175]
[0176]
[0177]
Example 18 Unilateral Ear Administration and Effect of Four-Week-Old Mice
[0178] A pAAV-CMV-OTOF-N-S2-Rma-N-intein plasmid and a pAAV-CMV-Rma-C-intein-OTOF-C-S2 plasmid were respectively along with a pHelper plasmid and a pRC plasmid of AAV1 at a molar ratio of 1:1:1 were co-transfected into HEK-293T cells with a PEI transfection reagent (1 μg of the plasmids were added into about every million cells), the cells were cultured by using a DMEM medium containing 10% fetal bovine serum at a 5% carbon dioxide incubator at 37° C. for 3 days, washed once with a PBS buffer, collected, and repeatedly frozen and thawed for five times, a solid NaCl was added to make a final concentration 500 mM, the cells were centrifuged at 10,000 g for half an hour, the obtained supernatant was taken and filtered with a 0.45-μm filter membrane, a gradient iodixanol solution was prepared and added into a centrifuge tube (5 mL of 60% iodixanol, 5 mL of 40% iodixanol, 6 mL of 25% iodixanol, and 8 mL of 15% iodixanol), the sample was added to an uppermost layer and centrifuged at 350,000 g for 1 h, and a virus layer of 40% and 60% of an interface was sucked. The viruses were centrifuged with a 50 Kda ultrafiltration tube at 10,000 g and treated with a 0.01% poloxamer PBS buffer for 5 times, after a virus titer was measured by using a qPCR method, the tilter was adjusted, finally the adeno-associated viruses with the virus titer of 1±0.2×10.sup.13 virus genomes/ml and an empty shell rate of about 50%, namely pAAV-CMV-OTOF-N-S2-Rma-N-intein AAV1 and pAAV-CMV-Rma-C-intein-OTOF-C-S2 AAV1 were obtained, and the solvent is the 0.01% poloxamer PBS buffer.
[0179] The above constructed adeno-associated viruses were administered to the Otof, gene mutant mice (four week old) constructed in example 12, specifically, the right cochlea was injected through the semicircular canal, and each mouse was administrated with 2×10.sup.10 virus genomes (1×10.sup.10 virus genomes of the two AAVs respectively), and an ABR index of the mice was detected to confirm the hearing recovery of the mice. The results after one month were shown in
[0180] The above examples are merely illustrative of several implementations of the present disclosure, and the description thereof is more specific and detailed. However, these examples may not to be construed as a limitation to the scope of the patent. It should be noted that those of ordinary skill in the art can further make several variations, combinations and improvements without departing from the conception of the present disclosure. These variations, combinations and improvements all fall within the protection scope of the patent. Therefore, the protection scope of the patent shall be in accordance with the claims.