Biosynthetic production of steviol glycoside rebaudioside D4 from rebaudioside E

11306340 · 2022-04-19

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates, in some aspects, to the production of steviol glycoside rebaudioside D4 through the use of rebaudioside E. In some aspects, the invention relates to mutant CP1 enzymes, mutant HV1 enzymes as well as host cells and methods utilizing such enzymes, such as to produce rebaudioside D4.

Claims

1. A method of producing rebaudioside D4, the method comprising incubating a substrate with a recombinant polypeptide comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 7 or SEQ ID NO: 9, wherein the substrate comprises Reb E, stevioside, or combinations thereof.

2. The method of claim 1, further comprising incubating a recombinant sucrose synthase with the substrate and the recombinant polypeptide.

3. The method of claim 1, wherein the recombinant polypeptide comprises an amino acid sequence having at least 95% identity to SEQ ID NO: 7.

4. The method of claim 3, wherein the recombinant polypeptide comprises the amino acid sequence of SEQ ID NO: 7.

5. The method of claim 1, wherein the recombinant polypeptide comprises an amino acid sequence having at least 95% identity to SEQ ID NO: 9.

6. The method of claim 5, wherein the recombinant polypeptide comprises the amino acid sequence of SEQ ID NO: 9.

7. The method of claim 1, wherein the substrate further comprises sucrose, uridine diphosphate (UDP), uridine diphosphate glucose (UDP-glucose), or combinations thereof.

8. The method of claim 1, further comprising incubating an HV1 enzyme with the substrate and the recombinant polypeptide.

9. The method of claim 2, wherein the sucrose synthase is selected from the group consisting of an Arabidopsis sucrose synthase 1, an Arabidopsis sucrose synthase 3 and a Vigna radiate sucrose synthase.

10. The method of claim 9, wherein the sucrose synthase is an Arabidopsis thaliana sucrose synthase 1.

11. The method of claim 1, wherein the Reb D4 produced is greater than 70% pure.

12. A method for synthesizing rebaudioside D4 from rebaudioside E, the method comprising: preparing a reaction mixture comprising rebaudioside E, a substrate selected from the group consisting of sucrose, uridine diphosphate (UDP) and uridine diphosphate glucose (UDP-glucose), and C1m2, and incubating the reaction mixture for a sufficient time to produce rebaudioside D4, wherein a glucose is covalently coupled to the rebaudioside E to produce rebaudioside D4.

13. The method of claim 12 further comprising adding a HV1 enzyme to the reaction mixture.

14. A method for synthesizing rebaudioside D4 from rebaudioside E, the method comprising: preparing a reaction mixture comprising rebaudioside E, a substrate selected from the group consisting of sucrose, uridine diphosphate (UDP) and uridine diphosphate glucose (UDP-glucose), and C1m3, and incubating the reaction mixture for a sufficient time to produce rebaudioside D4, wherein a glucose is covalently coupled to the rebaudioside E to produce rebaudioside D4.

15. The method of claim 14 further comprising adding a HV1 enzyme to the reaction mixture.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1. Shows a Steviol glycoside Biosynthetic Pathway of the production of Reb D4 from Reb E.

(2) FIG. 2. Shows In vitro production of Reb D4 from Reb E catalyzed by C1m2 and C1m3 enzyme. A: shows the standard of rebaudioside E (“Reb E”). B: shows the standards of rebaudioside D4 (“Reb D4”). Reb D4 enzymatically produced by C1m2 (C) and C1m3 (D) at 16 hr.

(3) FIG. 3. Shows the LC-MS Analysis of the produced compound by C1m2 mutant.

(4) FIG. 4. Shows the LC-MS Analysis of the produced compound by C1m3 mutant.

(5) FIG. 5. Shows the Hydrolysis of Reb D4, Reb E and Reb D by GXT6 beta-glucosidase. Hydrolysis of Reb D4, Reb E and Reb D by GXT6 beta-glucosidase at 16 hr. A: shows the standards of rebaudioside D (“Reb D”), rebaudioside M (“Reb M”) and rebaudioside A (“Reb A”). B: shows the standards of rebaudioside E (“Reb E”), rebaudioside KA(“KA”), Stevioside (“ST”) and rubusoside (“Rub”). C: shows the standard of rebaudioside D4 (“Reb D4”) and Reb WB2 (“WB2”) D: shows the standards of rebaudioside WB1 (“WB1”) and Reb WB2 (“WB2”). E: shows hydrolysis of Reb E. F: hydrolysis of D4. G: shows hydrolysis of Reb D.

(6) FIG. 6. Shows the Hydrolysis of the produced compound to confirm the bioconversion of Reb E to Reb D4 by C1m2 and C1m3 mutant. A: shows the standards of rebaudioside D (“Reb D”), rebaudioside M (“Reb M”) and rebaudioside A (“Reb A”). B: shows the standards of rebaudioside E (“Reb E”), rebaudioside KA(“KA”), Stevioside (“ST”) and rubusoside (“Rub”). C: shows the standard of rebaudioside D4 (“Reb D4”) and Reb WB2 (“WB2”) D: shows the standards of rebaudioside WB1 (“WB1”) and Reb WB2 (“WB2”). Bioconversion of Reb E by C1m2 (E) and C1m3 (F) at 16 hr. Hydrolysis of produced compounds by GXT6 at 16 hr. G: shows hydrolysis of produced compounds in C1m2 reaction, H: shows hydrolysis of produced compound in C1m3 reaction.

(7) FIG. 7. Shows in vitro production of Reb D4 from stevioside by combination of Hv1 and C1m2 or C1m3 enzyme. A: shows the standards of rebaudioside D (“Reb D”), rebaudioside M (“Reb M”) and rebaudioside A (“Reb A”). B: shows the standards of rebaudioside E (“Reb E”) and stevioside (“ST”). C: shows the standard of rebaudioside D4 (“Reb D4”). Reb D4 was produced by combination of HV1 with C1m2 (D) or C1m3(E) at 16 hr.

(8) FIG. 8. Shows the LC-MS Analysis of the produced Reb D4 by combination of HV1 with C1m2 (A) or C1m3 (B).

(9) FIG. 9. Shows a Biosynthetic Pathway of Reb M from stevioside.

(10) FIG. 10. Shows the structure of the steviol glycoside WB1.

DETAILED DESCRIPTION OF THE INVENTION

(11) Explanation of Terms Used Herein:

(12) Steviol Glycosides are a class of chemical compounds responsible for the sweet taste of the leaves of the South American plant Stevia rebaudiana (Asteraceae), and can be used as sweeteners in food, feed and beverages.

(13) Definitions:

(14) Cellular system is any cells that provide for the expression of ectopic proteins. It includes bacteria, yeast, plant cells and animal cells. It includes both prokaryotic and eukaryotic cells. It also includes the in vitro expression of proteins based on cellular components, such as ribosomes.

(15) Coding sequence is to be given its ordinary and customary meaning to a person of ordinary skill in the art, and is used without limitation to refer to a DNA sequence that encodes for a specific amino acid sequence.

(16) Growing the Cellular System. Growing includes providing an appropriate medium that would allow cells to multiply and divide. It also includes providing resources so that cells or cellular components can translate and make recombinant proteins.

(17) Protein Expression. Protein production can occur after gene expression. It consists of the stages after DNA has been transcribed to messenger RNA (mRNA). The mRNA is then translated into polypeptide chains, which are ultimately folded into proteins. DNA is present in the cells through transfection a process of deliberately introducing nucleic acids into cells. The term is often used for non-viral methods in eukaryotic cells. It may also refer to other methods and cell types, although other terms are preferred: “transformation” is more often used to describe non-viral DNA transfer in bacteria, non-animal eukaryotic cells, including plant cells. In animal cells, transfection is the preferred term as transformation is also used to refer to progression to a cancerous state (carcinogenesis) in these cells. Transduction is often used to describe virus-mediated DNA transfer. Transformation, transduction, and viral infection are included under the definition of transfection for this application.

(18) Yeast. According to the current disclosure, a yeast is a eukaryotic, single-celled microorganism classified as a member of the fungus kingdom. Yeasts are unicellular organisms which evolved from multicellular ancestors but with some species useful for the current disclosure being those that have the ability to develop multicellular characteristics by forming strings of connected budding cells known as pseudohyphae or false hyphae.

(19) The names of the UGT enzymes used in the present disclosure are consistent with the nomenclature system adopted by the UGT Nomenclature Committee (Mackenzie et al., “The UDP glycosyltransferase gene super family: recommended nomenclature updated based on evolutionary divergence,” PHARMACOGENETICS, 1997, vol. 7, pp. 255-269), which classifies the UGT genes by the combination of a family number, a letter denoting a subfamily, and a number for an individual gene. For example, the name “UGT76G1” refers to a UGT enzyme encoded by a gene belonging to UGT family number 76 (which is of plant origin), subfamily G, and gene number 1.

(20) Structural Terms:

(21) As used herein, the singular forms “a, an” and “the” include plural references unless the content clearly dictates otherwise.

(22) To the extent that the term “include,” “have,” or the like is used in e description or the claims, such term is intended to be inclusive in a manner similar to the term “comprise” as “comprise” is interpreted when employed as a transitional word in a claim.

(23) The word “exemplary” is used herein to mean “serving as an example, instance, or illustration”. Any embodiment described herein as “exemplary” is not necessarily to be construed as preferred or advantageous over other embodiments.

(24) The term “complementary” is to be given its ordinary and customary meaning to a person of ordinary skill in the art, and is used without limitation to describe the relationship between nucleotide bases that are capable to hybridizing to one another. For example, with respect to DNA, adenosine is complementary to thymine and cytosine is complementary to guanine. Accordingly, the subjection technology also includes isolated nucleic acid fragments that are complementary to the complete sequences as reported in the accompanying Sequence Listing as well as those substantially similar nucleic acid sequences

(25) The terms “nucleic acid” and “nucleotide” are to be given their respective ordinary and customary meanings to a person of ordinary skill in the art, and are used without limitation to refer to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally-occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified or degenerate variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.

(26) The term “isolated” is to be given its ordinary and customary meaning to a person of ordinary skill in the art, and when used in the context of an isolated nucleic acid or an isolated polypeptide, is used without limitation to refer to a nucleic acid or polypeptide that, by the hand of man, exists apart from its native environment and is therefore not a product of nature. An isolated nucleic acid or polypeptide can exist in a purified form or can exist in a non-native environment such as, for example, in a transgenic host cell.

(27) The terms “incubating” and “incubation” as used herein means a process of mixing two or more chemical or biological entities (such as a chemical compound and an enzyme) and allowing them to interact under conditions favorable for producing a steviol glycoside composition.

(28) The term “degenerate variant” refers to a nucleic acid sequence having a residue sequence that differs from a reference nucleic acid sequence by one or more degenerate codon substitutions. Degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed base and/or deoxy inosine residues. A nucleic acid sequence and all of its degenerate variants will express the same amino acid or polypeptide.

(29) The terms “polypeptide,” “protein,” and “peptide” are to be given their respective ordinary and customary meanings to a person of ordinary skill in the art; the three terms are sometimes used interchangeably, and are used without limitation to refer to a polymer of amino acids, or amino acid analogs, regardless of its size or function. Although “protein” is often used in reference to relatively large polypeptides, and “peptide” is often used in reference to small polypeptides, usage of these terms in the art overlaps and varies. The term “polypeptide” as used herein refers to peptides, polypeptides, and proteins, unless otherwise noted. The terms “protein,” “polypeptide,” and “peptide” are used interchangeably herein when referring to a polynucleotide product. Thus, exemplary polypeptides include polynucleotide products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing.

(30) The terms “polypeptide fragment” and “fragment,” when used in reference to a reference polypeptide, are to be given their ordinary and customary meanings to a person of ordinary skill in the art, and are used without limitation to refer to a polypeptide in which amino acid residues are deleted as compared to the reference polypeptide itself, but where the remaining amino acid sequence is usually identical to the corresponding positions in the reference polypeptide. Such deletions can occur at the amino-terminus or carboxy-terminus of the reference polypeptide, or alternatively both.

(31) The term “functional fragment” of a polypeptide or protein refers to a peptide fragment that is a portion of the full length polypeptide or protein, and has substantially the same biological activity, or carries out substantially the same function as the full length polypeptide or protein (e.g., carrying out the same enzymatic reaction).

(32) The terms “variant polypeptide,” “modified amino acid sequence” or “modified polypeptide,” which are used interchangeably, refer to an amino acid sequence that is different from the reference polypeptide by one or more amino acids, e.g., by one or more amino acid substitutions, deletions, and/or additions. In an aspect, a variant is a “functional variant” which retains some or all of the ability of the reference polypeptide.

(33) The term “functional variant” further includes conservatively substituted variants. The term “conservatively substituted variant” refers to a peptide having an amino acid sequence that differs from a reference peptide by one or more conservative amino acid substitutions, and maintains some or all of the activity of the reference, peptide. A “conservative amino acid substitution” is a substitution of an amino acid residue with a functionally similar residue. Examples of conservative substitutions include the substitution of one non-polar (hydrophobic) residue such as isoleucine, valine, leucine or methionine for another; the substitution of one charged or polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, between threonine and serine; the substitution of one basic residue such as lysine or arginine for another; or the substitution of one acidic residue, such as aspartic acid or glutamic acid for another; or the substitution of one aromatic residue, such as phenylalanine, tyrosine, or tryptophan for another. Such substitutions are expected to have little or no effect on the apparent molecular weight or isoelectric point of the protein or polypeptide. The phrase “conservatively substituted variant” also includes peptides wherein a residue is replaced with a chemically-derivatized residue, provided that the resulting peptide maintains some or all of the activity of the reference peptide as described herein.

(34) The term “variant,” in connection with the polypeptides of the subject technology, further includes a functionally active polypeptide having an amino acid sequence at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, and even 100% identical to the amino acid sequence of a reference polypeptide.

(35) The term “homologous” in all its grammatical forms and spelling variations refers to the relationship between polynucleotides or polypeptides that possess a “common evolutionary origin,” including polynucleotides or polypeptides from super families and homologous polynucleotides or proteins from different species (Reeck et al., CELL 50:667, 1987). Such polynucleotides or polypeptides have sequence homology, as reflected by their sequence similarity, whether in terms of percent identity or the presence of specific amino acids or motifs at conserved positions. For example, two homologous polypeptides can have amino acid sequences that are at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 900 at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, and even 100% identical.

(36) “Suitable regulatory sequences” is to be given its ordinary and customary meaning to a person of ordinary skill in the art, and is used without limitation to refer to nucleotide sequences located upstream (5′ non-coding sequences), within, or downstream (3′ non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences may include promoters, translation leader sequences, introns, and polyadenylation recognition sequences.

(37) “Promoter” is to be given its ordinary and customary meaning to a person of ordinary skill in the art, and is used without limitation to refer to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA. In general, a coding sequence is located 3′ to a promoter sequence. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even comprise synthetic DNA segments. It is understood by those skilled in the art that different promoters may direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental conditions. Promoters, which cause a gene to be expressed in most cell types at most times, are commonly referred to as “constitutive promoters”. It is further recognized that since in most cases the exact boundaries of regulatory sequences have not been completely defined, DNA fragments of different lengths may have identical promoter activity.

(38) The term “operably linked” refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other. For example, a promoter is operably linked with a coding sequence when it can affect the expression of that coding sequence (i.e., that the coding sequence is under the transcriptional control of the promoter). Coding sequences can be operably linked to regulatory sequences in sense or antisense orientation.

(39) The term “expression” as used herein, is to be given its ordinary and customary meaning to a person of ordinary skill in the art, and is used without limitation to refer to the transcription and stable accumulation of sense (mRNA) or antisense RNA derived from the nucleic acid fragment of the subject technology. “Over-expression” refers to the production of a gene product in transgenic or recombinant organisms that exceeds levels of production in normal or non-transformed organisms.

(40) “Transformation” is to be given its ordinary and customary meaning to a person of reasonable skill in the craft, and is used without limitation to refer to the transfer of a polynucleotide into a target cell. The transferred polynucleotide can be incorporated into the genome or chromosomal DNA of a target cell, resulting in genetically stable inheritance, or it can replicate independent of the host chromosomal. Host organisms containing the transformed nucleic acid fragments are referred to as “transgenic” or “transformed”.

(41) The terms “transformed,” “transgenic,” and “recombinant,” when used herein in connection with host cells, are to be given their respective ordinary and customary meanings to a person of ordinary skill in the art, and are used without limitation to refer to a cell of a host organism, such as a plant or microbial cell, into which a heterologous nucleic acid molecule has been introduced. The nucleic acid molecule can be stably integrated into the genome of the host cell, or the nucleic acid molecule can be present as an extrachromosomal molecule. Such an extrachromosomal molecule can be auto-replicating. Transformed cells, tissues, or subjects are understood to encompass not only the end product of a transformation process, but also transgenic progeny thereof.

(42) The terms “recombinant,” “heterologous,” and “exogenous,” when used herein in connection with polynucleotides, are to be given their ordinary and customary meanings to a person of ordinary skill in the art, and are used without limitation to refer to a polynucleotide (e.g., a DNA sequence or a gene) that originates from a source foreign to the particular host cell or, if from the same source, is modified from its original form. Thus, a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell but has been modified through, for example, the use of site-directed mutagenesis or other recombinant techniques. The terms also include non-naturally occurring multiple copies of a naturally occurring DNA sequence. Thus, the terms refer to a DNA segment that is foreign or heterologous to the cell, or homologous to the cell but in a position or form within the host cell in which the element is not ordinarily found.

(43) Similarly, the terms “recombinant,” “heterologous,” and “exogenous,” when used herein in connection with a polypeptide or amino acid sequence, means a polypeptide or amino acid sequence that originates from a source foreign to the particular host cell or, if from the same source, is modified from its original form. Thus, recombinant DNA segments can be expressed in a host cell to produce a recombinant polypeptide.

(44) The terms “plasmid,” “vector,” and “cassette” are to be given their respective ordinary and customary meanings to a person of ordinary skill in the art, and are used without limitation to refer to an extra chromosomal element often carrying genes which are not part of the central metabolism of the cell, and usually in the form of circular double-stranded DNA molecules. Such elements may be autonomously replicating sequences, genome integrating sequences, phage or nucleotide sequences, linear or circular, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a promoter fragment and DNA sequence for a selected gene product along with appropriate 3′ untranslated sequence into a cell. “Transformation cassette” refers to a specific vector containing a foreign gene and having elements in addition to the foreign gene that facilitate transformation of a particular host cell. “Expression cassette” refers to a specific vector containing a foreign gene and having elements in addition to the foreign gene that allow for enhanced expression of that gene in a foreign host.

(45) The present disclosure relates, in part, to the use of Reb E in the production of Reb D4. From a biological perspective, all steviol glycosides are formed by a series of glycosylation reactions of steviol, which typically are catalyzed by UDP-glycosyltransferase (UGT) enzymes using uridine 5′-diphosphoglucose (UDP-glucose) as a donor of the sugar moiety. In plants, UGTs are a very divergent group of enzymes that can transfer a glucose residue from UDP-glucose to steviol. In these reactions stevioside is often an intermediate in the biosynthesis of various rebaudioside compounds. For example, glycosylation of stevioside at the C-3′ at the C-13-O-glucose of stevioside yields rebaudioside A; while glycosylation at the C-2′ at the 19-0-glucose position of stevioside yields rebaudioside E.

(46) According to the current disclosure, the specific and directed glycosylation of rebaudioside E (at the C-19-O-glucose) can produce rebaudioside Reb D4 from Reb E which can then be further directed towards the glycosylation of Reb D4 by UGT enzymes to produce rebaudioside M. The synthetic steps to produce Reb D4 from Reb E enzymatically have not been previously reported. The first committed step of steviol glycoside biosynthesis pathway involves conversion of ent-kaurenoic acid to steviol by the activity of enzyme KAH. It has been shown that UGT76G1 exhibits multiple glycosylation activities towards steviol bioside forming rebaudioside B, and stevioside resulting in the production of rebaudioside A. In addition, the interaction affinity of KAH, UGT85C2, UGT74G1 and UGT76G1 has been evaluated for ent-kaurenoic acid and steviol. The model predicted for KAH showed highest affinity for the ligand steviol, followed by steviol-monoside and ent-kaurenoic acid. The docking results for the three-dimensional model of UGT76G1 suggested its highest binding affinity for ent-kaurenoic acid but also suggest that these enzymes have the ability to interact with more than one of the ligands in the steviol glycoside biosynthesis pathway. According to the current disclosure, mutations in the domains in UGT76G1 can cause specific alteration of glycosylation activity leading to the production of alternate rebaudiosides.

(47) According to the current disclosure, a practical approach to improve the taste quality of stevia extracts is to increase the yield of those rebaudioside compounds that have more desirable taste characteristics in general and to do this via a more productive synthetic pathway. Of those steviol glycosides tested many believe that Reb M has the most desirable taste and chemical characteristics for use in a variety of food and beverages. As stated above, however, the plant has vanishingly small amounts of this compound present in its leaves and therefore an alternative biosynthetic process needs to be developed to enable the large-scale production of this glycoside as well as to provide alternate sweeteners to the food and beverage industry. Part of this pathway is provided herein.

(48) Accordingly, there is a need for steviol glycosides with better and more consistent taste profiles to be developed as commercial products and for such steviol glycosides to utilize a relative common starting substrate, such as more abundant steviol glycosides as starting molecules, so that such production of desirable glycosides can be commercially as cost effective as possible. The present disclosure provides a method of producing rebaudioside D4 from stevioside through rebaudioside E.

(49) Going further, the extraction process from plants, typically employs solid-liquid extraction techniques using solvents like hexane, chloroform, and ethanol for steviol glycoside recovery (Catchpole et al., 2003). However, solvent extraction is itself energy intensive, leads to problems of toxic waste disposal, requires extensive acreage for the plants themselves to be grown and yields a product that requires further purification for minor constituents to be recovered. Thus, new production methods are also needed to reduce costs of steviol glycoside production and lessen the environmental impact of large scale cultivation and processing (Yao et al., 1994). One such potential solution is the use of fermentation bio-conversion technology that allows the production in certain microbial species that increases the selectivity, abundance and purity of desired steviol glycosides available for commerce.

(50) In addition to the above, while consumers approve and actively seek natural and biological sources for food, feed, flavor or medicinal components they are also concerned about sourcing, consistent taste profile and environmentally sustainable production. Into this situation, the microbial fermentation and production methods of the current disclosure provide Reb D4 in quantities useful for a variety of industries and research while doing so in a more natural fashion than inorganic synthesis or current plant extraction techniques.

(51) Accordingly, a need exists for the development of a novel method of producing Reb D4 economically and conveniently to further enable human and animal consumption. Specifically, the current disclosure provides methods to use Reb E to produce Reb D4 via engineered microorganisms.

(52) The present disclosure relates to the production of a steviol glycoside of interest, Reb D4 from Reb E using UGT enzymes to allow that conversion. The subject technology provides recombinant polypeptides with UDP glycosyltransferase activities, such as 1,3-19-O-glucose glycosylation activity and 1,3-13-O-glucose glycosylation activity for synthesizing steviol glycosides. The recombinant polypeptide of the subject technology is useful for the biosynthesis of steviol glycoside compounds. In the present disclosure, UDP-glycosyltransferase (UGT) refers to an enzyme that transfers a sugar residue from an activated donor molecule (typically UDP-glucose) to an acceptor molecule. The 1,3-19-O-glucose glycosylation activity refers to an enzymatic activity that transfers a sugar moiety to the C-3′ of the 19-O glucose moiety of rebaudioside E to produce rebaudioside D4 (Reb D4) (FIG. 1).

(53) Synthetic Biology

(54) Standard recombinant DNA and molecular cloning techniques used here are well known in the art and are described, for example, by Sambrook, J., Fritsch, E. F. and Maniatis, T. MOLECULAR CLONING: A LABORATORY MANUAL, 2nd ed.; Cold Spring Harbor Laboratory: Cold Spring Harbor, N. Y., 1989 (hereinafter “Maniatis”); and by Silhavy. T. J., Bennan, M. L. and Enquist, L. W. EXPERIMENTS WITH GENE FUSIONS; Cold Spring Harbor Laboratory: Cold Spring Harbor, N. Y., 1984; and by Ausubel, F. M. et al., IN CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, published by Greene Publishing and Wiley-Interscience, 1987; (the entirety of each of which is hereby incorporated herein by reference).

(55) Glycosylation is often considered a ubiquitous reaction controlling the bioactivity and storage of plant natural products. Glycosylation of small molecules is catalyzed by a superfamily of transferases in most plant species that have been studied to date. These glycosyltransferases (GTs) have been classified into over 60 families. Of these, the family 1 GT enzymes, also known as the UDP glycosyltransferases (UGTs), transfer UDP-activated sugar moieties to specific acceptor molecules. These are the molecules that transfer such sugar moieties in the steviol glycosides to create various rebaudiosides. Each of these UGTs have their own activity profile and preferred structure locations where they transfer their activated sugar moieties.

(56) Production Systems

(57) Expression of proteins in prokaryotes is most often carried out in a bacterial host cell with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fusion vectors typically serve three purposes: 1) to increase expression of recombinant protein; 2) to increase the solubility of the recombinant protein; and 3) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such vectors are within the scope of the present disclosure.

(58) In an embodiment, the expression vector includes those genetic elements for expression of the recombinant polypeptide in bacterial cells. The elements for transcription and translation in the bacterial cell can include a promoter, a coding region for the protein complex, and a transcriptional terminator.

(59) A person of ordinary skill in the art will be aware of the molecular biology techniques available for the preparation of expression vectors. The polynucleotide used for incorporation into the expression vector of the subject technology, as described above, can be prepared by routine techniques such as polymerase chain reaction (PCR).

(60) Several molecular biology techniques have been developed to operably link DNA to vectors via complementary cohesive termini. In one embodiment, complementary homopolymer tracts can be added to the nucleic acid molecule to be inserted into the vector DNA. The vector and nucleic acid molecule are then joined by hydrogen bonding between the complementary homopolymeric tails to form recombinant DNA molecules.

(61) In an alternative embodiment, synthetic linkers containing one or more restriction sites provide are used to operably link the polynucleotide of the subject technology to the expression vector. In an embodiment, the polynucleotide is generated by restriction endonuclease digestion. In an embodiment, the nucleic acid molecule is treated with bacteriophage T4 DNA polymerase or E. coli DNA polymerase I, enzymes that remove protruding, 3′-single-stranded termini with their 3′-5′-exonucleolytic activities, and fill in recessed 3′-ends with their polymerizing activities, thereby generating blunt ended DNA segments. The blunt-ended segments are then incubated with a large molar excess of linker molecules in the presence of an enzyme that can catalyze the ligation of blunt-ended DNA molecules, such as bacteriophage T4 DNA ligase. Thus, the product of the reaction is a polynucleotide carrying polymeric linker sequences at its ends. These polynucleotides are then cleaved with the appropriate restriction enzyme and ligated to an expression vector that has been cleaved with an enzyme that produces termini compatible with those of the polynucleotide.

(62) Alternatively, a vector having ligation-independent cloning (LIC) sites can be employed. The required PCR amplified polynucleotide can then be cloned into the LIC vector without restriction digest or ligation (Aslanidis and de Jong, NUCL. ACID. RES. 18 6069-74, (1990), Haun, et al, BIOTECHNIQUES 13, 515-18 (1992), which is incorporated herein by reference to the extent it is consistent herewith).

(63) In an embodiment, to isolate and/or modify the polynucleotide of interest for insertion into the chosen plasmid, it is suitable to use PCR. Appropriate primers for use in PCR preparation of the sequence can be designed to isolate the required coding region of the nucleic acid molecule, add restriction endonuclease or LIC sites, place the coding region in the desired reading frame.

(64) In an embodiment, a polynucleotide for incorporation into an expression vector of the subject technology is prepared using PCR using appropriate oligonucleotide primers. The coding region is amplified, whilst the primers themselves become incorporated into the amplified sequence product. In an embodiment, the amplification primers contain restriction endonuclease recognition sites, which allow the amplified sequence product to be cloned into an appropriate vector.

(65) The expression vectors can be introduced into plant or microbial host cells by conventional transformation or transfection techniques. Transformation of appropriate cells with an expression vector of the subject technology is accomplished by methods known in the art and typically depends on both the type of vector and cell. Suitable techniques include calcium phosphate or calcium chloride co-precipitation, DEAE-dextran mediated transfection, lipofection, chemoporation or electroporation.

(66) Successfully transformed cells, that is, those cells containing the expression vector, can be identified by techniques well known in the art. For example, cells transfected with an expression vector of the subject technology can be cultured to produce polypeptides described herein. Cells can be examined for the presence of the expression vector DNA by techniques well known in the art.

(67) The host cells can contain a single copy of the expression vector described previously, or alternatively, multiple copies of the expression vector,

(68) In some embodiments, the transformed cell is an animal cell, an insect cell, a plant cell, an algal cell, a fungal cell, or a yeast cell. In some embodiments, the cell is a plant cell selected from the group consisting of: canola plant cell, a rapeseed plant cell, a palm plant cell, a sunflower plant cell, a cotton plant cell, a corn plant cell, a peanut plant cell, a flax plant cell, a sesame plant cell, a soybean plant cell, and a petunia plant cell.

(69) Microbial host cell expression systems and expression vectors containing regulatory sequences that direct high level expression of foreign proteins are well known to those skilled in the art. Any of these could be used to construct vectors for expression of the recombinant polypeptide of the subjection technology in a microbial host cell. These vectors could then be introduced into appropriate microorganisms via transformation to allow for high level expression of the recombinant polypeptide of the subject technology.

(70) Vectors or cassettes useful for the transformation of suitable microbial host cells are well known in the art. Typically the vector or cassette contains sequences directing transcription and translation of the relevant polynucleotide, a selectable marker, and sequences allowing autonomous replication or chromosomal integration. Suitable vectors comprise a region 5′ of the polynucleotide which harbors transcriptional initiation controls and a region 3′ of the DNA fragment which controls transcriptional termination. It is preferred for both control regions to be derived from genes homologous to the transformed host cell, although it is to be understood that such control regions need not be derived from the genes native to the specific species chosen as a host.

(71) Initiation control regions or promoters, which are useful to drive expression of the recombinant polypeptide in the desired microbial host cell are numerous and familiar to those skilled in the art. Virtually any promoter capable of driving these genes is suitable for the subject technology including but not limited to CYCI, HIS3, GALI, GALIO, ADHI, PGK, PH05, GAPDH, ADCI, TRPI, URA3, LEU2, ENO, TPI (useful for expression in Saccharomyces); AOXI (useful for expression in Pichia); and lac, trp, JPL, IPR, T7, tac, and trc (useful for expression in Escherichia coli).

(72) Termination control regions may also be derived from various genes native to the microbial hosts. A termination site optionally may be included for the microbial hosts described herein.

(73) In plant cells, the expression vectors of the subject technology can include a coding region operably linked to promoters capable of directing expression of the recombinant polypeptide of the subject technology in the desired tissues at the desired stage of development. For reasons of convenience, the polynucleotides to be expressed may comprise promoter sequences and translation leader sequences derived from the same polynucleotide. 3′ non-coding sequences encoding transcription termination signals should also be present. The expression vectors may also comprise one or more introns to facilitate polynucleotide expression.

(74) For plant host cells, any combination of any promoter and any terminator capable of inducing expression of a coding region may be used in the vector sequences of the subject technology. Some suitable examples of promoters and terminators include those from nopaline synthase (nos), octopine synthase (ocs) and cauliflower mosaic virus (CaMV) genes. One type of efficient plant promoter that may be used is a high level plant promoter. Such promoters, in operable linkage with an expression vector of the subject technology should be capable of promoting the expression of the vector. High level plant promoters that may be used in the subject technology include the promoter of the small subunit (ss) of the ribulose-1, 5-bisphosphate carboxylase for example from soybean (Berry-Lowe et al., J. MOLECULAR AND APP. GEN., 1:483 498 (1982), the entirety of which is hereby incorporated herein to the extent it is consistent herewith), and the promoter of the chlorophyll alb binding protein. These two promoters are known to be light-induced in plant cells (see, for example, GENETIC ENGINEERING OF PLANTS, AN AGRICULTURAL PERSPECTIVE, A. Cashmore, Plenum, N. Y. (1983), pages 29 38; Coruzzi, G. et al., The Journal of Biological CHEMISTRY, 258: 1399 (1983), and Dunsmuir, P. et al., JOURNAL OF MOLECULAR AND APPLIED GENETICS, 2:285 (1983), each of which is hereby incorporated herein by reference to the extent they are consistent herewith).

(75) Precursor Synthesis to Reb E

(76) As previously stated steviol glycosides are the chemical compounds responsible for the sweet taste of the leaves of the South American plant Stevia rebaudiana (Asteraceae) and in the plant Rubus chingii (Rosaceae). These compounds are glycosylated diterpenes. Specifically, their molecules can be viewed as a steviol molecule, with its hydroxyl hydrogen atom replaced by a glucose molecule to form an ester, and a hydroxyl hydrogen with combinations of glucose and rhamnose to form an acetal.

(77) One method of making the compounds of interest in the current disclosure is to take common or inexpensive precursors such as steviol or rubososide derived chemically or produced via biosynthesis in engineered microbes such as bacteria and/or yeast and to synthesize targeted steviol glycosides through known or inexpensive methods, such as Reb E.

(78) Aspects of the present disclosure relate to methods involving recombinantly expressing enzymes in a microbial system capable of producing steviol. In general, such enzymes may include: a copalyl diphosphate synthase (CPS), a kaurene synthase (KS) and a geranylgeranyl diphosphate to synthase (GGPPS) enzyme. This should occur in a microbial strain that expresses an endogenous isoprenoid synthesis pathway, such as the non-mevalonate (MEP) pathway or the mevalonic acid pathway (MVA). In some embodiments, the cell is a bacterial cell, including E. coli, or yeast cell such as a Saccharomyces cell, Pichia cell, or a Yarrowia cell. In some embodiments, the cell is an algal cell or a plant cell.

(79) Thereafter, the precursor is recovered from the fermentation culture for use in chemical synthesis. Typically, this is steviol though it can be kaurene, or a steviol glycoside from the cell culture. In some embodiments, the steviol, kaurene and/or steviol glycosides is recovered from the gas phase while in other embodiments, an organic layer or polymeric resin is added to the cell culture, and the kaurene, steviol and/or steviol glycosides is recovered from the organic layer or polymeric resin. In some embodiments, the steviol glycoside is selected from rebaudioside A, rebaudioside B, rebaudioside C, rebaudioside D, rebaudioside E, rebaudioside F or dulcoside A. In some embodiments, the terpenoid produced is steviobioside or stevioside. It should also be appreciated that in some embodiments, at least one enzymatic step, such as one or more glycosylation steps, are performed ex vivo.

(80) Part of the disclosure is the production of the Reb E steviol glycoside that is then subject to further enzymatic conversion to Reb D4. According to the current disclosure, the biosynthesis for the conversion of microbially produced steviol to a desired steviol glycoside (here Reb D4) occurs when the diterpenoid steviol is converted from rubusoside and stevioside using multi-step chemical assembly of sugar moieties into the steviol backbone.

(81) Biosynthesis of Steviol Glycosides

(82) As described herein, the recombinant polypeptides of the present technology have UDP-glycosyltransferase activities and are useful for developing biosynthetic methods for preparing steviol glycosides that are either not present in nature or typically of low abundance in natural sources, such as rebaudioside D4 and rebaudioside M, respectively. The recombinant polypeptides of the present technology have UDP-glycosyltransferase activities, are useful for developing biosynthetic methods for preparing novel steviol glycosides, such as rebaudioside D4 and reaching the synthetic production of rebaudioside M.

(83) The substrate can be any natural or synthetic compound capable of being converted into a steviol glycoside compound in a reaction catalyzed by one or more UDP glycosyltransferases. For example, the substrate can be natural stevia extract, steviol, steviol-13-O-glucoside, steviol-19-O-glucoside, steviol-1, 2-bioside, rubusoside, stevioside, rebaudioside A, rebaudioside G or rebaudioside E. The substrate can be a pure compound or a mixture of different compounds. Preferably, the substrate includes a compound selected from the group consisting of rubusoside, stevioside, steviol, rebaudioside A, rebaudioside F and combinations thereof.

(84) Methods described herein also provide a coupling reaction system in which the recombinant peptides described herein can function in combination with one or more additional enzymes to improve the efficiency or modify the outcome of the overall biosynthesis of steviol glycoside compounds. For example, the additional enzyme may regenerate the UDP-glucose needed for the glycosylation reaction by converting the UDP produced from the glycosylation reaction back to UDP-glucose (using, for example, sucrose as a donor of the glucose residue), thus improving the efficiency of the glycosylation reaction. In some embodiments, the enzyme is a sucrose synthase. In some embodiments, the additional enzyme is Arabidopsis sucrose synthase 1, an Arabidopsis sucrose synthase 3 or a Vigna radiate sucrose synthase. Such enzymes are disclosed, e.g., in U.S. Pat. No. 9,522,929, which is incorporated herein by reference.

(85) In another embodiment, methods of the subject technology further include incubating a recombinant UDP-glycosyltransferase with the recombinant sucrose synthase, the substrate, and the recombinant polypeptide described herein. The recombinant UDP-glycosyltransferase can catalyze a different glycosylation reaction than the one catalyzed by the recombinant polypeptide of the subject technology.

(86) Suitable UDP-glycosyltransferase includes any UGT known in the art or described herein as capable of catalyzing one or more reactions in the biosynthesis of steviol glycoside compounds, such as UGT85C2, UGT74G1, UGT76G1, or the functional homologs thereof.

(87) Typically, in an in vitro method of the subject technology, UDP-Glucose is included in the buffer at a concentration of from about 0.2 mM to about 5 mM, preferably from about 0.5 mM to about 2 mM, more preferably from about 0.7 mM to about 1.5 mM. In an embodiment, when a recombinant sucrose synthase is included in the reaction, sucrose is also included in the buffer at a concentration of from about 100 mM to about 500 mM, preferably from about 200 mM to about 400 mM, more preferably from about 250 mM to about 350 mM.

(88) Typically, in an in vitro method of the subject technology, the weight ratio of the recombinant polypeptide to the substrate, on a dry weight basis, is from about 1:100 to about 1:5, preferably from about 1:50 to about 1:10, more preferably from about 1:25 to about 1:15.

(89) Typically, the reaction temperature of the in vitro method is from about 20° C. to about 40° C., suitably from 25° C. to about 37° C., more suitably from 28° C. to about 32° C.

(90) One with skill in the art will recognize that the steviol glycoside composition produced by the methods described herein can be further purified and mixed with other steviol glycosides, flavors, or sweeteners to obtain a desired flavor or sweetener composition. For example, a composition enriched with rebaudioside M or Reb D4 produced as described herein can be mixed with a natural stevia extract containing rebaudioside A as the predominant steviol glycoside, or with other synthetic or natural steviol glycoside products to make a desired sweetener composition. Alternatively, a substantially purified steviol glycoside (e.g., rebaudioside D4) obtained from the steviol glycoside composition described herein can be combined with other sweeteners, such as sucrose, maltodextrin, aspartame, sucralose, neotame, acesulfame potassium, and saccharin. The amount of steviol glycoside relative to other sweeteners can be adjusted to obtain a desired taste, as known in the art. The steviol glycoside composition described herein (including rebaudioside D, rebaudioside E, rebaudioside D4, rebaudioside M or a combination thereof) can be included in food products (such as beverages, soft drinks, ice cream, dairy products, confectioneries, cereals, chewing gum, baked goods, etc.), dietary supplements, medical nutrition, as well as pharmaceutical products.

(91) One with skill in the art will recognize that the steviol glycoside composition produced by the methods described herein can be further purified and mixed with other steviol glycosides, flavors, or sweeteners to obtain a desired flavor or sweetener composition. For example, a composition enriched with rebaudioside D4 produced as described herein can be mixed with a natural stevia extract containing rebaudioside A as the predominant steviol glycoside, or with other synthetic or natural steviol glycoside products to make a desired sweetener composition. Alternatively, a substantially purified steviol glycoside (e.g., rebaudioside D4) obtained from the steviol glycoside composition described herein can be combined with other sweeteners, such as sucrose, maltodextrin, aspartame, sucralose, neotame, acesulfame potassium, and saccharin. The amount of steviol glycoside relative to other sweeteners can be adjusted to obtain a desired taste, as known in the art. The steviol glycoside composition described herein (including rebaudioside D, rebaudioside E, rebaudioside D4, rebaudioside M or a combination thereof) can be included in food products (such as beverages, soft drinks, ice cream, dairy products, confectioneries, cereals, chewing gum, baked goods, etc.), dietary supplements, medical nutrition, as well as pharmaceutical products.

(92) Analysis of Sequence Similarity Using Identity Scoring

(93) As used herein “sequence identity” refers to the extent to which two optimally aligned polynucleotide or peptide sequences are invariant throughout a window of alignment of components, e.g., nucleotides or amino acids. An “identity fraction” for aligned segments of a test sequence and a reference sequence is the number of identical components which are shared by the two aligned sequences divided by the total number of components in reference sequence segment, i.e., the entire reference sequence or a smaller defined part of the reference sequence.

(94) As used herein, the term “percent sequence identity” or “percent identity” refers to the percentage of identical nucleotides in a linear polynucleotide sequence of a reference (“query”) polynucleotide molecule (or its complementary strand) as compared to a test (“subject”) polynucleotide molecule (or its complementary strand) when the two sequences are optimally aligned (with appropriate nucleotide insertions, deletions, or gaps totaling less than 20 percent of the reference sequence over the window of comparison). Optimal alignment of sequences for aligning a comparison window are well known to those skilled in the art and may be conducted by tools such as the local homology algorithm of Smith and Waterman, the homology alignment algorithm of Needleman and Wunsch, the search for similarity method of Pearson and Lipman, and preferably by computerized implementations of these algorithms such as GAP, BESTFIT, PASTA, and TFASTA available as part of the GCG® Wisconsin Package® (Accelrys Inc., Burlington, Mass.). An “identity fraction” for aligned segments of a test sequence and a reference sequence is the number of identical components which are shared by the two aligned sequences divided by the total number of components in the reference sequence segment, i.e., the entire reference sequence or a smaller defined part of the reference sequence. Percent sequence identity is represented as the identity fraction multiplied by 100. The comparison of one or more polynucleotide sequences may be to a full-length polynucleotide sequence or a portion thereof, or to a longer polynucleotide sequence. For purposes of this disclosure “percent identity” may also be determined using BLASTX version 2.0 for translated nucleotide sequences and BLASTN version 2.0 for polynucleotide sequences.

(95) The percent of sequence identity is preferably determined using the “Best Fit” or “Gap” program of the Sequence Analysis Software Package™ (Version 10; Genetics Computer Group, Inc., Madison, Wis.). “Gap” utilizes the algorithm of Needleman and Wunsch (Needleman and Wunsch, JOURNAL OF MOLECULAR BIOLOGY 48:443-453, 1970) to find the alignment of two sequences that maximizes the number of matches and minimizes the number of gaps. “BestFit” performs an optimal alignment of the best segment of similarity between two sequences and inserts gaps to maximize the number of matches using the local homology algorithm of Smith and Waterman (Smith and Waterman, ADVANCES IN APPLIED MATHEMATICS, 2:482-489, 1981, Smith et al., NUCLEIC ACIDS RESEARCH 11:2205-2220, 1983). The percent identity is most preferably determined using the “Best Fit” program.

(96) Useful methods for determining sequence identity are also disclosed in the Basic Local Alignment. Search Tool (BLAST) programs which are publicly available from National Center Biotechnology Information (NCBI) at the National Library of Medicine, National Institute of Health, Bethesda, Md. 20894; see BLAST Manual, Altschul et al., NCBI, NLM, NIH; Altschul et al., J. MOL. BIOL: 215:403-410 (1990); version 2.0 or higher of BLAST programs allows the introduction of gaps (deletions and insertions) into alignments; for peptide sequence BLASTX can be used to determine sequence identity; and, for polynucleotide sequence BLASTN can be used to determine sequence identity.

(97) As used herein, the term “substantial percent sequence identity” refers to a percent sequence identity of at least about 70% sequence identity, at least about 80% sequence identity, at least about 85% identity, at least about 90% sequence identity, or even greater sequence identity, such as about 98% or about 99% sequence identity. Thus, one embodiment of the invention is a polynucleotide molecule that has at least about 70% sequence identity, at least about 80% sequence identity, at least about 85% identity, at least about 90% sequence identity, or even greater sequence identity, such as about 98% or about 99% sequence identity with a polynucleotide sequence described herein. Polynucleotide molecules that have the activity of the C1m2 and C1m3 sequences of the current disclosure are capable of directing the production of a variety of steviol glycosides and have a substantial percent sequence identity to the polynucleotide sequences provided herein and are encompassed within the scope of this disclosure.

(98) Identity and Similarity

(99) Identity is the fraction of amino acids that are the same between a pair of sequences after an alignment of the sequences (which can be done using only sequence information or structural information or some other information, but usually it is based on sequence information alone), and similarity is the score assigned based on an alignment using some similarity matrix. The similarity index can be any one of the following BLOSUM62, PAM250, or GONNET, or any matrix used by one skilled in the art for the sequence alignment of proteins.

(100) Identity is the degree of correspondence between two sub-sequences (no gaps between the sequences). An identity of 25% or higher implies similarity of function, while 18-25% implies similarity of structure or function. Keep in mind that two completely unrelated or random sequences (that are greater than 100 residues) can have higher than 20% identity. Similarity is the degree of resemblance between two sequences when they are compared. This is dependent on their identity.

(101) As is evident from the foregoing description, certain aspects of the present disclosure are not limited by the particular details of the examples illustrated herein, and it is therefore contemplated that other modifications and applications, or equivalents thereof, will occur to those skilled in the art. It is accordingly intended that the claims shall cover all such modifications and applications that do not depart from the spirit and scope of the present disclosure.

(102) Moreover, unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure belongs. Although any methods and materials similar to or equivalent to or those described herein can be used in the practice or testing of the present disclosure, the preferred methods and materials are described above.

(103) Although the foregoing invention has been described in some detail by way of illustration and example for purposes of understanding, it will be apparent to those skilled in the art that certain changes and modifications may be practiced. Therefore, the description and examples should not be construed as limiting the scope of the invention, which is delineated by the appended claims.

(104) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure belongs. Although any methods and materials similar to or equivalent to those described herein can be used in the practice or testing of the present disclosure, the preferred materials and methods are described below.

(105) The disclosure will be more fully understood upon consideration of the following non-limiting Examples. It should be understood that these Examples, while indicating preferred embodiments of the subject technology, are given by way of illustration only. From the above discussion and these Examples, one skilled in the art can ascertain the essential characteristics of the subject technology, and without departing from the spirit and scope thereof, can make various changes and modifications of the subject technology to adapt it to various uses and conditions.

EXAMPLES

(106) 1. Enzymatic Synthesis of Reb D4

(107) There are several enzymatic methods of making Reb D4. One method starting from Reb E is presented here.

(108) The expression construct was transformed into E. coli BL21 (DE3), which was subsequently grown in LB media containing 50 μg/mL kanamycin at 37° C. until reaching an OD600 of 0.8-1.0. Protein expression was induced by addition of 1 mM isopropyl β-D-1-thiogalactopyranoside (IPTG) and the culture was further grown at 16° C. for 22 hr. Cells were harvested by centrifugation (3,000× g; 10 min; 4° C.). The cell pellets were collected and were either used immediately or stored at −80° C.

(109) The cell pellets were re-suspended in lysis buffer (50 mM potassium phosphate buffer, pH 7.2, 25 μg/ml lysozyme, 5 μg/ml DNase I, 20 mM imidazole, 500 mM NaCl, 10% glycerol, and 0.4% TRITON X-100). The cells were disrupted by sonication at 4° C., and the cell debris was clarified by centrifugation (18,000× g; 30 min). The supernatant was loaded to an equilibrated (equilibration buffer: 50 mM potassium phosphate buffer, pH 7.2, 20 mM imidazole, 500 mM NaCl, 10% glycerol) Ni-NTA (Qiagen) affinity column. After loading of protein sample, the column was washed with equilibration buffer to remove unbound contaminant proteins. The His-tagged B-glu1 recombinant polypeptide was eluted by equilibration buffer containing 250 mM imidazole.

(110) HPLC analysis was performed using a Dionex ultimate 3000 system (Sunnyvale, Calif.), including a quaternary pump, a temperature controlled column compartment, an auto sampler and a UV absorbance detector. Synergi Hydro-RP column with guard column was used for the characterization of steviol glycosides. Acetonitrile in water was used for elution in HPLC analysis. The detection wavelength was 210 nm.

(111) Mutant Enzymes

(112) Based on UGT76G1 structure, a series of circular permutations (PLoS computational Biology, 2012; BIOINFORMATICS, 2015) and a set of mutations were designed and their function was tested. Circular permutation analysis is a powerful tool to develop or modify enzymes of interest. After test several versions of circular permutations, significant activity was found in one version of UGT76G1. This circular mutation “circular permutation 1” (“CP1”) has demonstrated significant activity in terms of glucosylation of the steviol core. According to the current disclosure, the activity of CP1 enzyme was studied and its ability to assist in the conversion of Reb D4 to Reb M was assessed. Broadly speaking, CP1 is a variant of UGT76G1 with its domains switched and identified mutation sites.

(113) Based on the CP1 modeling analysis, multiple mutation sites for the CP1 enzyme were selected to test bioconversion of Reb E to Reb D4. After a series of such mutations, a handful of mutants were isolated that could function as desired with regard to glycosylation activity and ornamentation of the steviol core. The positional mutants away from the wild type CP1 are provided in Table 1. With these enzymes in hand, a genetically modified microbe was developed capable of bio-converting Reb E to rebaudioside D4 directly. For example, two CP1mutants (C1m2 and C1m3) were found that have high enzymatic activity for the bioconversion of Reb E to Reb D4. C (SEQ ID NO: 7) includes two mutation sites and C1m3 (SEQ ID NO: 9) contains three mutation sites from the CP1 sequence.

(114) TABLE-US-00001 TABLE 1 Mutation Sites of CP1. Position Amino acid 3 W-L 6 L-A, L-G 90 T-A; T-G 91 S-G; S-L 93 V-A; V-G 181 S-G 183 F-V; F-A; F-G 184 G-A 185 L-A 350 G-A 389 L-V 410 S-G 418 H-V 450 T-A; T-G 451 K-A 452 D-A 454 K-L; K-V
2. Identification the UGT Mutants with Activity for Reb D4 Production from Reb E:

(115) To confirm the conversion of Reb E to rebaudioside D4 in vitro, the C1m2 and C1m3 enzyme mutants were assayed using Reb E as the steviol glycoside substrate. The recombinant polypeptide (10 μg) was tested in a 200 μL in vitro reaction system. The reaction system contained 50 mM potassium phosphate buffer, pH 7.2, 3 mM MgCl.sub.2, 1 mg/ml Reb E substrate, and 1 mM UDP-glucose. The reaction was performed at 37° C. and terminated by adding 200 μL of 1-butanol. The samples were extracted three times with 200 μL of 1-butanol. The pooled fraction was dried and dissolved in 70 μL of 80% methanol for high-performance liquid chromatography (HPLC) analysis.

(116) HPLC analysis was performed using a Dionex UPLC ultimate 3000 system (Sunnyvale, Calif.), including a quaternary pump, a temperature controlled column compartment, an auto sampler and a UV absorbance detector. Synergi Hydro-RP column with guard column was used for the characterization of steviol glycosides. Acetonitrile in water was used for elution in HPLC analysis. The detection wavelength was 210 nm. Reb D and Reb D4 has different retention time in the HPLC profile. However, Reb D4 and Reb E has close retention time. (FIGS. 2, A and B).

(117) As shown in FIG. 2, C1m2 and C1m3 enzyme can convert Reb E to a compound with similar retention time as Reb D4 standard, indicating these two mutants have the enzymatic activity for Reb D4 production.

(118) 3. Identification of Reb D4 Production by LC-MS Analysis

(119) As shown in FIG. 2, the retention time of Reb E and Reb D4 is very close. It is difficult to distinguish Reb E and Reb D4 in the reactions by current HPLC methods. To confirm the conversion of Reb E to Reb D4, the produced compound was analyzed by LC-MS analysis.

(120) In order to identify Reb D4 compound in the related reactions, samples from C1m2 and C1m3 bioconversion were analyzed by LC-MS using the Synergy Hydro-RP column. Mobile phase A was 0.1% formic acid in water, and mobile phase B was 0.1% formic acid in acetonitrile. The flow rate was 0.5 ml/minute. Mobile phase B was started at 20% B and maintained for 2 minutes. Then a linear gradient to 45% B over 15 minutes was run. Then % B was increased to 90% over 0.5 minutes and maintained for the following 8 minutes. The starting conditions were re-established over 0.5 minute and maintained for another 4.5 minutes prior to the next injection for re-equilibration of the column. Mass spectrometry analysis of the samples was done on the Bruker Impact II with an optimized method in positive ion mode. Funnel 1 RF was kept at 400Vp-p, Funnel 2 RF at 400 Vp-p, Transfer time of 120 μs and pre-pulse storage of 15 μs. A full calibration of the m/z scale was done with sodium formate clusters at the end of each run. All eluent was diverted to waste for the first 2 minutes using a secondary/optional 6-port valve to keep the source clean.

(121) As shown in FIGS. 3 and 4, the produced compound has same molecular weight as Reb D4. Reb E substrate also can be detected at the same retention time. These results provide the evidence supporting Reb D4 production in these reactions was catalyzed by C1m2 or C1m3 enzyme.

(122) 4. Identification of Reb D4 Production by Enzymatic Assay

(123) According to the current disclosure, an enzymatic assay was established to confirm the production of Reb D4. A beta-glucosidase assay was modified to detect Reb D4 production in the related reactions. In this assay beta-glucosidase can hydrolyze steviol glycosides to remove the glucose group(s). After screening, a beta-glucosidase (GXT6, SEQ: 5) was found that has the specific enzymatic activity to hydrolyze Reb D4, Reb E and Reb D. So, the enzymatic assay was generated to distinguish the three compounds present in the reactions of the current disclosure.

(124) As shown in FIG. 5, GXT6 can hydrolyze Reb D4 to Reb WB1. Reb E can be hydrolyzed to stevioside and rubusoside by GXT6; Reb D can be hydrolyzed to Reb A by GXT6. All compounds have different retention times in the HPLC profile and can be distinguished clearly.

(125) The same enzymatic reaction was run using the produced compounds from Reb E bioconversion by C1m2 and C1m3. As shown in FIG. 6, Reb WB1 only can be produced in C1m2 and C1m3 reactions. Less or no Reb A and rubusoside can be produced in C1m2 and C1m3 reactions. These results provided the evidence to confirm the biosynthesis of Reb D4 in C1m2 and C1m3 reaction. C1m2 and C1m3 has the main enzymatic activity for conversion of Reb E to Reb D4, less or no activity for conversion of Reb E to Reb D.

(126) According to the current disclosure, Reb E was hydrolyzed by the action of the C1m2 and C1m3 enzymes to produce Reb M. In each of the measurements taken the compounds were produced along with what the biosynthetic pathway of the current disclosure would predict.

(127) 5. Bioconversion of Stevioside to Reb D4 by Enzymatic Reaction

(128) To confirm the conversion of stevioside to rebaudioside D4 in vitro, the HV1, C1m2 and C1m3 enzymes were assayed using stevioside as the steviol glycoside substrate. The reaction system contained 50 mM potassium phosphate buffer (pH 7.2), 3 mM MgCl.sub.2, 1 mg/ml stevioside, 1 mM UDP-glucose, HV1 and C1m2 or C1m3. The reaction was performed at 37° C. and terminated by adding 1-butanol. The samples were extracted three times with 1-butanol. The pooled fraction was dried and dissolved in 80% methanol for high-performance liquid chromatography (HPLC) analysis. HPLC analysis was performed as above description.

(129) As shown in FIG. 7, the combination of HV1 with C1m2 or C1m3 can convert stevioside to Reb D4. In the reactions, stevioside can be converted to Reb E by HV1 enzyme, then the produced Reb E can be converted to Reb D4 by C1m2 or C1m3 enzyme. In order to identify Reb D4 compound in the related reactions, samples were analyzed by LC-MS using the Synergy Hydro-RP column. As shown in FIG. 8, the produced compound (retention time 9.1 min) has the same molecular weight as Reb D4. Reb E substrate also can be detected at the same retention time. These results provide the evidence supporting Reb D4 production in the reactions.

(130) According to the current disclosure, two UGT mutants were developed that, when put into the bioconversion system, allowed the production of Reb D4 from Reb E. The entire biosynthetic pathway from stevioside to Reb M through Reb D4 was confirmed (FIG. 9). Stevioside can be converted to Reb E by HV1 enzyme as previously described, then Reb E can be converted to Reb D4 by C1m2 or C1m3 enzyme as described herein. Lastly, Reb D4 can be converted to Reb M by one of enzymes from UGT76G1, CP1 and CR1.

(131) UGT mutants were identified for converting Reb E to Reb D4. Based on structure modeling analysis, some mutant variations of the CP1enzyme (which is itself a circular version of UGT76G1) were screened for their capacity to convert Reb E to Reb D4. Two mutants were found to have this capability, they have been identified as C1m2 and C1m3.

(132) As described above, an LC-MS method was established to identify Reb D4 production. As shown in the HPLC profile, the retention time of Reb E and Reb D4 is very close. It is difficult to distinguish Reb E and Reb D4 in the reactions by most existing HPLC methods. To confirm the conversion of Reb E to Reb D4, the produced compound was analyzed by LC-MS analysis. Reb D4 compound can be detected in the bioconversion of Reb E by both the C1m2 and C1m3 enzymes.

(133) As described above, an enzymatic assay was established to confirm Reb D4 production. In order to confirm the production of Reb D4 in the related reactions, a beta-glucosidase assay was generated to distinguish Reb D4, Reb E and Reb D steviol glycosides. In this assay beta-glucosidase can hydrolyze steviol glycosides to remove the glucose group(s). GXT6 has the specific enzymatic activity to hydrolyze Reb D4, Red E and Reb D. So, the enzymatic assay was generated to distinguish the three compounds present in the reactions of the current disclosure. After enzymatic assay, the exist of Reb D4 was confirmed in the related reactions, supporting the enzymatic activity of C1m2 and C1m3 for Reb D4 synthesis from Reb E.

(134) Sequences of Interest:

(135) TABLE-US-00002 Sequences: UGT76G1 sequences: (SEQ ID NO: 1) UGT76G1 sequence Amino Acid Sequence: MENKTETTVRRRRRIILFPVPFQGHINPILQLANVLYSKGFSITIFHTNF NKPKTSNYPHFTFRFILDNDPQDERISNLPTHGPLAGMRIPRIINEHGAD ELRRELELLMLASEEDEEVSCLITDALWYFAQSVADSLNLRRINLMTSSL FNFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPMLKVKDIKSAYSNWQI LKEILGKMIKQTKASSGVIWNSFKELEESELETVIREIPAPSFLIPLPKH LTASSSSLLDHDRTVFQWLDQQPPSSVLYVSFGSTSEVDEKDFLEIARGL VDSKQSFLWVVRPGFVKGSTWVEPLPDGFLGERGRIVKWVPQQEVLAHGA IGAFWTHSGWNSTLESVCEGVPMIFSDFGLDQPLNARYMSDVLKVGVYLE NGWERGEIANAIRRVMVDEEGEYIRQNARVLKQKADVSLMKGGSSYESLE SLVSYISSL UGT76G1 sequence DNA sequence: (SEQ ID NO: 2) ATGGAGAATAAGACAGAAACAACCGTAAGACGGAGGCGGAGGATTATCTT GTTCCCTGTACCATTTCAGGGCCATATTAATCCGATCCTCCAATTAGCAA ACGTCCTCTACTCCAAGGGATTTTCAATAACAATCTTCCATACTAACTTT AACAAGCCTAAAACGAGTAATTATCCTCACTTTACATTCAGGTTCATTCT AGACAACGACCCTCAGGATGAGCGTATCTCAAATTTACCTACGCATGGCC CCTTGGCAGGTATGCGAATACCAATAATCAATGAGCATOGAGCCGATGAA CTCCGTCGCGAGTTAGAGCTTCTCATGCTCGCAAGTGAGGAAGACGAGGA AGTTTCGTGCCTAATAACTGATGCGCTTTGGTACTTCGCCCAATCAGTCG CAGACTCACTGAATCTACGCCGTTTGGTCCTTATGACAAGTTCATTATTC AACTTTCACGCACATGTATCACTGCCGCAATTTGACGAGTTGGGTTACCT GGACCCGGATGACAAAACGCGATTGGAGGAACAAGCGTCGGGCTTCCCCA TGCTGAAAGTCAAAGATATTAAGAGCGCTTATAGTAATTGGCAAATTCTG AAAGAAATTCTCGGAAAAATGATAAAGCAAACCAAAGCGTCCTCTGGAGT AATCTGGAACTCCTTCAAGGAGTTAGAGGAATCTGAACTTGAAACGGTCA TCAGAGAAATCCCCGCTCCCTCGTTCTTAATTCCACTACCCAAGCACCTT ACTGCAAGTAGCAGTTCCCTCCTAGATCATGACCGAACCGTGTTTCAGTG GCTGGATCAGCAACCCCCGTCGTCAGTTCTATATGTAAGCTTTGGGAGTA CTTCGGAAGTGGATGAAAAGGACTTCTTAGAGATTGCGCGAGGGCTCGTG GATAGCAAACAGAGCTTCCTGTGGGTAGTGAGACCGGGATTCGTTAAGGG CTCGACGTGGGTCGAGCCGTTGCCAGATGGTTTTCTAGGGGAGAGAGGGA GAATCGTGAAATGGGTTCCACAGCAAGAGGTTTTGGCTCACGGAGCTATA GGGGCCTTTTGGACCCACTCTGGTTGGAATTCTACTCTTGAAAGTGTCTG TGAAGGCGTTCCAATGATATTTTCTGATTTTGGGCTTGACCAGCCTCTAA ACGCTCGCTATATGTCTGATGTGTTGAAGGTTGGCGTGTACCTGGAGAAT GGTTGGGAAAGGGGGGAAATTGCCAACGCCATACGCCGGGTAATGGTGGA CGAGGAAGGTGAGTACATACGTCAGAACGCTCGGGTTTTAAAACAAAAAG CGGACGTCAGCCTTATGAAGGGAGGTAGCTCCTATGAATCCCTAGAATCC TTGGTAAGCTATATATCTTCGTTATAA CP1 sequences: (SEQ ID NO: 3) CP1 sequence Amino Acid: MNWQILKEILGKMIKQTKASSGVIWNSFKELEESELETVIREIPAPSFLI PLPKHLTASSSSLLDHDRTVFQWLDQQPPSSVLYVSFGSTSEVDEKDFLE IARGLVDSKQSFLWVVRPGFVKGSTWVEPLPDGFLGERGRIVKWVPQQEV LAHGAIGAFWTHSGWNSTLESVCEGVPMIFSDFGLDQPLNARYMSDVILK VGVYLENGWERGEIANAIRRVMVDEEGEYIRQNARVLKQKADVSLMKGGS SYESLESLVSYISSLENKTETTVRRRRRIILFPVPFQGHINPILQLANVL YSKGESITIFHTNFNKPKTSNYPHFTFRFILDNDPQDERISNLPTHGPLA GMRIPIINEHGADELRRELELLMLASEEDEEVSCLITDALWYFAQSVADS LNLRRLVLMTSSLFNFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPMLK VKDIKSAYS CP1 sequence DNA sequence: (SEQ ID NO: 4) ATGAACCTGCAAATCCTGAAAGAAATCCTGGGTAAAATGATCAAACAAAC CAAAGCGTCGTCGGGCGTTATCTGGAACTCCTTCAAAGAACTGGAAGAAT CAGAACTGGAAACCGTTATTCGCGAAATCCCGGCTCCGTCGTTCCTGATT CCGCTGCCGAAACATCTGACCGCGAGCAGCAGCAGCCTGCTGGATCACGA CCGTACGGTCTTTCAGTGGCTGGATCAGCAACCGCCGTCATCGGTGCTGT ATGTTTCATTCGGTAGCACCTCTGAAGTCGATGAAAAAGACTTTCTGGAA ATCGCTCGCGGCCTGGTGGATAGTAAACAGTCCTTCCTGTGGGTGGTTCG TCCGGGTTTTGTGAAAGGCAGCACGTGGGTTGAACCGCTGCCGGATGGCT TCCTGGGTGAACGCGGCCGTATTGTCAAATGGGTGCCGCAGCAAGAAGTG CTGGCACATGGTGCTATCGGCGCGTTTTGGACCCACTCTGGTTGGAACAG TACGCTGGAATCCGTTTGCGAAGGTGTCCCGATGATTTTCAGCGATTTTG GCCTGGACCAGCCGCTGAATGCCCGCTATATGTCTGATGTTCTGAAAGTC GGTGTGTACCTGGAAAACGGTTGGGAACGTGGCGAAATTGCGAATGCCAT CCGTCGCGTTATGGTCGATGAAGAAGGCGAATACATTCGCCAGAACGCTC GTGTCCTGAAACAAAAAGCGGACGTGAGCCTGATGAAAGGCGGTAGCTCT TATGAATCACTGGAATCCGTGGTTAGCTACATCAGTTCCCTGGAAAATAA AACCGAAACCACGGTGCGTCGCCGTCGCCGTATTATCCTGTTCCCGGTTC CGTTTCAGGGTCATATTAACCCGATCCTGCAACTGGCGAATGTTCTGTAT TCAAAAGGCTTTTCGATCACCATCTTCCATACGAACTTCAACAAACCGAA AACCAGTAACTACCCGCACTTTACGTTCCGCTTTATTCTGGATAACGACC CGCAGGATGAACGTATCTCCAATCTGCCGACCCACGGCCCGCTGGCCGGT ATGCGCATTCCGATTATCAATGAACACGGTGCAGATGAACTGCGCCGTGA ACTGGAACTGCTGATGCTGGCCAGTGAAGAAGATGAAGAAGTGTCCTGTC CTTGATCACCGACGCAGTGGTATTTCGCCCAGAGCGTTGCAGATTCTCTG AACCTGCGCCGTCTGGTCCTGATGACGTCATCGCTGTTCAATTTTCATGC GCACGTTTCTCTGCCGCAATTTGATGAACTGGGCTACCTGGACCCGGATG ACAAAACCCGTCTGGAAGAACAAGCCAGTGGTTTTCCGATGCTGAAAGTC AAAGACATTAAATCCGCCTATTCGTAA GXT6: amino acid. From Streptomyces sp. GXT6 (SEQ. ID NO: 5) MTPPFGSELALPETFLMGAATSAHQVEGNNIGSDWWEIEHRPDTFVAQPS GDAADSYHRWPEDMDLLAGLGFNAYRFSIEWARIEPEPGRISRAALAHYR AMVRGALERGLTPLVTLHFTFTCPRWFSARGGWLAPDAAETFTAYARTAS EVVGEGVSHVATINEPNMLAHMYTLRRLAAEHGWSALAEGRRAGAAAFDP AAVAPDRDVTAALIEAHRRSAVVLRQAGLQVGWTVANQVYHAEPGAEEIA TAYARPREDVFLEAAREDDWIGVQAYTRHRIGPDGPLPVPDGAPTTLTGW EVYPDALAEAVLHTVATVGAQVPVIVTENGIATGDDDQRIAYTRQALAGL ARVMREGADVRGYFHWSALDNYEWGTYRPTFGLIGVDPDTFARTPKPSAR WLGALARDRRLPAAKAPVGTGAPTAR GXT6: DNA Codon optimization for E coli (SEQ ID NO: 6) ATGACCCCACCGTTTGGTAGCGAACTGGCGCTTCCGGAAACATTCCTTAT GGGTGCGGCCACTTCAGCTCACCAGGTTGAAGGTAATAATATCGGTAGCG ATTGGTGGGAAATTGAGCACCGCCCGGATACTTTTGTTGCTCAGCCGTCC GGAGATGCGGCAGATTCCTATCACCGCTGGCCGGAAGATATGGATTTGCT TGCCGGATTGGGCTTTAATGCTTATCGTTTTAGTATTGAGTGGGCTCGTA TTGAACCGGAACCTGGTCGGATTTCAAGAGCGGCTCTGGCGCATTATCGT GCGATGGTCCGCGGAGCGCTGGAGCGTGGCCTGACACCATTAGTAACTTT GCATCACTTTACATGCCCACGGTGGTTTTCAGCTCGGGGCGGTTGGTTAG CTCCAGATGCAGCGGAAACTTTTACTGCTTATGCCAGAACTGCCAGCGAG GTAGTTGGTGAGGGCGTGTCTCATGTCGCGACGATCAACGAGCCTAACAT GCTGGCACATATGTATACTTTGAGAAGACTTGCAGCGGAACACGGTTGGT CAGCCTTAGCGGAAGGAAGACGTGCTGGCGCCGCAGCTTTTGATCCGGCT GCTGTTGCCCCGGATCGCGATGTGACGGCTGCTCTGATTGAGGCGCACCG TCGCAGCGCCGTAGTGCTGCGCCAGGCCGGCCTGCAGGTTGGCTGGACAG TTGCCAATCAGGTTTATCACGCCGAACCGGGAGCAGAAGAAATTGCTACG GCCTATGCTCGGCCACGGGAGGATGTATTCTTGGAGGCAGCCCGCGAAGA TGATTGGATCGGCGTGCAGGCATATACTCGTCACCGTATTGGACCGGATG GACCTCTGCCGGTACCTGATGGGGCACCTACAACACTTACTGGCTGGGAA GTTTATCCTGATGCCCTTGCAGAAGCCGTGCTGCATACAGTCGCCACCGT GGGTGCGCAGGTACCAGTTATTGTAACAGAGAATGGTATCGCCACCGGCG ATGATGATCAGCGTATCGCATATACTAGACAGGCACTGGCAGGGTTGGCC CGTGTCATGCGCGAAGGTGCGGATGTGCGGGGATATTTTCATTGGTCCGC ATTAGATAACTATGAATGGGGCACCTATCGTCCAACCTTCGGGTTAATCG GGGTTGATCCGGATACGTTTGCTCGGACGCCTAAACCTTCTGCACGCTGG CTGGGTGCTCTGGCACGCGATCGCAGACTGCCAGCCGCGAAAGCGCCTGT CGGCACTGGCGCCCCTACAGCTCGC C1m2: Amino Acid Sequence for mutant enzyme (SEQ ID NO: 7) MNWQIAKEILGKIMIKQTKASSGVPIWNSFKELEESELETVIREIPAPSF LIPLPKHLTASSSSLLDHDRTVFQWLDQQPPSSVLYVSFGSTSEVDEKDF FLEIARGLVDSKQSFLWVVRPGVKGSTWVEPLPDGFLGERGRIVKWVPQQ EVLAHGAIGAFWTHSGWNSTLESVCEGVPMIFSDFGGDQPLNARYMSDVI LKVGVYLENGWERGEIANAIRRVMVDEEGEYIRQNARVLKQKADVSLMKG GSSYESLESLVSYISSLENKTETTVRRRRRIILFPVPFQGHINPILQLAN VLYSKGFSITIFHTNFNKPKTSNYPHFTFRFILDNDPQDERISNLPTHGP LAGMRIPIINEHGADELRRELELLMLASEEDEEVSCLITDALWYFAQSVA DSLNLRRLVLMTSSLFNFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPM LKVKDIKSAYS C1M2: DNA Sequence for mutant enzyme (SEQ ID NO: 8) ATGAACTGGCAAATCGCGAAAGAAATCCTGGGTAAAATGATCAAACAAAC CAAAGCGTCGTCGGGCGTTATCTGGAACTCCTTCAAAGAACTGGAAGAAT CAGAACTGGAAACCGTTATTCGCGAAATCCCGGCTCCGTCGTTCCTGATT CCGCTGCCGAAACATCTGACCGCGAGCAGCAGCAGCCTGCTGGATCACGA CCGTACGGTCTTTCAGTGGCTGGATCAGCAACCGCCGTCATCGGTGCTGT ATGTTTCATTCGGTAGCACCTCTGAAGTCGATGAAAAAGACTTTCTGGAA ATCGCTCGCGGCCTGGTGGATAGTAAACAGTCCTTCCTGTGGGTGGTTCG TCCGGGTTTTGTGAAAGGCAGCACGTGGGTTGAACCGCTGCCGGATGGCT TCCTGGGTGAACGCGGCCGTATTGTCAAATGGGTGCCGCAGCAAGAAGTG CTGGCACATGGTGCTATCGGCGCGTTTTGGACCCACTCTGGTTGGAACAG TACGCTGGAATCCGTTTGCGAAGGTGTCCCGATGATTTTTCAGCGATTTT GGCGGCGACCAGCCGCTGAATGCCCGCTATATGTCTGATGTCTGAAAGTC GGTGTGTACCTGGAAAACGGTTGGGAACGTGGCGAAATTGCGAATGCCAT CCGTCGCGTTATGGTCGATGAAGAAGGCGAATACATTCCGCCAGAACGCT CGTGTCCGTGAAACAAAAAGCGGACGTGAGCCTGATGAAAGGCGGTAGCT CTTATGAATCACTGGAATCGCTGGTTAGCTACATCAGTTCCCTGGAAAAT AAAACCGAAACCACGGTGCGTCGCCGTCGCCGTATTATCCTGTTCCCGGT TCCGTTTCAGGGTCATATTAACCCGATCCTGCAACTGGCGAATGTCTGTA TTCAAAAGGCTTTTCGATCACCATCTTCCATACGAACTTCAACAAACCGA AAACCAGTAACTACCCGCACTTTACGTTCCGTTTATTCTGGATAACGACC CGCAGGATGAACGTATCTCCAATCTGCCGACCCACGGCCCGCTGGCCGGT ATGCGCATTCCGATTATCAATGAACACGGTGCAGATGAACTGCGCCGTGA ACTGGAACTGCTGATGCTGGCCAGTGAAGAAGATGAAGAAGTGTCCTGTC TGATCACCGACGCACTGTGGTATTTCGCCCAGAGCGTTGCAGATTCTCTG AACCTGCGCCGTCTGGTCCTGATGACGTCATCGCTGTTCAATTTTCATGC GCACGTTTCTCTGCCGCAATTTGATGAACTGGGCTACCTGGACCCGGATG ACAAAACCCGTCTGGAAGAACAAGCCAGTGGTTTTCCGATGCTGAAAGTC AAAGACATTAAATCCGCCTATTCGTAA C1m3: Amino Acid Sequence for mutant enzyme (SEQ ID NO: 9) MNWQIAKEILGKMIKQTKASSGVIWNSFKELEESELETVIREIPAPSFLI PLPKHLTASSSSLLDHDRTVFQWLDQQPPSSVLYVSFGSASEVDEKDFLE IARGLVDSKQSFLWVVRPGFVKGSTWVEPLPDGFLGERGRIVKWVPQQEV LAHGAIGAFWTHSGWNSTLESVCEGVPMIFSDFGGDQPLNARYMSDVLKV GVYLENGWERGEIANAIRRVMVDEEGEYIRQNARVLKQKADVSLMKGGSS YESLESLVSYISSLENKTETTVRRRRRIILFPVPFQGHINPILQLANVLY SKGFSITIFHTNFNKPKTSNYPHFTFRFILDNDPQDERISNLPTHGPLAG MRIPIINEHGADELRRELELLMLASEEDEEVSCLITDALWYFAQSVADSL NLRRLVLMTSSLFNMFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPMLK VKDIKSAYS C1m3: DNA Sequence for mutant enzyme (SEQ ID NO: 10) ATGAACTGGCAAATCGCGAAAGAAATCCTGGGTAAAATGATCAAACAAAC CAAAGCGTCGTCGGGCGTTATCTGGAACTCCTTCAAAGAACTGGAAGAAT CAGAACTGGAAACCGTTATTCGCGAAATCCCGGCTCCGTCGTTCCTGATT CCGCTGCCGAAACATCTGACCGCGAGCAGCAGCAGCCTGCTGGATCACGA TCCGTACGGTCTTTCAGTGGCGGATCAGCAACCGCCGTCATCGGTGCTGT ATGTTTCATTCGGTAGCGCCTCTGAAGTCGATGAAAAAGACTTTCTGGAA ATCGCTCGCGGCCTGGTGGATAGTAAACAGTCCTTCCTGTGGGTGGTTCG TCCGGGTTTTGTGAAAGGCAGCACGTGGGTTGAACCGCTGCCGGATGGCT TCCTGGGTGAACGCGGCCGTATTGTCAAATGGGTGCCGCAGCAAGAAGTG CTGGCACATGGTGCTATCGGCGCGTTTTGGACCCACTCTGGTTGGAACAG TACGCTGGAATCCGTTTGCGAAGGTGTCCCGATGATTTTCAGCGATTTTG CGACCAGCCGCTGAATGCCCGCTATATGTCTGATGTTCTGAAAGTCGGTG TGCGGGGAAAACGGTTGGGAACGTGGCGAAATTGCGAATGCCATCCGTCG CGTTATGGTCTGTACCGATGAAGAAGGCGAATACATTCGCCAGAACGCTC GTGTCCTGAAACAAAAAGCGGACGTGAGCCTGATGAAAGGCGGTAGCTCT TATGAATCACTGGAATCGCTGGTTAGCTACATCAGTTCCCTGGAAAATAA AACCGAAACCACGGTGCGTCGCCGTCGCCGTATTATCCTGTTCCCGGTTC CGTTTCAGGGTCATATTAACCCGATCCTGCAACTGGCGAATGTTCTGTAT TCAAAAGGCTTTTCGATCACCATCTTCCATACGAACTTCAACAAACCGAA AACCAGTAACTACCCGCACTTTACGTTCCGCTTTATTCTGGATAACGACC CGCAGGATGAACGTATCTCCAATCTGCCGACCCACGGCCCGCTGGCCGGT ATGCGCATTCCGATTATCAATGAACACGGTGCAGATGAACTGCGCCGTGA ACTGGAACTGCTGATGCTGGCCAGTGAAGAAGATGAAGAAGTGTCCTGTC TGATCACCGACGCACTGTGGTATTTCGCCCAGAGCGTTGCAGATTCTCTG AACCTGCGCCGTCTGGTCCTGATGACGTCATCGCTGTTCAATTTTCATGC GCACGTTTCTCTGCCGCAATTTGATGAACTGGGCTACCTGGACCCGGATG ACAAAACCCGTCTGGAAGAACAAGCCAGTGGTTTTCCGATGCTGAAAGTC AAAGACATTAAATCCGCCTATTCGTAA HV1: Amino Acid Sequence (SEQ. ID NO: 11) MDGNSSSSPLHVVICPWLALGHLLPCLDIAERLASRGHRVSFVSTPRNIA RLPPLRPAVAPLVDFVALPLPHVDGLPEGAESTNDVPYDKFELHRKAFDG LAAPFSEFLRAACAEGAGSRPDWLIVDTFHHWAAAAAVENKVPCVMLLLG AATVIAGFARGVSEHAAAAVGKERPAAEAPSFETERRKLMTTQNASGMTV AERYFLTLMRSDLVAIRSCAEWEPESVAALTTLAGKPVVPLGLLPPSPEG HGRGVSKEDAAVRWLDAQPAKSVVYVALGSEVPLRAEQVELALGLELSGA RFLWALRKPTDAPDAAVLPPGFEERTRGRGLVVTGWVPQIGVLAHGAVAA FLTHCGWNSTIEGLLFGHPLIMLPISSDQGPNARLMEGRKGMQVPRDESD GSFRIZEDVAATVRAVAVEEDGRRVFTANAKKMQEIVADGACHERCIDGG IQQLRSYKA HV1: DNA Sequence (SEQ ID NO: 12) ATGGATGGTAACTCCTCCTCCTCGCCGCTGCATGTGGTCATTTGTCCGTG GCTGGCTCTGGGTCACCTGCTGCCGTGTCTGGATATTGCTGAACGTCTGG CGTCACGCGGCCATCGTGTCAGTTTTGTGTCCACCCCGCGCAACATTGCC CGTCTGCCGCCGCTGCGTCCGGCTGTTGCACCGCTGGTTGATTTCGTCGC ACTGCCGCTGCCGCATGTTGACGGTCTGCCGGAGGGTGCGCAAATCGACC AATGATGTGCCGTATGACAAATTTGAACTGCACCGTAAGGCGTTCGATGG TCTGGCGGCCCCGTTTAGCGAATTTCTGCGTGCAGCTTGCGCAGAAGGTG CAGGTTCTCGCCCGGATTGGCTGATTGTGGACACCTTTCATCACTGGGCG GCGGCGGCGGCGGTGGAAAACAAAGTGCCGTGTGTTATGCTGCTGCTGGG TGCAGCAACGGTGATCGCTGGTTTCGCGCGTGGTGTTAGCGAACATGCGG CGGCGGCGGTGGGTAAAGAACGTCCGGCTGCGGAAGCCCCGAGTTTTGAA ACCGAACGTCGCAAGCTGATGACCACGCAGAATGCCTCCGGCATGACCGT GGCAGAACGCTATTTCCTGACGCTGATGCGTAGCGATCTGGTTGCCATCC GCTCTTGCGCAGAATGGGAACCGGAAAGCGTGGCAGCACTGACCACGCTG GCAGGTAAACCGGTGGTTCCGCTGGGTCTGCTGCCGCCGAGTCCGGAAGG CGGTCGTGGCGTTTCCAAAGAAGATGCTGCGGTCCGTTGGCTGGACGCAC AGCCGGCAAAGTCAGTCGTGTACGTCGCACTGGGTTCGGAAGTGCCGCTG CGTGCGGAACAAGTTCACGAACTGGCACTGGGCCTGGAACTGAGCGGTGC TCGCTTTCTGTGGGCGCTCGTAAACCGACCGATGCACCGGACGCCGCAGT GCTGCCGCCGGGTTTCGAAGAACGTACCCGCGGCCGTGGTCTGGTTGTCA CGGGTTGGGTGCCGCAGATTGGCGTTCTGGCTCATGGTGCGGTGGCTGCG TTTCTGACCCACTGTGGCTGGAACTCTACGATCGAAGGCCTGCTGTTCGG TCATCCGCTGATTATGCTGCCGATCAGCTCTGATCAGGGTCCGAATGCGC GCCTGATGGAAGGCCGTAAAGTCGGTATGCAAGTGCCGCGTGATGAATCA GACGGCTCGTTTCGTCGCGAAGATGTTGCCGCAACCGTCCGCGCCGTGGC AGTTGAAGAAGACGGTCGTCGCGTCTTCACGGCTAACGCGAAAAAGATGC AAGAAATTGTGGCCGATGGCGCATGCCACGAACGTTGTATTGACGGTTTT ATCCAGCAACTGCGCAGTTACAAGGCGTAA CR1: Amino acid sequence (SEQ ID NO: 13) MNWQIAKEILGKMIKQTKASSGVIWNSFKELEESELETVIREIPAPSFLI PLPKHLTASSSSLLDHDRTVFQWLDQQPPSSVLYVSFGSTSEVDEKDFLE IARGLVDSKQSFLWVVRPGFVKGSTWVEPLPDGFLGERGRIVKWVPQQEV LAHGAIGAFWTHSGWNSTLESVCEGVPMIFSDFGLDQPLNARYMSDVLKV GVYLENGWERGEIANAIRRVMVDEEGEYIRQNARVLKQKADVSLMKGGSS YESLESLVSYISSLENKTETTVRRRRRIILFPVPFQGHINPILQLANVLY SKGFSITIFHTNFNKPKTSNYPHFTFRFILDNDPQDERISNLPTHGPLAG MRIPIINEHGADELRRELELLMLASEEDEEVSCLITDALWYFAQSVADSL NLRRLVLMTSSLFNFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPMLKV KDIKSAYS CR1: DNA sequence (SEQ ID NO: 14) ATGAACTGGCAAATCGCGAAAGAAATCCTGGGTAAAATGATCAAACAAAC CAAAGCGTCGTCGGGCGTTATCTGGAACTCCTTCAAAGAACTGGAAGAAT CAGAACTGGAAACCGTTATTCGCGAAATCCCGGCTCCGTCGTTCCTGATT CCGCTGCCGAAACATCTGACCGCGAGCAGCAGCAGCCTGCTGGATCACGA CCGTACGGTCTTTCAGTGGCTGGATCAGCAACCGCCGTCATCGGTGCTGT ATGTTTCATTCGGTAGCACCTCTGAAGTCGATGAAAAAGACTTTCTGGAA ATCGCTCGCGGCCTGGTGGATAGTAAACAGTCCTTCCTGTGGGTGGTTCG TCCGGGTTTTGTGAAAGGCAGCACGTGGGTTGAACCGCTGCCGGATGGCT TCCTGGGTGAACGCGGCCGTATTGTCAAATGGGTGCCGCAGCAAGAAGTG CTGGCACATGGTGCTATCGGCGCGTTTTGGACCCACTCTGGTTGGAACAG TACGCTGGAATCCGTTTGCGAAGGTGTCCCGATGATTTTCAGCGACTTTG GCCTGGACCAGCCGCTGAATGCCCGCTATATGTCTGATGTTCTGAAAGTC GGTGTGTACCTGGAAAACGGTTGGGAACGTGGCGAAATTGCGAATGCCAT CCGTCGCGTTATGGTCGATGAAGAAGGCGAATACATTCGCCAGAACGCTC GTGTCCTGAAACAAAAAGCGGACGTGAGCCTGATGAAAGGCGGTAGCTCT TATGAATCACTGGAATCGCTGGTTAGCTACATCAGTTCCCTGGAAAATAA AACCGAAACCACGGTGCGTCGCCGTCGCCGTATTATCCTGTTCCCGGTTC CGTTTCAGGGTCATATTAACCCGATCCTGCAACTGGCGAATGTTCTGTAT TCAAAAGGCTTTTCGATCACCATCTTCCATACGAACTTCAACAAACCGAA AACCAGTAACTACCCGCACTTTACGTTCCGCTTTATTCTGATAACGACCC GCAGGATGAACGTATCTCCAATCTGCCGACCCACGGCCCGCTGGCCGGTA TGCGCATTCCGATTATCAATGAACACGGTGCAGATGAACTGCGCCGTGAA CTGGAACTGCTGATGCTGGCCAGTGAAGAAGATGAAGAAGTGTCCTGTCT GATCACCGACGCACTGTGGTATTTCGCCCAGAGCGTTGCAGATTCTCTGA ACCTGCGCCGTCTGGTCCTGATGACGTCATCGCTGTTCAATTTTCATGCG CACGTTTCTCTGCCGCAATTTGATGAACTGGGCTACCTGGACCCGGATGA CAAAACCCGTCTGGAAGAACAAGCCAGTGGTTTTCCGATGCTGAAAGTCA AAGACATTAAATCCGCCTATTCGTAA

STATEMENT OF INDUSTRIAL APPLICABILITY/TECHNICAL FIELD

(136) This disclosure has applicability in the food, feed, beverage, and pharmacological industries. This disclosure relates generally to a method for the biosynthetic production of steviol glycosides, e.g., via a modified microbial strain.

LITERATURE CITED AND INCORPORATED BY REFERENCE

(137) 1. Brandle, J. E. et al., (1998). Stevia Rebaudiana: Its Agricultural, Biological, and Chemical Properties, CANADIAN J. PLANT SCIENCE. 78 (4): 527-36. 2. Ceunen, S., and J. M. C. Geuns, Steviol Glycosides: Chemical Diversity, Metabolism, and Function, J. NAT. PROD., 2013, 76 (6), pp 1201-28 (2013). 3. Du J et al., (2011), Engineering microbial factories for synthesis of value-added products, J IND MICROBIOL BIOTECHNOL. 38: 873-90. 4. GRAS Notices, USA Food and Drug Administration, United States Health & Human Services. (2016) (relevant to steviol glycosides & polyglycosides). 5. Häusler A, and Münch T., (1997), Microbial production of natural flavors, ASM NEWS 63:551-59. 6. Prakash I., et al.; Isolation and Characterization of a Novel Rebaudioside M Isomer from a Bioconversion Reaction ref Rebaudioside A and AMR Comparison Studies of Rebaudioside M Isolated from Stevia rebaudiana Bertoni and Stevia rebaudiana Morita, BIOMOLECULES, 2014 June; 4(2): 374-89. (Published online 2014 Mar. 31. 2014). 7. Prakash I., et al., Development of Next Generation Stevia Sweetener: Rebaudioside M, FOODS, 2014, 3:162-175. 8. Richman A., et. al., Functional genomics uncovers three glucosyltransferases involved in the synthesis of the major sweet glucosides of Stevia rebaudiana, PLANT J. 2005 January;41(1):56-67. 9. Shockey J M. Et a., (2003), Arabidopsis contains a large superfamily of acyl-activating enzymes: phylogenetic and biochemical analysis reveals a new class of acyl-coenzyme A synthetases. PLANT PHYSIOL. 132 1065-76. 10. Wang J., et al., Pathway mining-based integration of critical enzyme parts for de nova biosynthesis of steviolglycosides sweetener in Escherichia coli, CELL. RESEARCH (2016) 26:258-61.