CLAUDIN-18.2-SPECIFIC IMMUNORECEPTORS AND T CELL EPITOPES
20230303656 · 2023-09-28
Inventors
- Ugur Sahin (Mainz, DE)
- Ozlem Tureci (Mainz, DE)
- Petra OEHM (Mainz, DE)
- Tana Omokoko (Mainz, DE)
- Andrea BREITKREUZ (Worms, DE)
- Karolina Anna MROZ (Wiesbaden, DE)
- Lisa Hebich (Kerzenheim, DE)
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2319/035
CHEMISTRY; METALLURGY
International classification
A61K39/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present invention provides Claudin-18.2-specific immunoreceptors (T cell receptors and artificial T cell receptors (chimeric antigen receptors; CARs)) and T cell epitopes which are useful for immunotherapy.
Claims
1. A peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 3, 4, 5, 6 and 7 or a variant of said amino acid sequence.
2. The peptide of claim 1 which is 100 or less, 50 or less, 20 or less, or 10 or less amino acids long.
3. The peptide of claim 1 or 2 which consists of the amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 3, 4, 5, 6 and 7 or a variant of said amino acid sequence.
4. A nucleic acid comprising a nucleotide sequence encoding the peptide of any one of claims 1 to 3.
5. The nucleic acid of claim 4 which is a recombinant nucleic acid.
6. A cell comprising the nucleic acid of claim 4 or 5.
7. A cell that presents the peptide of any one of claims 1 to 3 or a procession product thereof.
8. An immunoreactive cell which is reactive with a peptide of any one of claims 1 to 3.
9. A binding agent which binds to a peptide of claim 1, optionally in a complex with an MHC molecule.
10. A T cell receptor which binds to a peptide of claim 1, optionally in a complex with an MHC molecule, and preferably is reactive with said peptide, or a polypeptide chain of said T cell receptor.
11. A T cell receptor α-chain or a T cell receptor comprising said T cell receptor α-chain, wherein said T cell receptor α-chain is selected from the group consisting of: (i) a T cell receptor α-chain comprising at least one, preferably two, more preferably all three of the CDR sequences of a T cell receptor α-chain selected from the group consisting of SEQ ID NOs: 8, 10, 12, 14, 16 and 18 or a variant thereof and (ii) a T cell receptor α-chain comprising a T cell receptor α-chain sequence selected from the group consisting of SEQ ID NOs: 8, 10, 12, 14, 16 and 18 or a fragment thereof, or a variant of said sequence or fragment.
12. A T cell receptor β-chain or a T cell receptor comprising said T cell receptor β-chain, wherein said T cell receptor β-chain is selected from the group consisting of: (i) a T cell receptor β-chain comprising at least one, preferably two, more preferably all three of the CDR sequences of a T cell receptor β-chain selected from the group consisting of SEQ ID NOs: 9, 11, 13, 15, 17 and 19 or a variant thereof and (ii) a T cell receptor β-chain comprising a T cell receptor β-chain sequence selected from the group consisting of SEQ ID NOs: 9, 11, 13, 15, 17 and 19 or a fragment thereof, or a variant of said sequence or fragment.
13. A T cell receptor selected from the group consisting of: (I) a T cell receptor comprising: (i) a T cell receptor α-chain comprising at least one, preferably two, more preferably all three of the CDR sequences of the T cell receptor α-chain of SEQ ID NO: x or a variant thereof, and (ii) a T cell receptor β-chain comprising at least one, preferably two, more preferably all three of the CDR sequences of a T cell receptor β-chain of SEQ ID NO: x+1 or a variant thereof; wherein x selected from the group consisting of 8, 10, 12, 14, 16 and 18 and (II) a T cell receptor comprising: (i) a T cell receptor α-chain comprising the T cell receptor α-chain sequence of SEQ ID NO: x or a fragment thereof, or a variant of said sequence or fragment, and (ii) a T cell receptor β-chain comprising the T cell receptor β-chain sequence of SEQ ID NO: x+1 or a fragment thereof, or a variant of said sequence or fragment; wherein x selected from the group consisting of 8, 10, 12, 14, 16 and 18.
14. An artificial T cell receptor which binds to claudin-18.2 (CLDN18.2).
15. The artificial T cell receptor of claim 14 which binds to an extracellular domain of CLDN18.2.
16. The artificial T cell receptor of claim 14 or 15 wherein said binding is a specific binding.
17. The artificial T cell receptor of any one of claims 14 to 16 which comprises a binding domain for CLDN18.2.
18. The artificial T cell receptor of claim 17 wherein the binding domain for CLDN18.2 is comprised by an exodomain of said artificial T cell receptor.
19. The artificial T cell receptor of claim 17 or 18, wherein the binding domain for CLDN18.2 comprises a single-chain variable fragment (scFv) of a CLDN18.2 antibody.
20. The artificial T cell receptor of any one of claims 17 to 19, wherein the binding domain for CLDN18.2 comprises a variable region of a heavy chain of an immunoglobulin (VH) with a specificity for CLDN18.2 (VH(CLDN18.2)) and a variable region of a light chain of an immunoglobulin (VL) with a specificity for CLDN18.2 (VL(CLDN18.2)).
21. The artificial T cell receptor of claim 20, wherein said heavy chain variable region (VH) and the corresponding light chain variable region (VL) are connected via a peptide linker, preferably a peptide linker comprising the amino acid sequence (GGGGS)3.
22. The artificial T cell receptor of any one of claims 17 to 21, wherein the binding domain for CLDN18.2 comprises a VH(CLDN18.2) comprising an amino acid sequence represented by SEQ ID NO: 23 or a fragment thereof, or a variant of said amino acid sequence or fragment.
23. The artificial T cell receptor of any one of claims 17 to 22, wherein the binding domain for CLDN18.2 comprises a VL(CLDN18.2) comprising an amino acid sequence represented by SEQ ID NO: 30 or a fragment thereof, or a variant of said amino acid sequence or fragment.
24. The artificial T cell receptor of any one of claims 17 to 23, wherein the binding domain for CLDN18.2 comprises a VH(CLDN18.2) comprising an amino acid sequence represented by SEQ ID NO: 23 or a fragment thereof, or a variant of said amino acid sequence or fragment and a VL(CLDN18.2) comprising an amino acid sequence represented by SEQ ID NO: 30 or a fragment thereof, or a variant of said amino acid sequence or fragment.
25. The artificial T cell receptor of any one of claims 17 to 24, wherein the binding domain for CLDN18.2 comprises an amino acid sequence represented by SEQ ID NO: 35 or a fragment thereof, or a variant of said amino acid sequence or fragment.
26. The artificial T cell receptor of any one of claims 14 to 25 which comprises a transmembrane domain.
27. The artificial T cell receptor of any one of claims 14 to 26 which comprises a T cell signaling domain.
28. The artificial T cell receptor of claim 27, wherein the T cell signaling domain comprises CD3-zeta, preferably the endodomain of CD3-zeta, optionally in combination with CD28.
29. The artificial T cell receptor of any one of claims 14 to 28 which comprises a signal peptide which directs the nascent protein into the endoplasmic reticulum.
30. The artificial T cell receptor of any one of claims 14 to 29 which comprises a spacer region which links the binding domain for CLDN18.2 to the transmembrane domain.
31. The artificial T cell receptor of any one of claims 14 to 30 which comprises the structure: NH2—signal peptide—binding domain for CLDN18.2—spacer region—transmembrane domain—T cell signaling domain—COOH.
32. The artificial T cell receptor of any one of claims 14 to 31 which comprises the amino acid sequence according to SEQ ID NO: 41 or a fragment thereof, or a variant of said amino acid sequence or fragment.
33. A nucleic acid comprising a nucleotide sequence encoding the T cell receptor chain or T cell receptor of any one of claims 10 to 13 or encoding the artificial T cell receptor of any one of claims 14 to 32.
34. A cell comprising the T cell receptor chain or T cell receptor of any one of claims 10 to 13 or the artificial T cell receptor of any one of claims 14 to 32 and/or comprising a nucleic acid comprising a nucleotide sequence encoding the T cell receptor chain or T cell receptor or encoding the artificial T cell receptor.
35. A method of producing an immunoreactive cell comprising the step of transducing a T cell with a nucleic acid of claim 33.
36. A pharmaceutical composition comprising one or more of: (i) the peptide of any one of claims 1 to 3; (ii) the nucleic acid of any one of claims 4, 5 and 33; (iii) the cell of any one of claims 6, 7 and 34; (iv) the immunoreactive cell of claim 8; (v) the binding agent of claim 9; (vi) the T cell receptor of any one of claims 10 to 13; and (vii) the artificial T cell receptor of any one of claims 14 to 32.
37. The pharmaceutical composition of claim 36 which further comprises a pharmaceutically acceptable carrier.
38. A method of treating or preventing a cancer disease comprising administering to a patient the pharmaceutical composition of claim 36 or 37.
39. The peptide of any one of claims 1 to 3, the nucleic acid of any one of claims 4, 5 and 33, the cell of any one of claims 6, 7 and 34, the immunoreactive cell of claim 8, the binding agent of claim 9, the T cell receptor of any one of claims 10 to 13, or the artificial T cell receptor of any one of claims 14 to 32 for use in therapy, in particular for use in treating or preventing cancer.
40. A method for inducing an immune response in a subject, comprising administering to the subject a pharmaceutical composition of claim 36.
41. A method for stimulating, priming and/or expanding T cells, comprising contacting T cells with one or more of: the peptide of any one of claims 1 to 3, the nucleic acid of claim 4 or 5 and/or the cell of claim 6 or 7.
42. A method of killing cancer cells in a subject, comprising the step of providing to the subject a therapeutically effective amount of the peptide of any one of claims 1 to 3, the nucleic acid of any one of claims 4, 5 and 33, the cell of any one of claims 6, 7 and 34, the immunoreactive cell of claim 8, the binding agent of claim 9, the T cell receptor of any one of claims 10 to 13, or the artificial T cell receptor of any one of claims 14 to 32.
43. A method for determining an immune response in a subject, comprising determining T cells reactive with a peptide of any one of claims 1 to 3 in a biological sample isolated from the subject.
Description
FIGURES
[0415]
[0416]
[0417]
[0418]
[0419]
[0420]
[0421]
[0422]
[0423] CAR-RNA. 20 h after electroporation cells were stained with a PE-conjugated anti-CD8 antibody and idiotype-specific flurochrome-conjugated antibodies specific for the CLDN18.2-CAR and the CLDN6-CAR, respectively. Cells were gated on single CD8+T lymphocytes.
[0424]
[0425]
[0426]
[0427]
EXAMPLES
[0428] The techniques and methods used herein are described herein or carried out in a manner known per se and as described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2.sup.nd Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. All methods including the use of kits and reagents are carried out according to the manufacturers' information unless specifically indicated.
Example 1: Materials and Methods
Cell Lines and Reagents
[0429] The human chronic myeloid leukemia cell line K562 (Lozzio, C. B. & Lozzio, B. B (1975), Blood 45, 321-334) stably transfected with HLA-A*0201 (Britten, C. M. et al. (2002), J. Immunol. Methods 259, 95-110) (referred to e.g. as K562-A2) and used for TCR validation assays was cultured under standard conditions. The primary human newborn foreskin fibroblast cell line CCD-1079Sk (ATCC No. CRL-2097) was cultured according to the manufacturers' instructions.
Peripheral Blood Mononuclear Cells (PBMCs), Monocytes and Dendritic Cells (DCs)
[0430] PBMCs were isolated by Ficoll-Hypaque (Amersham Biosciences, Uppsala, Sweden) density gradient centrifugation from buffy coats. HLA allelotypes were determined by PCR standard methods. Monocytes were enriched with anti-CD14 microbeads (Miltenyi Biotech, Bergisch-Gladbach, Germany). Immature DCs (iDCs) were obtained by differentiating monocytes for 5 days in cytokine-supplemented culture medium as described in Kreiter et al. (2007), Cancer Immunol. Immunother., CII, 56, 1577-87.
Peptides and Peptide Pulsing of Stimulator Cells
[0431] Pools of N- and C-terminally free 15-mer peptides with 11 amino acid overlaps corresponding to sequences of Claudin-18.2 or HIV-gag (referred to as antigen peptide pool) were synthesized by standard solid phase chemistry (JPT GmbH, Berlin, Germany) and dissolved in DMSO to a final concentration of 0.5 mg/ml. Nonamer peptides were reconstituted in PBS 10% DMSO. For pulsing stimulator cells were incubated for 1 h at 37° C. in culture medium using different peptide concentrations.
Vectors for In Vitro Transcription (IVT) of RNA
[0432] All constructs are variants of the previously described pST1-sec-insert-2βgUTR-A(120)-Sap1 plasmid (Holtkamp, S. et al. (2006), Blood 108, 4009-4017). For generation of plasmids encoding murine TCR chains, cDNAs coding for murine TCR-α, β.sub.1 and β.sub.2 constant regions were ordered from a commercial provider and cloned analogously (GenBank accession numbers M14506, M64239 and X67127, respectively). Specific V(D)J PCR products were introduced into such cassettes to yield full-length TCR chains (referred to as pST1-murineTCRαβ-2βgUTR-A(120)).
[0433] Full-length CLDN18.2, CLDN18.2 aa 1-80 and CLDN6 antigens were cloned linked to the MHC class I trafficking signal (MITD) in pST1 plasmids previously described (Kreiter, S. et al. (2008), J. Immunol. 180, 309-318).
Generation of In Vitro Transcribed (IVT) RNA and Transfer Into Cells
[0434] Generation of IVT RNA was performed as described previously (Holtkamp, S. et al. (2006), Blood 108, 4009-4017) and added to cells suspended in X-VIVO 15 medium (Lonza, Basel, Switzerland) in a pre-cooled 4-mm gap sterile electroporation cuvette (Bio-Rad Laboratories GmbH, Munich, Germany). Electroporation was performed with a Gene-Pulser-II apparatus (Bio-Rad Laboratories GmbH, Munich, Germany) (T cells: 450 V/250 μF; K562-A2: 200 V/300 μF).
In vivo Priming of T Cells by Intranodal Immunization of HLA A2.1/DR1 Mice With IVT RNA
[0435] T cells of A2/DR1 mice (Pajot A. et al. (2004), Eur. J. Immunol. 34, 3060-69) were primed in vivo against the antigen of interest by repetitive intranodal immunization using antigen-encoding IVT RNA (Kreiter S. et al. (2010), Cancer Research 70, 9031-40). For intranodal immunizations, mice were anesthetized with xylazine/ketamine. The inguinal lymph node was surgically exposed, 10 μL RNA (20 μg) diluted in Ringer's solution and Rnase-free water were injected slowly using a single-use 0.3-ml syringe with an ultrafine needle (31G, BD Biosciences), and the wound was closed. After six immunization cycles the mice were sacrificed and spleen cells were isolated.
Harvest of Spleen Cells
[0436] Following their dissection under sterile conditions, the spleens were transferred to PBS containing falcon tubes. The spleens were mechanically disrupted with forceps and the cell suspensions were obtained with a cell strainer (40 μm). The splenocytes were washed with PBS centrifuged and resuspended in a hypotonic buffer for lysis of the erythrocytes. After 5 min incubation at RT, the reaction was stopped by adding 20-30 ml medium or PBS. The spleen cells were centrifuged and washed twice with PBS.
Single-Cell Sorting of Antigen-Specific CD8+ T Cells After CD137 Staining
[0437] For antigen-specific restimulation 2.5×10{circumflex over ( )}6/well spleen cells from immunized A2/DR1 mice were seeded in a 24-well plate and pulsed with a pool of overlapping peptides encoding the antigen of interest or a control antigen. After 24 h incubation cells were harvested, stained with a FITC-conjugated anti-CD3 antibody, a PE-conjugated anti-CD4 antibody, a PerCP-Cy5.5-conjugated anti-CD8 antibody and a Dylight-649-conjugated anti-CD137 antibody. Sorting was conducted on a BD FACS Aria flow cytometer (BD Biosciences). Cells positive for CD137, CD3 and CD8 were sorted, one cell per well was harvested in a 96-well V-bottom-plate (Greiner Bio-One) containing human CCD-1079Sk cells as feeder cells, centrifuged at 4° C. and stored immediately at −80° C.
RNA Extraction, SMART-Based cDNA Synthesis and Unspecific Amplification From Sorted Cells
[0438] RNA from sorted T cells was extracted with the RNeasy Micro Kit (Qiagen, Hilden, Germany) according to the instructions of the supplier. A template-switch protocol was used for cDNA synthesis: Mint Reverse Transcriptase (Evrogen JSC) was combined with oligo(dT)-T-primer long for priming of the first-strand synthesis reaction and TS-short (Eurofins Genomic) introducing an oligo(riboG) sequence to allow for creation of an extended template by the terminal transferase activity of the reverse transcriptase and for template switch (Matz, M. et al. (1999) Nucleic Acids Res. 27, 1558-1560). First strand cDNA synthesized according to the manufacturer's instructions was subjected to 21 cycles of amplification with 5 U PfuUltra Hotstart High-Fidelity DNA Polymerase (Agilent Technologies) and 0.48 μM primer TS-PCR primer in the presence of 200 μM dNTP (cycling conditions: 2 min at 95° C. for, 30 s at 94° C., 30 s at 65° C., 1 min at 72° C. for, final extension of 6 min at 72° C.). Successful amplification of TCR genes was controlled with murine TCR-β constant region specific primers and consecutive clonotype-specific murine Vα-/Vβ-PCRs were only performed if strong bands were detected.
Design of PCR Primers for TCR Amplification
[0439] For design of murine TCR consensus primers, all functional murine TCR-Vβ and -Vα genes as listed in the ImMunoGeneTics (IMGT) database (http://www.imgt.org) together with their corresponding leader sequences were aligned with the BioEdit Sequence Alignment Editor (e.g. http://www.bio-soft.net). Forward primers of 24 to 27 bp length with a maximum of 3 degenerated bases, a GC-content between 40-60% and a G or C at the 3′ end were designed to anneal to as many leader sequences as possible and equipped with a 15 bp 5′ extension featuring a rare restriction enzyme site and Kozak sequence. Reverse primers were designed to anneal to the first exons of the constant region genes, with primer mTRACex_as binding to sequences corresponding to amino acids 24 to 31 of Ca and mTRBCex1_as to amino acids (aa) 8 to 15 in Cβ1 and Cβ2. Both oligonucleotides were synthesized with a 5′ phosphate. Primers were bundled in pools of 2-6 forward oligos with identical annealing temperature.
PCR Amplification and Cloning of V(D)J Sequences
[0440] 6 μl of preamplified cDNA from isolated T cells was subjected to 40 cycles of PCR in the presence of 0.6 μM mVα-/mVβ-specific oligo pool, 0.6 μM mCα- or mCβ-oligo, 200 μM dNTP and 5 U PfuUltra II Fusion HS DNA Polymerase (Agilent; cycling conditions: 1 min at 95° C., 30 s at 94° C., 30 s annealing temperature, 30 s at 72° C., final extension time of 3 min at 72° C.). PCR products were analyzed using Qiagen's capillary electrophoresis system. Samples with bands at 470-550 bp were size fractioned on agarose gels, the bands excised and purified using a Gel Extraction Kit (Qiagen, Hilden, Germany). Sequence analysis was performed to reveal the sequence of both the V(D)J domain and β constant region, as mTRBCex1_as and mTRBCex1_as primer, respectively, match to both TCR constant region genes Cβ1 and Cβ2 in mouse. DNA was digested and cloned into the IVT vectors containing the appropriate backbone for a complete murine TCR-α/β chain.
Flow Cytometric Analyses
[0441] Cell surface expression of transfected TCR genes was analyzed by flow cytometry using fluorochrome-conjugated anti-TCR antibody against the appropriate variable region family or the constant region of the TCR β chain (Beckman Coulter Inc., Fullerton, USA) in combination with antibodies directed against CD3, CD8 or CD4 (BD Biosciences). Cell surface expression of transfected CARs was analyzed using a fluorochrome-conjugated idiotype-specific antibodies (Ganymed Pharmaceuticals) recognizing the scFv fragments contained in the respective CAR construct. Flow cytometric analysis was performed on a FACS CANTO II flow cytometer using the FACS Diva software (BD Biosciences).
Luciferase Cytotoxicity Assay
[0442] For assessment of cell-mediated cytotoxicity a bioluminescence-based assay was used as an alternative and optimization to 51Cr release. In contrast to the standard chromium release assay, this assay measures lytic activity of effector cells by calculating the number of viable luciferase expressing target cells following coincubation. The target cells were stably or transiently transfected with the luciferase gene coding for the firefly luciferase from firefly Photinus pyralis (EC 1.13.12.7). Luciferase is an enzyme catalyzing the oxidation of luciferin. The reaction is ATP-dependent and takes place in two steps: [0443] luciferin+ATP.fwdarw.luciferyl adenylate+PPi [0444] luciferyl adenylate+O2.fwdarw.oxyluciferin+AMP+light
[0445] Target cells were plated at a concentration of 10.sup.4 cells per well in white 96-well plates (Nunc, Wiesbaden, Germany) and were cocultivated with varying numbers of TCR-transfected T cells in a final volume of 100 μl. 3 h later 50 μl of a D-Luciferin (BD Biosciences) containing reaction mix (Luciferin (1 μg/μl), HEPES-buffer (50 mM, pH), Adenosine 5′-triphosphatase (ATPase, 0.4 mU/μl, Sigma-Aldrich, St. Louis, USA) was added to the cells. By addition of ATPase to the reaction mix luminescence resulting from luciferase released from dead cells was diminished.
[0446] After a total incubation time of 4 h bioluminescence emitted by viable cells was measured using the Tecan Infinite 200 reader (Tecan, Crailsheim, Germany). Cell-killing activity was calculated in regard to luminescence values obtained after complete cell lysis induced by the addition of 2% Triton-X 100 and in relationship to luminescence emitted by target cells alone. Data output was in counts per second (CPS) and percent specific lysis was calculated as follows:
(1−(CPS.sub.exp−CPS.sub.min)/(CPS.sub.max−CPS.sub.min)))*100.
[0447] Maximum luminescence (maximum counts per second, CPSmax) was assessed after incubating target cells without effectors and minimal luminescences (CPSmin) was assessed after treatment of targets with detergent Triton-X-100 for complete lysis.
ELISPOT (Enzyme-Linked ImmunoSPOT Assay)
[0448] Microtiter plates (Millipore, Bedford, MA, USA) were coated overnight at room temperature either with an anti-human IFNγ antibody 1-Dlk (Mabtech, Stockholm, Sweden) or overnight at 4° C. with an anti-murine IFNγ antibody AN18 (Mabtech) and blocked with 2% human albumin (CSL Behring, Marburg, Germany) or with murine culture medium. In the murine setting 5×10.sup.5 spleen cells were distributed per well, while in the human setting 2-5×10.sup.4/well antigen presenting stimulator cells were plated in triplicates together with 0.3-3×10.sup.5/well TCR-transfected CD4+ or CD8+ effector cells 24 h after electroporation. The plates were incubated overnight (37° C., 5% CO2), washed with PBS 0.05% Tween 20, and incubated for 2 hours with the anti-human IFNγ biotinylated mAB 7-B6-1 (Mabtech) or anti -murine IFNγ biotinylated mAb R4-6A2 (Mabtech) at a final concentration of 1 μg/ml at 37° C. Avidin-bound horseradish peroxidase H (Vectastain Elite Kit; Vector Laboratories, Burlingame, USA) was added to the wells, incubated for 1 hour at room temperature and developed with 3-amino-9-ethyl carbazole (Sigma, Deisenhofen, Germany).
CFSE (Carboxyfluorescein Succinimidyl Ester) Proliferation Assay
[0449] CD8.sup.+ T cells were transfected with CAR RNA and about 20 h later labeled with 0.8 μM CFSE. Labeled T cells were washed and cocultured with RNA-transfected autologous iDCs (E:T ratio=10:1). After 4 days of coculture cells were harvested and proliferation was analyzed by flow cytometry based on the progressive halving of CFSE fluorescence within daughter cells following cell divisions.
Animals
[0450] BALB/c mice were purchased from Javier Labs. Age (8 weeks old) and sex (female) matched animals were used throughout the experiments. Congenic BALB/c-Thy1.1 mice were bred in the animal facility of the BioNTech AG, Germany
Retroviral Gene Manipulation and Preparation of CAR T Cells for Adoptive T Cell Transfer
[0451] Splenocytes of BALB/c-Thy1.1 mice were isolated and pre-activated by 2 μg/mL soluble anti-CD3 (eBioscience) and 1 μg/mL soluble anti-CD28 (Novus Biologicals) in the presence of 5 ng/mL rh IL-7 and 10 ng/mL rh IL-15 (both Miltenyi). 24 h and 48 h after pre-activation, T cells were retrovirally (MLV-E) transduced with tricistronic vector encoding CLDN18.2-CAR-effLuc-GFP using RetroNectin-technique (Takara). Transduced T cells were then 3 days expanded in the presence of 5 ng/mL rh IL-7 and 10 ng/mL rh IL-15 and were subsequently ficoll cleaned with Ficoll-Paque PREMIUM (1.084) prior adoptive transfer into mice.
Mouse Experiments
[0452] 5×10.sup.6 CLDN18.2 CAR transduced BALB/c-Thy1.1.sup.+ T cells were intravenously (i.v.) transferred into BALB/c mice. Subsequently, mice were i.v. vaccinated with an F12:RNA ratio of 1.3:2 of RNA.sub.(Lip) 24 hours after adoptive T cells transfer (ACT). Whole body bioluminescence imaging was performed.
In Vivo Bioluminescence Imaging (BLI)
[0453] Expansion of CLDN18.2-CAR-effLuc-GFP transduced T cells was evaluated by in vivo bioluminescence imaging using the IVIS Lumina imaging system (Caliper Life Sciences). Briefly, 5 min after injection of an aqueous solution of D-luciferin (80 mg/kg body weight; Perkin Elmer), emitted photons were quantified (integration time of 1 min). The intensity of transmitted light originating from luciferase expressing cells within the animal was represented as a greyscale image, where black is the least intense and white to dark-grey the most intense bioluminescence signal. Greyscale reference images of mice were obtained under LED low light illumination. The images were superimposed using the Living Image 4.0 software.
Example 2: Isolation of High-Affinity HLA-A*02-Restricted Murine TCRs Specific for Claudin-18.2
[0454] We validated the immunogenic potential of CLDN18.2 in A2/DR1 mice by repetitive intranodal immunization with IVT-RNA encoding aa 1-80 of CLDN18.2. The human CLDN18 gene has two alternative first exons, giving rise to two protein isoforms (CLDN18.1 and CLDN18.2) differing in the N-terminal 69 amino acids (
[0455] Significant frequencies of CLDN18.2-specific T cells could be induced In all three mice by RNA immunization, whereas T cell reactivity was focused on two CLDN18.2 peptides predicted to bind to HLA-A*0201(CLDN18.2-A2-5 and —CLDN18.2-A2-6).
[0456] For isolation of CLDN18.2-specific T cells, spleen cells of immunized mice were restimulated in-vitro and single cells were isolated by flowcytometry based on the activation-induced upregulation of CD137 (
[0457] CLDN18.2-specific CD8+T cells could be retrieved from all three immunized A2/DR1 mice and a total of 6 CLDN18.2-specific TCRs were cloned from single-sorted murine T cells. TCRs were subjected to immunological validation assays, which revealed that all six CLDN18.2-TCRs recognized one or both of the two HLA-A*0201-restricted epitopes CLDN18.2 aa 7-15 (CLDN18.2-A2-5) and CLDN18.2 aa 8-16 (CLDN18.2-A2-6), which were previously identified by ex-vivo ELISPOT analysis (
Example 3: Generation and In-Vitro Validation of a Claudin-18.2-Specific CAR
[0458] We generated a second generation CAR targeting CLDN18.2 that contains the signaling and costimulatory moieties of CD3 and CD28, respectively. A deletion of the lck binding moiety in the CD28 endodomain abrogates IL2 secretion upon CAR engagement to prevent induction of regulatory T cells (Kofler D. M. et al., (2011) Molecular Therapy 19 (4), 760-767). A modification of the IgG1 Fc ‘spacer’ domain in the extracellular moiety of the CAR avoids ‘off-target’ activation and unintended initiation of an innate immune response (Hombach A. et al., (2010) Gene Therapy 17, 1206-1213).
[0459] To analyze the specific lysis of CLDN18.2-expressing target cells by CLDN18.2-CAR T cells a luciferase-based cytotoxicity assay was performed. CD8+ T cells were preactivated and transfected with IVT-RNA encoding either the CLDN18.2-CAR or the CLDN6-specific CAR as a control. CAR surface expression was confirmed after staining with fluorochrome-conjugated antibodies by flowcytometry (
[0460] In order to analyze, if the CLDN18.2-CAR-mediated lysis of CLDN18.2-expressing target cells may be inhibited by addition of an idiotype-specific antibody, CAR T cells were preincubated with or without the antibody that specifically binds to the scFv fragment contained in the CLDN18.2-CAR before coculture with target cells was initiated and lysis was analyzed using a luciferase-based cytotoxicity assay (
[0461] The CLDN18.2-CAR-mediated lysis of CLDN18.2-expressing target cells could be efficiently inhibited even with a high E:T ratio of 30:1 by blocking the binding of the CLDN18.2-CAR to its target antigen. No inhibition of the CLDN6-CAR mediated lysis could be observed confirming the selective binding of the antibody to the CLDN18.2-CAR. This experiment confirmed on the one hand that the CLDN18.2-CAR-mediated lysis is exclusively dependent on the CLDN18.2 specificity of the CAR and on the other hand that the idiotype-specific antibody that is used for CLDN18.2-CAR detection could in principle also be applied for inhibition of CLDN18.2-CAR T cells in-vivo in case of a severe adverse event.
[0462] An essential prerequisite for the anti-tumoral efficacy of CAR-engineered T cells is their ability to proliferate and persist in the patient. In order to analyze, if CLDN18.2-CAR T cells efficiently proliferate in response to CLDN18.2 ectopically expressed in iDCs, a carboxyfluorescein succinimidyl ester (CFSE) based in vitro co-culture assay was performed. CD8.sup.+ T cells transfected with IVT-RNA encoding the CLDN18.2-CAR were labeled with CFSE and co-cultured with autologous iDCs transfected with IVT-RNA encoding either CLDN18.2 or the control antigens CLDN9 or CLDN6. CAR surface expression was analyzed by flow cytometry using a fluorochrome-coupled anti-idiotype- specific antibody (
[0463] The potency of the CLDN18.2-CAR to mediate antigen-specific activation and expansion of CAR bearing T cells in vivo was examined in a syngenic mouse model. To follow the fate of adoptively transferred CAR-T cells in vivo, a tricistronic retroviral vector was used which encodes luciferase (effLuc) and eGFP reporter genes downstream of CLDN18.2-CAR separated by viral T2A sequences.
[0464] Naïve BALB/c mice were engrafted with CLDN18.2-CAR transduced murine T cells. At the day of transfer, CLDN18.2-CAR expression on transduced T cells was assessed by flow cytometry using fluorochrome-coupled anti-idiotype-specific antibody in combination with eGFP reporter expression. The CLDN18.2-CAR was highly expressed in about 36% of CD8.sup.+ and in about 45% of CD4.sup.+ T cells (
TABLE-US-00001 CLDN18.2-specific T cell epitopes A2-1 (aa 68-76) (SEQ ID NO: 2) TLLGLPAML A2-2 (aa 71-79) (SEQ ID NO: 3) GLPAMLQAV A2-3 (14-22) (SEQ ID NO: 4) SLIGIAGII A2-4 (17-25) (SEQ ID NO: 5) GIAGIIAAT A2-5 (7-15) (SEQ ID NO: 6) QGLGFVVSL A2-6 (8-16) (SEQ ID NO: 7) GLGFVVSLI CLDN18.2-specific T cell receptors mTCR.sub.CD8-CL18#2 >Alpha V12D.1 J33 C (MN lacks N-terminal; V.fwdarw.C und S.fwdarw.C) (SEQ ID NO: 8) MRPGTCSVLVLLLMLRRSNGDSVTQTEGLVTVTEGLPVKLNCTYQTTYLTIAFFWYVQ YLNEAPQVLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALMDSNY QLIWGSGTKLIIKPDIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDK TVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNL NFQNLSVMGLRILLLKVAGFNLLMTLRLWSS* >Beta V13.3 D1 J1.4*02 C1 (SEQ ID NO: 9) MGSRLFFVVLILLCAKHMEAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDT GHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSINERLF FGHGTKLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNG KEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPE GSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVMA MVKRKNS* mTCR.sub.CD8-CL18#4 >Alpha V6D.7*04 J26 C (S.fwdarw.F) (SEQ ID NO: 10) MNSFPGFMTVMLLIFTRAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYP GEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALGDYAQG LTFGLGTRVSVFPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKT VLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNL NFQNLSVMGLRILLLKVAGFNLLMTLRLWSS* >Beta V2 D2 J2.7 C2 (CASSQEWGGYEQYF) (SEQ ID NO: 11) MGSIFLSCLAVCLLVAGPVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAK KPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSQEWGG YEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGL VLMAMVKKKNS* mTCR.sub.CD8-CL18#5 >Alpha V6D.7*04 J47 C (N.fwdarw.D und S.fwdarw.F) (SEQ ID NO: 12) MDSFPGFMTVMLLIFTRAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPTLFWYVQYP GEGPQLLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALSVDYAN KMIFGLGTILRVRPHIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDK TVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNL NFQNLSVMGLRILLLKVAGFNLLMTLRLWSS* >Beta V1 D2 J2.7 C2 (SEQ ID NO: 13) MWQFCILCLCVLMASVATDPTVTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWY QQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCS PLTGSYEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHV ELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHG LSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVL VSGLVLMAMVKKKNS* mTCR.sub.CD8-CL18#8 >Alpha V8D.2*02 or V8N.2 J31 C (SEQ ID NO: 14) MNRFLGISLVTLWFQVAWAKSQWGEENLQALSIQEGEDVTMNCSYKTYTTVVQWYRQ KSGKGPAQLILIRSNEREKRSGRLRATLDTSSQSSSLSITGTLATDTAVYFCATDNRIFFG DGTQLVVKPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLD MKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQN LSVMGLRILLLKVAGFNLLMTLRLWSS* >Beta V23 D2 J2.7 C2 (SEQ ID NO: 15) MGARLICYVALCLLGAGSFDAAVTQKPRYLIKMKGQEAEMKCIPEKGHTAVFWYQQK QSKELKFLIYFQNQQPLDQIDMVKERFSAVCPSSSLCSLGIRTCEAEDSALYLCSSSQSGG YEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGL VLMAMVKKKNS* mTCR.sub.CD8-CL18#9 >Alpha V9N.3 J21 C (P.fwdarw.S) (SEQ ID NO: 16) MLLALLSVLGIHFLLRDAQAQSVTQPDARVTVSEGASLQLRCKYSYFGTPYLFWYVQY PRQGLQLLLKYYPGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDWAVYFCAVSKY YNVLYFGSGTKLTVEPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFIT DKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS* >Beta V2 D2 J2.7 C2 (CASSQDQGGQGQYF) (SEQ ID NO: 17) MGSIFLSCLAVCLLVAGPVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAK KPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSQDQGG QGQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGL VLMAMVKKKNS* mTCR.sub.CD8-CL18#12 >Alpha V6.3*02 or V6D.3 J26 C (N.fwdarw.T) (SEQ ID NO: 18) MNTSPALVTVMLFILGRTHGDSVIQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYS GEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAIGNYAQGL TFGLGTRVSVFPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTV LDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNF QNLSVMGLRILLLKVAGFNLLMTLRLWSS* >Beta V2 D2 J2.7 C2 (CASSPDWGAEYEQYF) (SEQ ID NO: 19) MGSIFLSCLAVCLLVAGPVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAK KPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSPDWGA EYEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELS WWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSE EDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVS GLVLMAMVKKKNS*