COMPOUNDS AND METHODS TARGETING INTERLEUKIN-34
20210363232 · 2021-11-25
Inventors
- Marcio Chedid (Fishers, IN)
- Victor H. Obungu (McCordsville, IN, US)
- Andrew Dixon SKORA (Solana Beach, CA, US)
- Ming Ye (Carmel, IN, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
G01N33/577
PHYSICS
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/71
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
C07K16/24
CHEMISTRY; METALLURGY
G01N33/577
PHYSICS
Abstract
The present invention relates to IL-34 antibodies, compositions comprising the same, and methods of using the antibodies and or compositions thereof for treating immune-mediated diseases such as neurodegenerative diseases, for example Alzheimer's Disease or a tauopathy disease.
Claims
1. An antibody that binds human IL-34 wherein the antibody comprises a heavy chain variable region (VH) and a light chain variable region (VL), wherein the VH comprises heavy chain complementarity determining regions (HCDR) HCDR1, HCDR2, and HCDR3, and the VL comprises light chain complementarity determining regions (LCDR) LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 5, the HCDR2 comprises SEQ ID NO: 6, the HCDR3 comprises SEQ ID NO: 7, the LCDR1 comprises SEQ ID NO: 8, the LCDR2 comprises SEQ ID NO: 9, and the LCDR3 comprises SEQ ID NO: 10.
2. The antibody of claim 1, wherein the VH comprises SEQ ID NO: 3 and the VL comprises SEQ ID NO: 4.
3. The antibody of claim 1, wherein the antibody comprises a heavy chain (HC) comprising SEQ ID NO: 1 and a light chain (LC) comprising SEQ ID NO: 2.
4. An antibody that binds human IL-34 comprising a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 15, the HCDR2 comprises SEQ ID NO: 16, the HCDR3 comprises SEQ ID NO: 17, the LCDR1 comprises SEQ ID NO: 8, the LCDR2 comprises SEQ ID NO: 9, and the LCDR3 comprises SEQ ID NO: 10.
5. The antibody of claim 4, wherein the VH comprises SEQ ID NO: 14 and the VL comprises SEQ ID NO: 4.
6. The antibody of claim 4, wherein the antibody comprises a HC comprising SEQ ID NO: 13 and a LC comprising SEQ ID NO: 2.
7. An antibody that binds murine IL-34 wherein the antibody comprises a VH and a VL, wherein the VH comprises HCDR1, HCDR2, and HCDR3, and the VL comprises LCDR1, LCDR2, and LCDR3, wherein the HCDR1 comprises SEQ ID NO: 23, the HCDR2 comprises SEQ ID NO: 24, the HCDR3 comprises SEQ ID NO: 25, the LCDR1 comprises SEQ ID NO: 26, the LCDR2 comprises SEQ ID NO: 27, and the LCDR3 comprises SEQ ID NO: 28.
8. The antibody of claim 7, wherein the VH comprises SEQ ID NO: 21 and the VL comprises SEQ ID NO: 22.
9. The antibody of claim 7, wherein the antibody comprises a HC comprising SEQ ID NO: 19 and a LC comprising SEQ ID NO: 20.
10. A nucleic acid comprising a sequence encoding a SEQ ID NO selected from one or more of the group consisting of: 11, 12, 18, 29, and 30.
11. A vector comprising the nucleic acid of claim 10.
12. The vector of claim 11, wherein the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 11 or 18, and a second nucleic acid sequence encoding SEQ ID NO: 12.
13. The vector of claim 11, wherein the vector comprises a first nucleic acid sequence encoding SEQ ID NO: 29, and a second nucleic acid sequence encoding SEQ ID NO: 30.
14. A composition comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 11 or 18, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 12.
15. A composition comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 29, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 30.
16. A cell comprising the vector of claim 12 or 13.
17. A cell comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 11 or 18, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 12.
18. A cell comprising a first vector comprising a nucleic acid sequence encoding SEQ ID NO: 29, and a second vector comprising a nucleic acid sequence encoding SEQ ID NO: 30.
19. The cell of claim 16 wherein the cell is a mammalian cell.
20. A process of producing an antibody comprising culturing the cell of claim 16 under conditions such that the antibody is expressed and recovering the expressed antibody from the culture medium.
21. An antibody produced by the process of claim 20.
22. A pharmaceutical composition comprising the antibody of claim 1 and a pharmaceutically acceptable excipient, diluent, or carrier.
23. A method of treating an immune-mediated disease in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the antibody of claim 1.
24. The method of claim 23, wherein the immune-mediated disease is selected from the group consisting of Alzheimer's Disease; a tauopathy disease; Sjogren's syndrome (SS); Rheumatoid arthritis (RA); inflammatory bowel disease (IBD), atopic dermatitis, kidney disease, sepsis, and/or non-alcoholic fatty liver disease (NAFLD).
25. The method of claim 23 wherein the immune-mediated disease is Alzheimer's Disease.
26. A method of determining the human IL-34 level in a bodily fluid comprising: (a) contacting the bodily fluid with an anti-human IL-34 diagnostic monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to human IL-34 consisting of the amino acid sequence as in SEQ ID NO: 41, the antibody, or antigen-binding fragment thereof, comprising: light chain complementarity determining regions LCDR1, LCDR2, and LCDR3 comprising the amino acid sequences (SEQ ID NO: 8), (SEQ ID NO: 9), and (SEQ ID NO: 10), respectively, and heavy chain complementarity determining regions HCDR1, HCDR2, and HCDR3 comprising the amino acid sequences (SEQ ID NO: 15), (SEQ ID NO: 16), and (SEQ ID NO: 17), respectively; (b) optionally, removing any non-specifically bound monoclonal antibody or, antigen-binding fragment thereof; and (c) detecting and/or quantifying the amount of monoclonal antibody, or antigen-binding fragment thereof, which is specifically bound to human IL-34.
27. The method of claim 26, wherein said bodily fluid is blood, serum or plasma, or cerebrospinal fluid, and said contacting occurs ex vivo.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0065]
[0066]
[0067]
[0068]
EXAMPLES
[0069] The following examples are offered to illustrate, but not to limit, the claimed invention. The results of the following assays demonstrate that the exemplified monoclonal antibodies, and/or antigen-binding fragments thereof of the present invention bind and/or neutralize IL-34, and therefore may be used for treating immune-mediated and inflammatory diseases described herein.
Example 1: Antibody Generation, Expression and Purification
[0070] A panel of human anti-IL-34 antibodies is obtained using human antibody phage display libraries and screened to identify reagents that could be effective IL-34 neutralizing antibodies. Mutations are systematically introduced into individual complementarity determining regions (CDRs) of each antibody and the resulting libraries are subjected to multiple rounds of selection with decreasing concentrations of antigen and/or increasing periods of dissociation, in order to isolate clones with improved affinities. The sequences of individual variants are determined and used to construct a combinatorial library which is subjected to an additional round of selection with increased stringency to identify additive or synergistic mutational pairings between the individual CDR regions. Individual combinatorial clones are sequenced, and binding characteristics are determined. In order to further increase the affinity to IL-34, these combinatorial clones are subjected to additional rounds of single and combinatorial mutagenesis. This screening can be conducted against human or mouse IL-34 to increase affinity against a selected species (for example Antibody 1 for human IL-34, and Antibody 3 for mouse IL-34). Selected antibodies can also be mutagenized to fix post-translational modifications such as methionine oxidation, while retaining binding affinity to IL-34. Additionally, framework (FW) substitutions can be made to the antibody to revert these FW1 sequences to their germline state in order to reduce potential immunogenicity risk.
[0071] Engineered and/or optimized anti-IL-34 antibodies referred to herein as Antibody 1, Antibody 2, and/or Antibody 3 are obtained, having the amino acid sequences of the variable regions of the heavy chain and light chain, and the complete heavy chain and light chain amino acid sequences, and the nucleotide sequences encoding the same, as listed below in the section entitled “Listing of Amino Acid and Nucleotide Sequences”. The SEQ ID NO's corresponding to these fragments are shown below in Table 1, as well as the light chain and heavy chain CDR amino acid sequences.
[0072] The exemplified anti-IL-34 antibodies of the present invention can be expressed and purified essentially as follows. An appropriate host cell, such as HEK 293, NS0 or CHO, can be either transiently or stably transfected with an expression system for secreting antibodies using an optimal predetermined HC:LC vector ratio (such as 1:3 or 1:2) or a single vector system encoding both the HC and the LC. Clarified media, into which the antibody has been secreted, is purified using any of many commonly-used techniques. For example, the medium may be applied to a Protein A or G column, for instance a Mab Select® column (GE Healthcare), or KappaSelect column (GE Healthcare) for Fab fragment, that has been equilibrated with a compatible buffer, such as phosphate buffered saline (pH 7.4). The column may be washed to remove nonspecific binding components. The bound antibody may be eluted, for example, by pH gradient (such as 20 mM Tris buffer, pH 7.0 to 10 mM sodium citrate buffer, pH 3.0, or phosphate buffered saline pH 7.4 to 100 mM glycine buffer, pH 3.0). Antibody fractions may be detected, such as by SDS-PAGE, and then may be pooled. The bound antibody is eluted, for example, by pH gradient (such as 0.1 M sodium phosphate buffer pH 6.8 to 0.1 M sodium citrate buffer pH 2.5). Antibody fractions are detected, such as by SDS-PAGE, and then are pooled. Further purification is optional, depending on the intended use. The antibody may be concentrated and/or sterile filtered using common techniques. Soluble aggregate and multimers may be effectively removed by common techniques, including size exclusion, hydrophobic interaction, or ion exchange, multimodal, or hydroxyapatite chromatography. The purity of the antibody after these chromatography steps is greater than 99%. The product may be immediately frozen at −70° C., or may be lyophilized, or preserved in 4° C. for immediate use. Amino acid SEQ ID NOs for exemplified human antibodies of the present invention are shown below in Table 1.
[0073] The expression plasmid contains cDNA versions of the LC and HC genes for Antibody 1 (for example, a DNA sequence of SEQ ID NO:12 encoding a HC of exemplified Antibody 1 presented in Table 1, and a DNA sequence encoding a LC amino acid sequence according to Table 1, for example, a DNA sequence of SEQ ID NO:13 encoding a LC of exemplified Antibody 1 presented in Table 1); and are expressed from a commonly-used and suitable construct for this purpose, such as one based on human cytomegalovirus major immediate early promoters. The LC and HC genes are flanked by inverted terminal repeat (ITR) sequences recognized by a transposase enzyme. The parent cell line is co-transfected with the expression plasmid and a transposase mRNA which enables transient expression of the transposase enzyme, to promote stable integration of the Antibody 1 gene expression cassette into the genomic DNA.
[0074] The selected bulk culture is subjected to single-cell cloning using Fluorescence-Activated Cell Sorting (FACS) technology. The clonally-derived cell lines are expanded and screened for Antibody 1 production. A clonally-derived cell line is selected and established. This cell line is generated without any animal component-containing materials and used for production.
[0075] Clarified medium, into which the antibody is secreted, is applied to a Protein A affinity column that is equilibrated with a compatible buffer, such as phosphate buffered saline (pH 7.4) or 20 mM Tris with 150 mM sodium chloride (pH 8.0). The column is washed with 1M NaCl to remove nonspecific binding components. Bound antibody is eluted, for example, with sodium citrate at pH (approx.) 3.5 and fractions are neutralized with 1M Tris buffer. Antibody fractions are detected, such as by SDS-PAGE or analytical size-exclusion, and then pooled. Soluble aggregate and multimers may be effectively removed by common techniques, including size exclusion, hydrophobic interaction, ion exchange, or hydroxyapatite chromatography. An exemplified anti-IL-34 antibody of the present invention is concentrated and/or sterile filtered using common techniques. The purity of an exemplified antibody after these chromatography steps is greater than 95%. An exemplified anti-IL-34 antibody of the present invention may be immediately frozen at −70° C. or stored at 4° C. for several months.
Example 2: Characterization of the Anti-IL-34 Antibodies
Binding Affinity to Human IL-34
[0076] Binding affinity of anti-IL-34 monoclonal antibodies of the present invention to human IL-34 including the leader sequence, or mature human IL-34, may be determined by methods known in the art. Except where noted, all reagents and materials may be purchased from Meso Scale Discovery (MSD®), and measurements may be performed at 37° C. Human and mouse IL-34 can be made and purified using IMAC and size exclusion chromatography or purchased from commercial suppliers. Human CSF1R Fc fusion protein (Exemplified compound D) is also made, purified by MabSelect™ SuRe™ (GE Healthcare), and further polished by size exclusion chromatography.
[0077] Briefly, usually a 2-fold or 3-fold dilution series of human, cyno or mouse IL-34 is prepared from a starting concentration of 40, or 50 or 60 or 80 or 100 or 120 nM to 100 fM; and each series includes an IL-34 blank control. Samples are prepared in 3% (w/v) Blocker A solution (MSD®, #R93AA-1) and a fixed final concentration of 5-50 pM of each exemplified antibody in Table 1 is added to each sample. An antibody only control is included. A volume of 50 μl of each protein-antibody sample is added to individual wells of a 96-well microtiter plate (Greiner, EK-20101). The plate is sealed with optical adhesive film (Thermo Fisher Scientific, #4311971) and incubated at 37° C. for 1-3 days to allow for sample equilibrium. On the day before analysis, each row of a 96-well MSD® Standard plate (MSD®, #L15XA) is coated with 30 μl of the corresponding IL-34 (as used in the titration series) at a concentration of 1 μg/ml in phosphate buffered saline (PBS). On the day of the experiment, the MSD® Standard plate is washed three times with 150 μl PBST (PBS with 0.05% Tween) and blocked with 150 μl of 3% Blocker A solution for 60 min at room temperature with shaking at 300 rpm on a MaxQ 4450 benchtop shaker (Thermo Fisher Scientific). Following three washes with PBST, 50 μl of each protein-antibody sample (prepared and incubated as described above) is added to the MSD® Standard plate and incubated for 150 seconds at 37° C. with shaking at 300 rpm. Following three times wash with PBST, 50 μl of 1 μg/ml SULFO-TAG labeled detection antibody prepared in 1% (w/v) Blocker A solution is added to the MSD® Standard plate and the plate is incubated at 37° C. for 150 seconds with shaking at 300 rpm. The plate is washed three more times with PBST followed by the addition of 150 μl/well of 1× Read buffer (MSD®, #R92TC-2). The MSD® Standard plate is read using a MESO Quickplex SQ 120/1300 instrument (Meso Scale Discovery). Data analysis is done using GraphPad Prism 8 (Version 8.0.0 for Windows, GraphPad Software, La Jolla Calif. USA, www.graphpad.com) and binding affinity (KO is determined using GraphPad Prism 8's integrated Four Parameter Logistic Curve Model. Results are provided in Table 2, 3 and 4.
TABLE-US-00005 TABLE 2 Binding affinity (K.sub.D) of antibody-human IL- 34 complexes at 37° C. Binding Affinity, K.sub.D (pM, 37° C., Mean ± STDEV, n = 5) Antigen Antibody (mature Human IL-34) Exemplified Antibody 1 59 ± 7 Exemplified Antibody 2 54 ± 7 Exemplified compound D 56 ± 12 (hCSF1R-Fc)
TABLE-US-00006 TABLE 3 Binding affinity (K.sub.D) of antibody-cyno IL- 34 complexes at 37° C. Binding Affinity, K.sub.D (pM, 37° C., Mean ± STDEV, n = 5) Antigen Antibody (Cyno IL-34) Exemplified Antibody 1 108 ± 25 Exemplified Antibody 2 152 ± 31
TABLE-US-00007 TABLE 4 Binding affinity (K.sub.D) of antibody-mouse IL34 complexes at 37° C. Binding Affinity, K.sub.D (pM, 37° C.) Antigen Antibody (Mouse IL-34) Exemplified Antibody 3 16
[0078] IL-34 binds to human CSF1R at approximately 50-100 pM affinity, necessitating a high-affinity antibody for effective neutralization of this cytokine in the CNS. Blocking IL-34 is believed to provide a useful means for disease modification while avoiding safety concerns associated with some existing immunomodulatory therapies. Therefore, neutralizing IL-34-mediated signaling represents a therapeutic approach for the management of neuroinflammation, microgliosis and neurodegenerative diseases, such as Alzheimer's Disease and other tauopathies and inflammatory diseases.
[0079] The results in Tables 2, 3, and 4 show that Antibodies 1, 2, and 3 possess high affinity for IL-34, and in particular, Antibody 1 and Antibody 2 show affinity for human IL-34 comparable to hCSF1R-Fc. Therefore, the Antibodies of the present invention possess binding properties that enable them to effectively neutralize IL-34 in vivo.
Physicochemical Attributes:
[0080] With respect to therapeutic antibody product attributes, including Chemical Stability, Photostability, 3× Slow Freeze/Thaw, Solubility, Antibody 1 exhibits a desirable combination of physicochemical attributes for use as a human therapeutic agent.
Stability Sample Preparation
[0081] To prepare stability samples, the aqueous antibody solution is dialyzed overnight at 4° C. into PBS, or 10 mM histidine/280 mM mannitol, pH 6 (H6M) or 10 mM histidine/150 mM NaCl, pH 6 (H6N), or 10 mM histidine/17% sucrose, pH 6.0 (H6S). Polysorbate-80 is added to final stability sample at 0.05% (“T”) when required. The formulated Antibody 1 is further concentrated to the desired concentration using an Amicon spin concentrator. Abbreviations: 4 wk=4-week; H6MT=10 mM histidine/280 mM mannitol/0.05% polysorbate, pH 6.0; H6ST=10 mM histidine/17% sucrose, 0.05% polysorbate, pH 6.0.
Chemical Stability
[0082] Antibody 1 demonstrates an acceptable rating for four weeks (4 wk) chemical stability hotspot check at 5 mg/ml in PBS. After four weeks of storage at 35° C. in PBS and compared to time 0 control, Antibody 1 shows 0.26% aggregate growth, as measured by analytical size exclusion chromatography (aSEC). Hotspots are checked by LC-MS (liquid chromatography-mass spectrometry) peptide mapping. The following degradation/hotspots changes are reported in PBS at 35° C. when compared to 4 wk/4° C. sample: isomerization of D104 (0.1%); cleavage of G93/D94/S95 (0.8%). Total change of CDR degradation was 0.9%.
High Concentration Stability Temperature Hold
[0083] Antibody 1 demonstrates an acceptable rating for the 4 wk high concentration stability at 100 mg/ml in H6MT. After 4 wk storage at 35° C. and compared to time 0 control, there is 1.0% aggregate growth, as measured by aSEC, and 0.9% increase in low molecular weight fragments under non-reducing conditions as determined by CE-SDS (capillary electrophoresis sodium dodecyl sulfate). Hotspots are checked by LC-MS peptide mapping. The change of following degradation/hotspots are reported in H6MT after 4 wk incubation at 35° C. and compared to the control of 4 wk incubation at 5° C.: deamidation of Q91 (0.1%); isomerization of D104 (0.1%); cleavage of G93/D94/S95 (0.5%). Total change of CDR degradation was 0.7%.
Solubility
[0084] Antibody 1 demonstrates an acceptable rating based on solubility assessment. The antibody achieves 150 mg/ml in both H6M and H6N formulations with no visible precipitation or phase separation observed after 3 days of storage at 5° C. followed by one week of storage at −5° C.
Photostability
[0085] Antibody 1 demonstrates an acceptable rating for photostability. Antibody in H6MT at 100 mg/ml is exposed to UV/VIS light (20% ICH guidelines) and compared to dark control sample. Chemical degradation is assessed by LC-MS peptide mapping. Total change in CDR hotspots analysis is 0.1%. Growth of cleavage was observed at residues G93/D94/S95 of light chain was 0.1%. Upon exposure to UV/VIS, the aggregate growth is 3.6% as determined by aSEC.
High Concentration Slow Freeze/Thaw Stability
[0086] Physical stability of Antibody 1 is assessed in slow freeze-thaw and demonstrates an acceptable rating when formulated in H6ST. After 3× slow freeze-thaw cycles in a shelf lyophilizer (VirTis SP Scientific), Antibody 1 shows 0.1% aggregate increase in H6ST determined by aSEC when compared to time 0 control.
Example 3: In Vitro Functional Characterization of the Anti-Human IL-34 Antibodies
Neutralization of IL-34 In Vitro
[0087] Antibodies of the present invention are tested for the ability to neutralize IL-34 binding and/or activity. Neutralization of IL-34 binding and/or activity by antibodies of the present invention may be assessed by one or more IL-34/CSF1R receptor binding assay formats, as well as IL-34 cell-based activity assays, for example, as described below.
[0088] Screening for neutralizing antibodies of IL-34/CSF1R binding may initially be done through an enzymatic assay. Such assays can use recombinantly expressed CSF1R extracellular domain proteins capable of binding to IL-34. These proteins can be bound to an ELISA plate in order to capture soluble IL-34. IL-34 can then be detected through either biotinylation of the antigen and detection via a streptavidin/neutravidin conjugated peroxidase or phosphatase enzyme. Alternatively, another detection technique may be used, such as an antibody that detects a his-tagged version of IL-34. Such neutralization assays involve pre-incubation of the antibody being assessed with the labeled IL-34 (for example, for 1 hour) before addition to the binding assay (as well as control samples in which no antibody targeting IL-34 is involved). Concentrations of labeled IL-34 near the 50% binding level (EC.sub.50) may be used, as well as varying concentrations (for example, in assessing a dose response of the antibody such as from about 100 micromolar down to about 1 picomolar). Antibody inhibition assessed for a range allows determination of potency (IC.sub.50).
Inhibition of IL-34 Induced Responses In Vitro
[0089] Neutralization of IL-34 activity by antibodies of the present invention may be assessed by one or more of the IL-34 cell-based assays, for example, as described below. The ability of antibodies of the present invention to neutralize human IL-34 induced luciferase reporter activity can be assessed in NIH-3T3 hCSF1R AP1, or 293 hCSF1R SRE cells, transfected with cDNAs to express human CSF1R, mouse CSF1R or cynomolgus CSF1R (human CSF1R (accession: NP_001275634.1); mouse CSF1R (accession: NM_001037859.2) and cyno CSF1R (accession: NC_022277). (The terms “cyno”, “cynomolgus” or “cynomolgus monkey” are used interchangeably, herein.) For example, 293/SRE cells stably overexpressing human CSF1R (hCSF1R) are dissociated in 0.05% trypsin-PBS and plated at 70,000 cells per 100 ml in tissue culture-treated 96 well plates. The following day, growth media is removed, and cells starved with DMEM-F12 (Dulbecco's Modified Eagle Medium: Nutrient Mixture F-12) supplemented with heat-inactivated 1% FBS (fetal bovine serum). 24 hr-post starve, cells are treated with 100 ng/ml human IL-34 or cyno IL-34 and multiple concentrations of either hCSF1R-Fc or Antibody 1 for 6 hr. Following incubation, cells are lysed with 50 ul Promega™ Glo™ Lysis Buffer (Promega™ E266A) for 5 min with gentle agitation. 50 ml of BrightGlo™ luminescence reagent (Promega™ E2620) is added and incubated on lysed cells for 2 min. Luminescence is read on Perkin Elmer Wallac 1420 Victor2™ Microplate Reader. The reduction in relative fluorescence units (RFUs) shown in Table 5, and
TABLE-US-00008 TABLE 5 Antibody 1 neutralization of human IL-34 induced luciferase reporter activity in hCSF1R expressing 293 SRE cells. hCSF1R-Fc Antibody 1 Concentration Average Standard Average Standard [nM] RLU deviation RLU deviation 133 1216 93.3 1180 18.4 26.6 995 153.4 1047.5 202.9 5.32 962 33.2 1117.5 38.9 1.064 2209 292.7 1494 70.7 0.213 7342.5 1282.0 7157.5 557.9 0.043 8472.5 727.6 7993 229.1 0.009 8185 459.6 8377.5 463.2 0.002 8253 365.6 8200.5 526.8 IC50 IC50 [nM] 95% CI [nM] [nM] 95% CI [nM] 0.5598 0.4047 to 0.7743 0.3852 0.3364 to 0.4412
[0090] Table 5 and
Ability of Antibody 1 to Neutralize the Dimerization of the CSF1R in the PathHunter® eXpress Dimerization Assay:
[0091] Human IL-34 neutralization can further be assessed by plating U2OS CSF1R/CSF1R cells (Path Hunter® eXpress Dimerization Assay, DiscoverX) in 96-well plates to assess the ability of anti-IL-34 antibodies to inhibit the dimerization of CSF1R. These assays utilize Enzyme Fragment Complementation (EFC) technology, where the b-galactosidase (b-gal) enzyme is split into two fragments, ProLink (PK) and Enzyme Acceptor (EA). Independently these fragments have no b-gal activity; however, when forced to complement through protein-protein interactions, they form an active b-gal enzyme. The PathHunter® eXpress Dimerization assay detects ligand-induced dimerization of two subunits of the CSF1R receptor-dimer pair. The cells have been engineered to co-express one CSF1R receptor subunit fused to Enzyme Donor (ED), and a second CSF1R dimer partner fused to Enzyme Acceptor (EA). Binding of human IL-34 to one receptor subunit induces it to interact with its dimer partner, forcing complementation of the two enzyme fragments. This results in the formation of a functional enzyme that hydrolyzes a substrate to generate a chemiluminescent signal. The reduction in relative fluorescence units (RFUs) shown in Table 6, and/or
TABLE-US-00009 TABLE 6 Ability of Antibody 1 to neutralize the dimerization of the CSF1R in the PathHunter ® eXpress Dimerization Assay. hCSF1R-Fc Antibody 1 Con Avg Con Avg [nM] RLU Stdev [nM] RLU Stdev 0.012 99405 5235.4 0.014 96495.5 3039.8 0.037 99090 1195.0 0.043 94760 1656.0 0.112 85642.5 832.3 0.128 81315.5 4488.0 0.335 68380 427.1 0.384 44394 91.9 1.004 40124 2375.9 1.151 29459.5 9280.7 3.011 29109 2643.2 3.453 27611.5 5296.9 9.033 26071.5 1119.4 10.360 28085.5 1103.8 27.100 34622.5 10704.9 31.080 27261 916.4 81.301 27529.5 3655.0 93.240 28438 1299.7 243.902 32958 973.0 279.720 29827 319.6 IC50 IC50 [nM] 95% CI [nM] [nM] 95% CI [nM] 0.3525 0.2595 to 0.4629 0.2256 0.1936 to 0.2630
Ability of Anti-IL-34 Antibodies to Inhibit ERK Phosphorylation in NIH-3T3/CSF1R Cells.
[0092] Alternatively, IL-34 neutralization can be determined by plating NIH-3T3/CSF1R cells in 96 well plates to assess the ability of anti-IL-34 antibodies to inhibit extracellular-signal-regulated kinase (ERK) phosphorylation. In this assay, cells are plated on day 1 in DMEM supplemented with 10% FBS and incubated overnight at 37 C. On day 2, medium is removed, cells are washed in serum-free DMEM and incubated for an additional 24-hour period in serum-free DMEM. On the third day, medium is removed and 1 μg/ml IL-34 is added to the cells for 5 minutes in the presence or absence of anti-IL-34 antibody. Phospho/Total ERK1/2 is assessed by the Whole Cell Lysate Kit (Meso Scale Discovery, cat #K15107D-3). The reduction in relative fluorescence units (RLUs) shown in Table 7 and/or
TABLE-US-00010 TABLE 7 Ability of Antibody 3 to inhibit ERK phosphorylation in NIH-3T3/CSF1R cells. CSF1R Antibody 3 Conc(nM) RLU Stdev Conc(nM) RLU Stdev 0 0.20982427 0.00490388 0 0.20982427 0.00490388 0.19 0.22678655 0.00463113 0.21 0.21266665 0.01065081 1 0.22612366 0.00094345 1.067 0.21877016 0.01222609 4.87 0.1696282 0.01027709 5.33 0.16963485 0.01577903 24.37 0.13803397 0.01444251 26.27 0.11909114 0.00324742 121.84 0.08925054 0.0052968 133.33 0.07254438 0.00527854 609.19 0.03167946 0.00344925 666.67 0.05997649 0.01118308 IC.sub.50(nM) 63.2 IC.sub.50(nM) 15.7
Ability of Anti-IL34 Antibodies to Inhibit IL-34 Induced Expression of CD163 in Human Monocytes by Flow Cytometry:
[0093] IL-34 neutralization can also be assessed by measuring the expression of the cell surface antigen CD163 in human monocytes after treatment with IL-34 by flow cytometry (See for example, Boulakirba, S., et al. IL-34 and CSF-1 display an equivalent macrophage differentiation ability but a different polarization potential. Sci Rep 8, 256 (2018). CD14-positive monocytes are treated with IL-34 for 72 hrs and CD163 expression is assessed by flow cytometry after staining with antibodies for CD163. In the experiments described in
[0094] The inhibition by Antibody 3 of CD163 expression in human monocytes, in response to IL-34, demonstrates the ability of the antibodies of the present invention to modulate monocyte/macrophage number and/or phenotypic differentiation responses to IL-34, and supports the use of the present antibodies to treat immune-mediated diseases, such as neuroinflammation and other inflammatory conditions (See, e.g., Lelios, I. et al. Emerging roles of IL-34 in health and disease, J Exp Med (2020) 217 (3): e20190290).
Example 4: In Vivo Functional Characterization of the Anti-IL-34 Antibodies
Ability of Antibody 3 to Reduce Microglial Cell Number in Dorsal Cortex and Hippocampus of Mice
[0095] The ability of anti-IL-34 antibodies of the present invention to reduce microglial cell number is examined using a mouse model. Briefly, FBV female mice (Envigo, 6-8 weeks old) are administered a subcutaneous dose of 50 mg/kg of an Antibody 3, or an isotype matched IgG control antibody. At different times post antibody administration (1, 3, 7 and 14 days), animals are euthanized with CO.sub.2 and the brain is perfused with saline. Following perfusion, brain tissue is collected, dorsal cortex and hippocampus are dissected under a microscope and flash frozen in liquid nitrogen. mRNA is prepared from dorsal cortex and hippocampus and used to assess the impact of anti-IL34 antibody or control antibody treatment on the expression of microglia markers Iba-1 and CD11b by TaqMan. Changes in mRNA expression are normalized versus an internal GAPDH mRNA control and presented as FOLD changes. Expression of Iba-1 and CD11b mRNA is routinely used as a surrogate marker for microglial cell number, and reduction in the expression of these markers is commonly accepted to reflect a reduction in brain microglia. Expression of mRNAs for two of the receptors for IL-34, CSF1R and PTP zeta, and both CSF1R ligands (IL-34 and CSF-1), are also assessed following administration of Antibody 3. Results are provided in Table 8 (A-Hippocampus, and B-Cortex):
TABLE-US-00011 TABLE 8 Effect of Antibody 3 on mRNA expression of microglia markers 1 Day 3 Days 7 Days 14 days FOLD SEM FOLD SEM FOLD SEM FOLD SEM 8A Hippocampus Iba1 1.16 0.15 0.91 0.06 0.50 0.02 0.74 0.04 CD11b 0.85 0.06 0.49 0.03 0.74 0.03 0.64 0.04 CSF-1R 1.01 0.06 0.78 0.04 0.52 0.02 0.79 0.04 PTPRz 1.01 0.00 0.98 0.00 1.00 0.00 1.00 0.00 CSF-1 1.01 0.03 0.79 0.05 1.11 0.05 1.03 0.05 IL-34 1.01 0.00 0.99 0.00 0.99 0.00 0.98 0.00 8B Cortex Iba1 1.09 0.06 0.67 0.04 0.82 0.03 0.88 0.04 CD11b 0.99 0.08 0.69 0.05 0.59 0.02 0.70 0.06 CSF1R 0.97 0.02 0.59 0.03 0.79 0.02 0.80 0.03 PTPRz 1.01 0.00 0.98 0.00 1.00 0.00 1.00 0.00 CSF1 1.22 0.10 1.02 0.06 0.69 0.04 0.90 0.07 IL34 1.01 0.00 0.99 0.00 0.99 0.00 0.98 0.00
Ability of Antibody 3 to Reduce Microglial Cell Number in a Mouse Model of Alzheimer's Disease (Tg4510 Mouse):
[0096] The ability of anti-IL-34 antibodies of the present invention to reduce microglial cell number in a mouse model of Alzheimer's Disease (Tg4510 mouse) is also examined. The Tg4510 mouse is a model of tauopathy characterized by the overexpression of the P301L mutant form of human Tau in the forebrain. These mice are used for studying the formation of neurofibrillary tangles as a model for Alzheimer's disease, neurodegenerative tauopathies and frontotemporal dementia, and they exhibit an age-dependent and region-specific progression of neuropathology associated with cognitive impairment. Briefly, 8-week-old female Tg4510 mice are administered biweekly doses of 5, 15 and 50 mg/kg of an anti-IL-34 antibody, or an isotype-matched IgG control, for 9 consecutive weeks. At the end of the dosing period, animals are euthanized and perfused with PBS. Following perfusion, brain tissue is collected and both hemispheres are separated via a midsagittal section and from each hemisphere, dorsal cortex and hippocampus are dissected under a microscope and flash frozen in liquid nitrogen. To assess the effect of anti-IL-34 antibodies on the expression of microglia markers, mRNA is prepared from hippocampus, and the expression of CD11b, Iba-1, and CSF1R are analyzed by real time PCR, as shown in Table 9 for hippocampus.
TABLE-US-00012 TABLE 9 Effect of Antibody 3 on the expression of microglia markers (mRNA from hippocampus, CD11b, Iba-1, and CSF1R, analyzed by real time PCR CD11b Iba1 CSF1R FOLD SEM FOLD SEM FOLD SEM Control 1.00 0.03 1.00 0.07 1.00 0.07 Antibody 3, 5 mpk 0.87 0.02 0.89 0.04 0.76 0.03 Antibody 3, 15 mpk 0.61 0.02 0.78 0.03 0.63 0.03 Antibody 3, 50 mpk 0.36 0.01 0.65 0.02 0.45 0.02
Ability of Anti-IL34 Antibodies to Reduce Phosphorylated Tau in Tg4510 Mice:
[0097] To assess whether anti-IL-34 antibodies can reduce phospho-Tau, one of the pathological forms of Tau associated with Alzheimer's Disease, protein lysates are prepared from the cortex of animals treated with anti-IL-34 antibody or IgG control antibody. Briefly, anti-phospho Tau antibodies (AT8) are used to coat the wells of a 96-well plate and incubated for 24 hrs at 4 C. The following day, plates are washed with 0.05% Tween/PBS, blocked with SynBlock™ buffer (ImmunoChemistry Technology) and incubated with cortex lysates for 24 hrs at 4° C. followed by the addition of a biotinylated Tau detection antibody (CP27) and streptavidin-horseradish peroxidase conjugate. As shown in Table 9, treatment with anti-IL-34 antibodies reduced phosphorylated Tau in the cortex of Tg4510 mice.
TABLE-US-00013 TABLE 9 FDT248: AT8 Tau ELISA P1 Cortex (μg/mg protein) mIgG1 Control Antibody 3, Antibody 3, Antibody 3, 50 mg/kg 50 mg/kg 15 mg/kg 5 mg/kg Number of 18 17 18 18 Values Mean 997.4 492.6 531.1 890.8 Standard 645.4 281.7 604.1 539.5 Deviation Standard Error 152.1 68.3 142.4 127.2 of the mean percent change −51% −17% −11% from control
TABLE-US-00014 Listing of Amino Acid and Nucleotide Sequences Heavy Chain of Antibody 1 (SEQ ID NO: 1) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYATSWVRQAPGKGLEWVSAISHSG RSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRSSLDTWGQ GTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTS GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYG PPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSL SLSLG Light Chain of Antibody 1; LC of Antibody 2 (SEQ ID NO: 2) EIVLTQSPGTLSLSPGERATLSCRASQSISSAYLAWYQQKPGQAPRLLIYASSIRPT GIPDRFSGSGSGTDFTLTISPLEPEDFAVYYCSQYGDSLSFGGGTKVEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC HCVR of Antibody 1 (SEQ ID NO: 3) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYATSWVRQAPGKGLEWVSAISHSG RSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRSSLDTWGQ GTLVTVSS LCVR of Antibody 1; LCVR of Antibody 2 (SEQ ID NO: 4) EIVLTQSPGTLSLSPGERATLSCRASQSISSAYLAWYQQKPGQAPRLLIYASSIRPT GIPDRFSGSGSGTDFTLTISPLEPEDFAVYYCSQYGDSLSFGGGTKVEIK HCDR1 of Antibody 1 (SEQ ID NO: 5) AASGFTFSSYATS HCDR2 of Antibody 1 (SEQ ID NO: 6) AISHSGRSTYYADSVKG HCDR3 of Antibody 1 (SEQ ID NO: 7) ARGRSSLDT LCDR1 of Antibody 1 and Antibody 2 (SEQ ID NO: 8) RASQSISSAYLA LCDR2 of Antibody 1 and Antibody 2 (SEQ ID NO: 9) YASSIRPT LCDR3 of Antibody 1 and Antibody 2 (SEQ ID NO: 10) SQYGDSLS DNA Encoding the Heavy Chain of Antibody 1 (SEQ ID NO: 11) gaagttcaattgctggagtcagggggaggattggtccaacccggcggatcccttcggctgtcatgtgctgcttctggatttaccttc tctagctacgctacctcctgggtaagacaggccccaggtaaggggctggagtgggtgtcagcaataagtcactccgggcgatct acatattatgctgattccgtcaaaggacgtttcactataagccgggataatagcaagaacactctgtatctgcaaatgaactctcttc gggcagaggacaccgctgtttactattgcgctcggggtcgaagctccctcgacacatgggggcagggtacattggtcaccgtat cctcagcctccaccaagggcccatcggtcttcccgctagcgccctgctccaggagcacctccgagagcacagccgccctggg ctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcc cggctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggcacgaagacctaca cctgcaacgtagatcacaagcccagcaacaccaaggtggacaagagagttgagtccaaatatggtcccccatgcccaccctgc ccagcacctgaggccgccgggggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccggacccct gaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagttcaactggtacgtggatggcgtggaggtgc ataatgccaagacaaagccgcgggaggagcagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccagga ctggctgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccatcgagaaaaccatctccaaagcca aagggcagccccgagagccacaggtgtacaccagcccccatcccaggaggagatgaccaagaaccaggtcagcctgacct gcctggtcaaaggcttctaccccagcgacatcgccgtggagtgggaaagcaatgggcagccggagaacaactacaagaccac gcctcccgtgctggactccgacggctccttcttcctctacagcaggctaaccgtggacaagagcaggtggcaggaggggaatg tcttctcatgctccgtgatgcatgaggctctgcacaaccactacacacagaagagcctctccctgtctctgggt DNA Encoding the Light Chain of Antibody 1 (SEQ ID NO: 12) gaaatcgtactgacccaaagcccagggactttgagtttgtcccctggggaaagagcaaccctctcatgtcgtgcaagtcaaagta tatccagtgcatatcttgcttggtatcagcaaaagcctggtcaagcaccaaggctgcttatttatgcctcatctattagacctacaggt atccctgaccgattctccggaagtggcagtgggactgatttcacacttacaatttcccccctggaacctgaagactttgccgtatatt attgttcacagtatggcgactcacttagtttcgggggcggcacaaaggttgaaataaagcggactgtggctgcaccatctgtcttc atcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaa gtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaaggacagcacct acagcctcagcagcaccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcaggg cctgagctcgcccgtcacaaagagcttcaacaggggagagtgc Heavy Chain of Antibody 2 (SEQ ID NO: 13) EVQLLESGGGLVQPGGSLRLSCAASGFTFFSYAHSWVRQAPGKGLEWVSAISHS GRSTYYADAVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRSSLDTWG QGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKY GPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNW YVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKS LSLSLG HCVR of Antibody 2 (SEQ ID NO: 14) EVQLLESGGGLVQPGGSLRLSCAASGFTFFSYAHSWVRQAPGKGLEWVSAISHS GRSTYYADAVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRSSLDTWG QGTLVTVSS HCDR1 of Antibody 2 (SEQ ID NO: 15) AASGFTFFSYAHS HCDR2 of Antibody 2 (SEQ ID NO: 16) AISHSGRSTYYADAVKG HCDR3 of Antibody 2 (SEQ ID NO: 17) ARGRSSLDT DNA Encoding the Heavy Chain of Antibody 2 (SEQ ID NO: 18) gaagttcaattgctggagtcagggggaggattggtccaacccggcggatcccttcggctgtcatgtgctgcttctggatttaccttc ttcagctacgctcattcctgggtaagacaggccccaggtaaggggctggagtgggtgtcagcaataagtcactccgggcgatct acatattatgctgatgctgtcaaaggacgtttcactataagccgggataatagcaagaacactctgtatctgcaaatgaactctcttc gggcagaggacaccgctgtttactattgcgctcggggtcgaagctccctcgacacatgggggcagggtacattggtcaccgtat cctcagcctccaccaagggcccatcggtcttcccgctagcgccctgctccaggagcacctccgagagcacagccgccctggg ctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcc cggctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggcacgaagacctaca cctgcaacgtagatcacaagcccagcaacaccaaggtggacaagagagttgagtccaaatatggtcccccatgcccaccctgc ccagcacctgaggccgccgggggaccatcagtcttcctgttccccccaaaacccaaggacactctcatgatctcccggacccct gaggtcacgtgcgtggtggtggacgtgagccaggaagaccccgaggtccagttcaactggtacgtggatggcgtggaggtgc ataatgccaagacaaagccgcgggaggagcagttcaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccagga ctggctgaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccatcgagaaaaccatctccaaagcca aagggcagccccgagagccacaggtgtacaccctgcccccatcccaggaggagatgaccaagaaccaggtcagcctgacct gcctggtcaaaggcttctaccccagcgacatcgccgtggagtgggaaagcaatgggcagccggagaacaactacaagaccac gcctcccgtgctggactccgacggctccttcttcctctacagcaggctaaccgtggacaagagcaggtggcaggaggggaatg tcttctcatgctccgtgatgcatgaggctctgcacaaccactacacacagaagagcctctccctgtctctgggt Heavy Chain of Antibody 3 (SEQ ID NO: 19) EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYAMSWVRQAPGKGLEWVSAISHR GGSTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRSSLDGWG QGTMVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGS LSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD CGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDD VEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTIS KTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENY KNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSP GK Light Chain of Antibody 3 (SEQ ID NO: 20) EIVLTQSPGILSLSPGERASLSCRASTSVSSAYLAWYQQKPGQAPRLLIYASSHRPL GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGDSLSFGGGTKVEIKRADAAP TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC HCVR of Antibody 3 (SEQ ID NO: 21) EVQLLESGGGLVQPGGSLRLSCAASGFTFSYYAMSWVRQAPGKGLEWVSAISHR GGSTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGRSSLDGWG QGTMVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGS LSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD CGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDD VEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTIS KTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENY KNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSP GK LCVR of Antibody 3 (SEQ ID NO: 22) EIVLTQSPGILSLSPGERASLSCRASTSVSSAYLAWYQQKPGQAPRLLIYASSHRPL GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGDSLSFGGGTKVEIKRADAAP TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC HCDR1 of Antibody 3 (SEQ ID NO: 23) AASGFTFSYYAMS HCDR2 of Antibody 3 (SEQ ID NO: 24) AISHRGGSTLYADSVKG HCDR3 of Antibody 3 (SEQ ID NO: 25) ARGRSSLDG LCDR1 of Antibody 3 (SEQ ID NO: 26) RASTSVSSAYLA LCDR2 of Antibody 3 (SEQ ID NO: 27) YASSHRPL LCDR3 of Antibody 3 (SEQ ID NO: 28) QQYGDSLS DNA Encoding the Heavy Chain of Antibody 3 (SEQ ID NO: 29) gaagtccaactcttggagagcggtggaggtctggttcagcctggcggttcactgcggcttagctgtgccgctagtggcttcacttt cagttattatgccatgtcctgggtacgccaggccccaggcaagggtctggaatgggtgtctgccatttcccacaggggcggctca acattgtacgctgacagtgttaaaggacggtttactataagcagggataactcaaaaaacacattgtatctccagatgaactccttg cgggcagaagacaccgctgtgtattattgtgctcggggtcgctcctccctcgatggctgggggcaaggaaccatggtcactgta agctccgccaaaacgacacccccatctgtctatccgctcgcacctggatctgccgcccagaccaacagcatggtgaccctggg ctgtctggtgaagggctacttccctgagcctgtgacagtgacctggaacagcggctctctgtctagcggcgtgcacacattccctg ccgtgctgcagagcgacctgtacaccctgagcagcagcgtgaccgtgcctagcagcacatggcctagcgagaccgtgacatg caacgtggcccaccctgcctcttctaccaaggtggacaagaagatcgtgcccagagactgcggctgcaagccttgcatctgcac cgtgcctgaggtgagcagcgtgttcatcttcccacccaagcccaaggacgtgctcaccatcaccctcacccccaaggtcacgtg tgttgtggtagacatcagcaaggatgatcccgaggtccagttcagctggtttgtagatgatgtggaggtgcacacagctcagacg caaccccgggaggagcagttcaacagcactttccgctcagtcagtgaacttcccatcatgcaccaggactggctcaatggcaag gagttcaaatgcagggtcaacagtgcagctttccctgcccccatcgagaaaaccatctccaaaaccaaaggcagaccgaaggc tccacaggtgtacaccattccacctcccaaggagcagatggccaaggataaagtcagtctgacctgcatgataacagacttcttc cctgaagacattactgtggagtggcagtggaatgggcagccagcggagaactacaagaacactcagcccatcatggacacag atggctcttacttcgtctacagcaagctcaatgtgcagaagagcaactgggaggcaggaaatactttcacctgctctgtgttacatg agggcctgcacaaccaccatactgagaagagcctctcccactctcctggtaaatagtatttaaatgagtttaaa DNA Encoding the Light Chain of Antibody 3 (SEQ ID NO: 30) gagatagtactgacccaaagtccgggtatattgtccctcagccctggcgaacgagccagccttagctgtcgggcctccaccagt gtgtcaagcgcgtacttggcctggtaccaacaaaaaccaggccaagcgcctcgactcctgatatatgcctcctcccaccggccc cttggaatcccggacagattttccggttcaggctcaggtacagattttaccctcactatatcccgactggagcccgaggacttcgca gtatattactgccagcagtatggtgactccctctcctttggcgggggtactaaggttgaaatcaagcgggctgatgcggcgccca ctgtatccatcttcccaccatccagtgagcagttaacatctggaggtgctagcgtcgtgtgcttcttgaacaacttctaccccaaaga catcaatgtcaagtggaagattgatggcagtgaacgacaaaatggcgtcctgaacagttggactgatcaggacagcaaagaca gcacctacagcatgagcagcaccctcacgttgaccaaggacgagtatgaacgacataacagctatacctgtgaggccactcac aagacatcaacttcacccattgtcaagagcttcaacaggaatgagtgt Human IL-34 (SEQ ID NO: 41) NEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEGVFRIA NVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNV QQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQS SVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGE GLLP Murine IL-34 (SEQ ID NO: 42) NENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYMKHYFPINYRIAVPYEGVLRV ANITRLQKAHVSERELRYLWVLVSLNATESVMDVLLEGHPSWKYLQEVQTLLEN VQRSLMDVEIGPHVEAVLSLLSTPGLSLKLVRPKALLDNCFRVMELLYCSCCKQS PILKWQDCELPRLHPHSPGSLMQCTATNVYPLSRQTPTSLPGSPSSSHGSLP IgG4PAA hinge region (SEQ ID NO: 51) ESKYGPPCPPCP IgG4PAA Fc region (SEQ ID NO: 52) APEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEV HNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG