CD47 antibodies and uses thereof for treating cancer
11180552 · 2021-11-23
Assignee
Inventors
- Shyra Gardai (Bothell, WA, US)
- Matthew Levengood (Bothell, WA, US)
- Vivian Trang (Lynnwood, WA, US)
- Lori Westendorf (Bothell, WA, US)
- Christopher Carosino (Duvall, WA, US)
- Che Leung-Law (Bothell, WA, US)
- Michael Feldhaus (Boston, MA, US)
Cpc classification
C07K2317/24
CHEMISTRY; METALLURGY
C07K2319/73
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/732
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
Humanized antibodies, including masked antibodies that specifically bind to CD47 are provided. Methods for using anti-CD47 antibodies, including masked antibodies, to modulate activity of (e.g., inhibit proliferation of) a CD47-expressing cell, as well as for the treatment of one or more diseases or disorders (e.g., cancer) associated with CD47-expressing cells, are provided.
Claims
1. A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, the antibody or antigen-binding fragment comprising a light chain variable region and a heavy chain variable region, wherein the heavy chain variable region comprises HCDR1 selected from SEQ ID NOs: 16, 19, 21, and 23; HCDR2 selected from SEQ ID NOs: 17, 20, 22, and 24; and HCDR3 of SEQ ID NO: 18; wherein the light chain variable region comprises LCDR1 selected from SEQ ID NOs: 31 and 34; LCDR2 selected from SEQ ID NOs: 32 and 35; and LCDR3 selected from SEQ ID NOs: 33 and 36; wherein the heavy chain variable region comprises an amino acid sequence with at least 97% identity to an amino acid sequence selected from SEQ ID NOs: 3, 4, 5, 6, 7 and 8; and wherein the light chain variable region comprises an amino acid sequence with at least 85% identity to an amino acid sequence selected from SEQ ID NOs: 11, 12, 13, 14 and 15.
2. The humanized antibody or antigen-binding fragment thereof of claim 1, wherein the heavy chain variable region comprises HCDR1, HCDR2, and HCDR3 selected from: SEQ ID NOs: 16, 17, and 18; SEQ ID NOs: 19, 20, and 18; SEQ ID NOs: 21, 22, and 18; SEQ ID NOs: 16, 20, and 18; and SEQ ID NOs: 23, 24, and 18.
3. The humanized antibody or antigen-binding fragment thereof of claim 1, wherein the light chain variable region comprises LCDR1, LCDR2, and LCDR3 selected from SEQ ID NOs: 31, 32, and 33; SEQ ID NOs: 31, 32, and 36; and SEQ ID NOs: 34, 35, and 33.
4. The humanized antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof comprises HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 selected from SEQ ID NOs: 16, 17, 18, 31, 32, and 33; SEQ ID NOs: 16, 17, 18, 34, 35, and 33; SEQ ID NOs: 19, 20, 18, 31, 32, and 33; SEQ ID NOs: 19, 20, 18, 34, 35, and 33; SEQ ID NOs: 21, 22, 18, 31, 32, and 33; SEQ ID NOs: 21, 22, 18, 34, 35, and 33; SEQ ID NOs: 16, 20, 18, 31, 32, and 33; SEQ ID NOs: 16, 20, 18, 34, 35, and 33; SEQ ID NOs: 23, 24, 18, 31, 32, and 33; SEQ ID NOs: 23, 24, 18, 34, 35, and 33; SEQ ID NOs: 16, 17, 18, 31, 32, and 36; SEQ ID NOs: 19, 20, 18, 31, 32, and 36; SEQ ID NOs: 21, 22, 18, 31, 32, and 36; 16, 20, 18, 31, 32, and 36; and SEQ ID NOs: 23, 24, 18, 31, 32, and 36.
5. The humanized antibody or antigen-binding fragment thereof of claim 1, wherein the heavy chain variable region comprises an amino acid sequence selected from SEQ ID NOs: 3, 4, 5, 6, 7 and 8.
6. The humanized antibody or antigen-binding fragment thereof of claim 1, wherein the light chain variable region comprises an amino acid sequence selected from SEQ ID NOs: 11, 12, 13, 14 and 15.
7. The humanized antibody or antigen-binding fragment thereof of claim 1, wherein the heavy chain variable region and light chain variable region comprise SEQ ID NOs: 3 and 11; SEQ ID NOs: 3 and 12; SEQ ID NOs: 3 and 13; SEQ ID NOs: 3 and 14; SEQ ID NOs: 4 and 11; SEQ ID NOs: 4 and 12; SEQ ID NOs: 4 and 13; SEQ ID NOs: 4 and 14; SEQ ID NOs: 5 and 11; SEQ ID NOs: 5 and 12; SEQ ID NOs: 5 and 13; SEQ ID NOs: 5 and 14; SEQ ID NOs: 6 and 11; SEQ ID NOs: 6 and 12; SEQ ID NOs: 6 and 13; SEQ ID NOs: 6 and 14; SEQ ID NOs: 7 and 11; SEQ ID NOs: 7 and 12; SEQ ID NOs: 7 and 13; SEQ ID NOs: 7 and 14; SEQ ID NOs: 8 and 11; SEQ ID NOs: 8 and 12; SEQ ID NOs: 8 and 13; SEQ ID NOs: 8 and 14; or SEQ ID NOs: 3 and 15.
8. A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, the antibody or antigen-binding fragment comprising a light chain variable region and a heavy chain variable region, wherein the heavy chain variable region comprises HCDR1 of SEQ ID NO: 16, HCDR2 of SEQ ID NO: 17, and HCDR3 of SEQ ID NO: 18; and wherein the light chain variable region comprises LCDR1 of SEQ ID NO: 31, LCDR2 of SEQ ID NO: 32, and LCDR3 of SEQ ID NO: 33; and wherein the heavy chain variable region comprises an amino acid sequence with at least 95% identity to SEQ ID NO: 3 and the light chain variable region comprises an amino acid sequence with at least 85% identity to SEQ ID NO: 13; and wherein the antibody has reduced hemagglutination of red blood cells compared to Ab47 comprising a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10.
9. The humanized antibody or antigen-binding fragment thereof of claim 8, wherein the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3 and the light chain variable region comprises the amino acid sequence of SEQ ID NO: 13.
10. A nucleic acid sequence encoding the antibody or antigen-binding fragment thereof of claim 1.
11. An expression vector comprising the nucleic acid of claim 10.
12. A host cell comprising the nucleic acid of claim 10.
13. A host cell that expresses the antibody or antigen-binding fragment thereof of claim 1.
14. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 12.
15. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 13.
16. A nucleic acid sequence encoding the antibody or antigen-binding fragment thereof of claim 4.
17. An expression vector comprising the nucleic acid of claim 16.
18. A host cell comprising the nucleic acid of claim 16.
19. A host cell that expresses the antibody or antigen-binding fragment thereof of claim 4.
20. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 18.
21. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 19.
22. A nucleic acid sequence encoding the antibody or antigen-binding fragment thereof of claim 8.
23. An expression vector comprising the nucleic acid of claim 22.
24. A host cell comprising the nucleic acid of claim 22.
25. A host cell that expresses the antibody or antigen-binding fragment thereof of claim 8.
26. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 24.
27. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 25.
28. A nucleic acid sequence encoding the antibody or antigen-binding fragment thereof of claim 9.
29. An expression vector comprising the nucleic acid of claim 28.
30. A host cell comprising the nucleic acid of claim 29.
31. A host cell that expresses the antibody or antigen-binding fragment thereof of claim 9.
32. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 30.
33. A method of producing an antibody or antigen-binding fragment thereof comprising culturing the host cell of claim 31.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
DETAILED DESCRIPTION
(48) Anti-CD47 IgG3 antibodies known in the art at the time of filing exhibit toxicities such as peripheral red blood cell depletion and platelet depletion, which decrease their usefulness as effective therapeutics against CD47-associated disorders such as, e.g., CD47 expressing cancers. Applicants have surprisingly discovered novel anti-CD47 IgG1 antibodies and antigen-binding fragments thereof that can be activated by unmasking in the context of a tumor microenvironment, to effectively target the antibodies and antigen-binding fragments thereof of the present invention specifically to CD47-expressing solid tumors. The humanized anti-CD47 antibodies and antigen-binding fragments thereof (either masked or unmasked) described herein are useful for treating CD47-related disorders, e.g., such as CD47-expressing cancers.
(49) In certain exemplary embodiments, antibodies and antigen-binding fragments thereof are provided that comprise a removable mask (e.g., a coiled coil mask) that blocks binding of the antibody or antigen-binding fragment thereof to its antigenic target. In certain embodiments, a removable mask is attached to the N-terminus of one or more of the heavy and/or light chains of the antibody or antigen-binding fragment thereof via a matrix metalloproteinase (MMP)-cleavable linker sequence.
(50) In the tumor microenvironment, altered proteolysis leads to unregulated tumor growth, tissue remodeling, inflammation, tissue invasion, and metastasis (Kessenbrock (2011) Cell 141:52). MMPs represent the most prominent family of proteinases associated with tumorigenesis, and MMPs mediate many of the changes in the microenvironment during tumor progression. Id. Upon exposure of the antibody or antigen-binding fragment thereof of the present invention to an MMP, the MMP linker sequence is cleaved, thus allowing removal of the coiled coil mask and enabling the antibody or antigen-binding fragment thereof to bind its target antigen in a tumor microenvironment-specific manner.
(51) The novel anti-CD47 IgG1 antibodies and antigen-binding fragments thereof of the present invention (both masked and un-masked) advantageously demonstrate increased pharmacokinetics and decreased off target effects compared with anti-CD47 IgG3 antibodies known in the art at the time of filing. The novel humanized anti-CD47 antibodies described herein advantageously exhibit one or more of: 1) enhanced antigen binding relative to a reference antibody (e.g., a murine parental antibody); 2) enhanced Antibody Dependent Cellular Cytotoxicity (ADCC) relative to a reference antibody (e.g., a murine parental antibody); 3) enhanced phagocytosis (e.g., enhanced Antibody Dependent Cellular Phagocytosis (ADCP)) relative to a reference antibody (e.g., a murine parental antibody); 4) reduced red blood cell hemagglutination (HA), relative to a reference antibody (e.g., a murine parental antibody); 5) binding to the same three-dimensional (i.e., non-linear) CD47 epitope.
(52) So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.
I. Definitions
(53) As used herein, including the appended claims, the singular forms of words such as “a,” “an,” and “the,” include their corresponding plural references unless the context clearly dictates otherwise.
(54) An “antibody-drug conjugate” refers to an antibody conjugated to a cytotoxic agent or cytostatic agent. Typically, antibody-drug conjugates bind to a target antigen (e.g., CD47) on a cell surface, followed by internalization of the antibody-drug conjugate into the cell and subsequent release of the drug into the cell.
(55) A “polypeptide” or “polypeptide chain” is a polymer of amino acid residues joined by peptide bonds, whether produced naturally or synthetically. Polypeptides of less than about 10 amino acid residues are commonly referred to as “peptides.”
(56) A “protein” is a macromolecule comprising one or more polypeptide chains. A protein may also comprise non-peptidic components, such as carbohydrate groups. Carbohydrates and other non-peptidic substituents may be added to a protein by the cell in which the protein is produced, and will vary with the type of cell. Proteins are defined herein in terms of their amino acid backbone structures. Substituents such as carbohydrate groups are generally not specified, but may be present nonetheless.
(57) The terms “amino-terminal” and “carboxy-terminal” denote positions within polypeptides. Where the context allows, these terms are used with reference to a particular sequence or portion of a polypeptide to denote proximity or relative position. For example, a certain sequence positioned carboxy-terminal to a reference sequence within a polypeptide is located proximal to the carboxy terminus of the reference sequence, but is not necessarily at the carboxy terminus of the complete polypeptide.
(58) For purposes of classifying amino acids substitutions as conservative or nonconservative, the following amino acid substitutions are considered conservative substitutions: serine substituted by threonine, alanine, or asparagine; threonine substituted by proline or serine; asparagine substituted by aspartic acid, histidine, or serine; aspartic acid substituted by glutamic acid or asparagine; glutamic acid substituted by glutamine, lysine, or aspartic acid; glutamine substituted by arginine, lysine, or glutamic acid; histidine substituted by tyrosine or asparagine; arginine substituted by lysine or glutamine; methionine substituted by isoleucine, leucine or valine; isoleucine substituted by leucine, valine, or methionine; leucine substituted by valine, isoleucine, or methionine; phenylalanine substituted by tyrosine or tryptophan; tyrosine substituted by tryptophan, histidine, or phenylalanine; proline substituted by threonine; alanine substituted by serine; lysine substituted by glutamic acid, glutamine, or arginine; valine substituted by methionine, isoleucine, or leucine; and tryptophan substituted by phenylalanine or tyrosine. Conservative substitutions can also mean substitutions between amino acids in the same class. Classes are as follows: Group I (hydrophobic side chains): met, ala, val, leu, ile; Group II (neutral hydrophilic side chains): cys, ser, thr; Group III (acidic side chains): asp, glu; Group IV (basic side chains): asn, gin, his, lys, arg; Group V (residues influencing chain orientation): gly, pro; and Group VI (aromatic side chains): trp, tyr, phe.
(59) Two amino acid sequences have “100% amino acid sequence identity” if the amino acid residues of the two amino acid sequences are the same when aligned for maximal correspondence. Sequence comparisons can be performed using standard software programs such as those included in the LASERGENE bioinformatics computing suite, which is produced by DNASTAR (Madison, Wis.). Other methods for comparing two nucleotide or amino acid sequences by determining optimal alignment are well-known to those of skill in the art. (See, e.g., Peruski and Peruski, The Internet and the New Biology: Tools for Genomic and Molecular Research (ASM Press, Inc. 1997); Wu et al. (eds.), “Information Superhighway and Computer Databases of Nucleic Acids and Proteins,” in Methods in Gene Biotechnology 123-151 (CRC Press, Inc. 1997); Bishop (ed.), Guide to Human Genome Computing (2nd ed., Academic Press, Inc. 1998).) Two amino acid sequences are considered to have “substantial sequence identity” if the two sequences have at least about 80%, at least about 85%, at about least 90%, or at least about 95% sequence identity relative to each other.
(60) Percentage sequence identities are determined with antibody sequences maximally aligned by the Kabat numbering convention. After alignment, if a subject antibody region (e.g., the entire variable domain of a heavy or light chain) is being compared with the same region of a reference antibody, the percentage sequence identity between the subject and reference antibody regions is the number of positions occupied by the same amino acid in both the subject and reference antibody region divided by the total number of aligned positions of the two regions, with gaps not counted, multiplied by 100 to convert to percentage.
(61) Compositions or methods “comprising” one or more recited elements may include other elements not specifically recited. For example, a composition that comprises antibody may contain the antibody alone or in combination with other ingredients.
(62) Designation of a range of values includes all integers within or defining the range.
(63) In antibodies or other proteins described herein, reference to amino acid residues corresponding to those specified by SEQ ID NO includes post-translational modifications of such residues.
(64) The term “antibody” denotes immunoglobulin proteins produced by the body in response to the presence of an antigen and that bind to the antigen, as well as antigen-binding fragments and engineered variants thereof. Hence, the term “antibody” includes, for example, intact monoclonal antibodies (e.g., antibodies produced using hybridoma technology) and antigen-binding antibody fragments, such as a F(ab′).sub.2, a Fv fragment, a diabody, a single-chain antibody, an scFv fragment, or an scFv-Fc. Genetically, engineered intact antibodies and fragments such as chimeric antibodies, humanized antibodies, single-chain Fv fragments, single-chain antibodies, diabodies, minibodies, linear antibodies, multivalent or multi-specific (e.g., bispecific) hybrid antibodies, and the like, are also included. Thus, the term “antibody” is used expansively to include any protein that comprises an antigen-binding site of an antibody and is capable of specifically binding to its antigen.
(65) The term antibody or antigen-binding fragment thereof includes a “naked” antibody or antigen-binding fragment thereof that is not bound (i.e., covalently or non-covalently bound) to a masking compound of the invention. The term antibody also embraces a “masked” antibody or antigen-binding fragment thereof that is covalently or non-covalently bound to one or more masking compounds such as, e.g., coiled coil peptides, as described further herein. The term antibody or antigen-binding fragment thereof includes a “conjugated” antibody or antigen-binding fragment thereof or an “antibody-drug conjugate (ADC)” in which an antibody or antigen-binding fragment thereof is covalently or non-covalently bound to a pharmaceutical agent, e.g., to a cytostatic or cytotoxic drug. In certain embodiments, an antibody or antigen-binding fragment thereof is a naked antibody or antigen-binding fragment that optionally is conjugated to a pharmaceutical agent, e.g., to a cytostatic or cytotoxic drug. In other embodiments, an antibody or antigen-binding fragment thereof is a masked antibody or antigen-binding fragment that optionally is conjugated to a pharmaceutical agent, e.g., to a cytostatic or cytotoxic drug.
(66) The term “genetically engineered antibodies” refers to an antibody in which the amino acid sequence has been varied from that of the native or parental antibody. The possible variations are many, and range from the changing of just one or a few amino acids to the complete redesign of, for example, the variable or constant region. Changes in the constant region are, in general, made to improve or alter characteristics such as, e.g., complement binding and other effector functions. Typically, changes in the variable region are made to improve antigen-binding characteristics, improve variable region stability, and/or reduce the risk of immunogenicity.
(67) The term “chimeric antibody” refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
(68) An “antigen-binding site of an antibody” is that portion of an antibody that is sufficient to bind to its antigen. The minimum such region is typically a variable domain or a genetically engineered variant thereof. Single domain binding sites can be generated from camelid antibodies (see Muyldermans and Lauwereys, Mol. Recog. 12: 131-140, 1999; Nguyen et al., EMBO J. 19:921-930, 2000) or from VH domains of other species to produce single-domain antibodies (“dAbs,” see Ward et al., Nature 341:544-546, 1989; U.S. Pat. No. 6,248,516 to Winter et al). Commonly, an antigen-binding site of an antibody comprises both a heavy chain variable (VH) domain and a light chain variable (VL) domain that bind to a common epitope. Within the context of the present invention, an antibody may include one or more components in addition to an antigen-binding site, such as, for example, a second antigen-binding site of an antibody (which may bind to the same or a different epitope or to the same or a different antigen), a peptide linker, an immunoglobulin constant region, an immunoglobulin hinge, an amphipathic helix (see Pack and Pluckthun, Biochem. 31: 1579-1584, 1992), a non-peptide linker, an oligonucleotide (see Chaudri et al, FEBS Letters 450:23-26, 1999), a cytostatic or cytotoxic drug, and the like, and may be a monomeric or multimeric protein. Examples of molecules comprising an antigen-binding site of an antibody are known in the art and include, for example, Fv, single-chain Fv (scFv), Fab, Fab′, F(ab′)2, F(ab)c, diabodies, minibodies, nanobodies, Fab-scFv fusions, bispecific (scFv)4-IgG, and bispecific (scFv)2-Fab. (See, e.g., Hu et al, Cancer Res. 56:3055-3061, 1996; Atwell et al., Molecular Immunology 33: 1301-1312, 1996; Carter and Merchant, Curr. Op. Biotechnol. 8:449-454, 1997; Zuo et al., Protein Engineering 13:361-367, 2000; and Lu et al., J. Immunol. Methods 267:213-226, 2002.)
(69) The term “immunoglobulin” refers to a protein consisting of one or more polypeptides substantially encoded by immunoglobulin gene(s). One form of immunoglobulin constitutes the basic structural unit of native (i.e., natural or parental) antibodies in vertebrates. This form is a tetramer and consists of two identical pairs of immunoglobulin chains, each pair having one light chain and one heavy chain. In each pair, the light and heavy chain variable regions (VL and VH) are together primarily responsible for binding to an antigen, and the constant regions are primarily responsible for the antibody effector functions. Five classes of immunoglobulin protein (IgG, IgA, IgM, IgD, and IgE) have been identified in higher vertebrates. IgG comprises the major class, and it normally exists as the second most abundant protein found in plasma. In humans, IgG consists of four subclasses, designated IgG1, IgG2, IgG3, and IgG4. Each immunoglobulin heavy chain possesses a constant region that consists of constant region protein domains (CH1, hinge, CH2, and CH3; IgG3 also contains a CH4 domain) that are essentially invariant for a given subclass in a species.
(70) DNA sequences encoding human and non-human immunoglobulin chains are known in the art. (See, e.g., Ellison et al, DNA 1: 11-18, 1981; Ellison et al, Nucleic Acids Res. 10:4071-4079, 1982; Kenten et al., Proc. Natl. Acad. Set USA 79:6661-6665, 1982; Seno et al., Nucl. Acids Res. 11:719-726, 1983; Riechmann et al., Nature 332:323-327, 1988; Amster et al., Nucl. Acids Res. 8:2055-2065, 1980; Rusconi and Kohler, Nature 314:330-334, 1985; Boss et al., Nucl. Acids Res. 12:3791-3806, 1984; Bothwell et al., Nature 298:380-382, 1982; van der Loo et al., Immunogenetics 42:333-341, 1995; Karlin et al., J. Mol. Evol. 22: 195-208, 1985; Kindsvogel et al., DNA 1:335-343, 1982; Breiner et al., Gene 18: 165-174, 1982; Kondo et al., Eur. J. Immunol. 23:245-249, 1993; and GenBank Accession No. J00228.) For a review of immunoglobulin structure and function see Putnam, The Plasma Proteins, Vol V, Academic Press, Inc., 49-140, 1987; and Padlan, Mol. Immunol. 31: 169-217, 1994. The term “immunoglobulin” is used herein for its common meaning, denoting an intact antibody, its component chains, or fragments of chains, depending on the context.
(71) Full-length immunoglobulin “light chains” (about 25 kDa or 214 amino acids) are encoded by a variable region gene at the amino-terminus (encoding about 110 amino acids) and a by a kappa or lambda constant region gene at the carboxyl-terminus. Full-length immunoglobulin “heavy chains” (about 50 kDa or 446 amino acids) are encoded by a variable region gene (encoding about 116 amino acids) and a gamma, mu, alpha, delta, or epsilon constant region gene (encoding about 330 amino acids), the latter defining the antibody's isotype as IgG, IgM, IgA, IgD, or IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. (See generally Fundamental Immunology (Paul, ed., Raven Press, N.Y., 2nd ed. 1989), Ch. 7).
(72) An immunoglobulin light or heavy chain variable region (also referred to herein as a “light chain variable domain” (“VL domain”) or “heavy chain variable domain” (“VH domain”), respectively) consists of a “framework” region interrupted by three “complementarity determining regions” or “CDRs.” The framework regions serve to align the CDRs for specific binding to an epitope of an antigen. Thus, the term “CDR” refers to the amino acid residues of an antibody that are primarily responsible for antigen binding. From amino-terminus to carboxyl-terminus, both VL and VH domains comprise the following framework (FR) and CDR regions: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
(73) The assignment of amino acids to each variable region domain is in accordance with the definitions of Kabat, Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1987 and 1991). Kabat also provides a widely used numbering convention (Kabat numbering) in which corresponding residues between different heavy chain variable regions or between different light chain variable regions are assigned the same number. CDRs 1, 2 and 3 of a VL domain are also referred to herein, respectively, as CDR-L1, CDR-L2 and CDR-L3. CDRs 1, 2 and 3 of a VH domain are also referred to herein, respectively, as CDR-H1, CDR-H2 and CDR-H3. If so noted, the assignment of CDRs can be in accordance with IMGT® (Lefranc et al., Developmental & Comparative Immunology 27:55-77; 2003) in lieu of Kabat.
(74) Numbering of the heavy chain constant region is via the EU index as set forth in Kabat (Kabat, Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md., 1987 and 1991).
(75) Unless the context dictates otherwise, the term “monoclonal antibody” is not limited to antibodies produced through hybridoma technology. The term “monoclonal antibody” can include an antibody that is derived from a single clone, including any eukaryotic, prokaryotic or phage clone. In particular embodiments, the antibodies described herein are monoclonal antibodies.
(76) The term “humanized VH domain” or “humanized VL domain” refers to an immunoglobulin VH or VL domain comprising some or all CDRs entirely or substantially from a non-human donor immunoglobulin (e.g., a mouse or rat) and variable domain framework sequences entirely or substantially from human immunoglobulin sequences. The non-human immunoglobulin providing the CDRs is called the “donor” and the human immunoglobulin providing the framework is called the “acceptor.” In some instances, humanized antibodies will retain some non-human residues within the human variable domain framework regions to enhance proper binding characteristics (e.g., mutations in the frameworks may be required to preserve binding affinity when an antibody is humanized).
(77) A “humanized antibody” is an antibody comprising one or both of a humanized VH domain and a humanized VL domain. Immunoglobulin constant region(s) need not be present, but if they are, they are entirely or substantially from human immunoglobulin constant regions.
(78) A humanized antibody is a genetically engineered antibody in which the CDRs from a non-human “donor” antibody are grafted into human “acceptor” antibody sequences (see, e.g., Queen, U.S. Pat. Nos. 5,530,101 and 5,585,089; Winter, U.S. Pat. No. 5,225,539; Carter, U.S. Pat. No. 6,407,213; Adair, U.S. Pat. No. 5,859,205; and Foote, U.S. Pat. No. 6,881,557). The acceptor antibody sequences can be, for example, a mature human antibody sequence, a composite of such sequences, a consensus sequence of human antibody sequences, or a germline region sequence. Human acceptor sequences can be selected for a high degree of sequence identity in the variable region frameworks with donor sequences to match canonical forms between acceptor and donor CDRs among other criteria. Thus, a humanized antibody is an antibody having CDRs entirely or substantially from a donor antibody and variable region framework sequences and constant regions, if present, entirely or substantially from human antibody sequences. Similarly, a humanized heavy chain typically has all three CDRs entirely or substantially from a donor antibody heavy chain, and a heavy chain variable region framework sequence and heavy chain constant region, if present, substantially from human heavy chain variable region framework and constant region sequences. Similarly, a humanized light chain typically has all three CDRs entirely or substantially from a donor antibody light chain, and a light chain variable region framework sequence and light chain constant region, if present, substantially from human light chain variable region framework and constant region sequences. A CDR in a humanized antibody is substantially from a corresponding CDR in a non-human antibody when at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% of corresponding residues (as defined by Kabat numbering), or wherein about 100% of corresponding residues (as defined by Kabat numbering), are identical between the respective CDRs. The variable region framework sequences of an antibody chain or the constant region of an antibody chain are substantially from a human variable region framework sequence or human constant region respectively when at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% of corresponding residues (as defined by Kabat numbering for the variable region and EU numbering for the constant region), or about 100% of corresponding residues (as defined by Kabat numbering for the variable region and EU numbering for the constant region) are identical.
(79) Although humanized antibodies often incorporate all six CDRs (preferably as defined by Kabat or IMGT®) from a mouse antibody, they can also be made with fewer than all six CDRs (e.g., at least 3, 4, or 5) CDRs from a mouse antibody (e.g., Pascalis et al., J. Immunol. 169:3076, 2002; Vajdos et al., Journal of Molecular Biology, 320: 415-428, 2002; Iwahashi et al., Mol. Immunol. 36:1079-1091, 1999; Tamura et al, Journal of Immunology, 164: 1432-1441, 2000).
(80) A CDR in a humanized antibody is “substantially from” a corresponding CDR in a non-human antibody when at least 60%, at least 85%, at least 90%, at least 95% or 100% of corresponding residues (as defined by Kabat (or IMGT)) are identical between the respective CDRs. In particular variations of a humanized VH or VL domain in which CDRs are substantially from a non-human immunoglobulin, the CDRs of the humanized VH or VL domain have no more than six (e.g., no more than five, no more than four, no more than three, no more than two, or nor more than one) amino acid substitutions (preferably conservative substitutions) across all three CDRs relative to the corresponding non-human VH or VL CDRs. The variable region framework sequences of an antibody VH or VL domain or, if present, a sequence of an immunoglobulin constant region, are “substantially from” a human VH or VL framework sequence or human constant region, respectively, when at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% of corresponding residues (as defined by Kabat numbering for the variable region and EU numbering for the constant region), or about 100% of corresponding residues (as defined by Kabat numbering for the variable region and EU numbering for the constant region) are identical. Hence, all parts of a humanized antibody, except the CDRs, are typically entirely or substantially from corresponding parts of natural human immunoglobulin sequences.
(81) Antibodies are typically provided in isolated form. This means that an antibody is typically at least about 50% w/w pure of interfering proteins and other contaminants arising from its production or purification but does not exclude the possibility that the antibody is combined with an excess of pharmaceutical acceptable carrier(s) or other vehicle intended to facilitate its use. Sometimes antibodies are at least about 60%, about 70%, about 80%, about 90%, about 95% or about 99% w/w pure of interfering proteins and contaminants from production or purification. Antibodies, including isolated antibodies, can be conjugated to cytotoxic agents and provided as antibody drug conjugates and/or masked, e.g., with associated coiled coils.
(82) Specific binding of an antibody to its target antigen typically refers an affinity of at least about 10.sup.6, about 10.sup.7, about 10.sup.8, about 10.sup.9, or about 10.sup.10 M.sup.−1. Specific binding is detectably higher in magnitude and distinguishable from non-specific binding occurring to at least one non-specific target. Specific binding can be the result of formation of bonds between particular functional groups or particular spatial fit (e.g., lock and key type), whereas nonspecific binding is typically the result of van der Waals forces.
(83) The term “epitope” refers to a site of an antigen to which an antibody binds. An epitope can be formed from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of one or more proteins. Epitopes formed from contiguous amino acids are typically retained upon exposure to denaturing agents, e.g., solvents, whereas epitopes formed by tertiary folding are typically lost upon treatment with denaturing agents, e.g., solvents. An epitope typically includes at least about 3, and more usually, at least about 5, at least about 6, at least about 7, or about 8-10 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and two-dimensional nuclear magnetic resonance. See, e.g., Epitope Mapping Protocols, in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed. (1996).
(84) Antibodies that recognize the same or overlapping epitopes can be identified in a simple immunoassay showing the ability of one antibody to compete with the binding of another antibody to a target antigen. The epitope of an antibody can also be defined by X-ray crystallography of the antibody bound to its antigen to identify contact residues.
(85) Alternatively, two antibodies have the same epitope if all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other (provided that such mutations do not produce a global alteration in antigen structure). Two antibodies have overlapping epitopes if some amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other antibody.
(86) Competition between antibodies can be determined by an assay in which a test antibody inhibits specific binding of a reference antibody to a common antigen (see, e.g., Junghans et al., Cancer Res. 50: 1495, 1990). A test antibody competes with a reference antibody if an excess of a test antibody inhibits binding of the reference antibody.
(87) Antibodies identified by competition assay (competing antibodies) include antibodies that bind to the same epitope as the reference antibody and antibodies that bind to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur. Antibodies identified by a competition assay also include those that indirectly compete with a reference antibody by causing a conformational change in the target protein thereby preventing binding of the reference antibody to a different epitope than that bound by the test antibody.
(88) An antibody effector function refers to a function contributed by an Fc region of an Ig. Such functions can be, for example, antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), or complement-dependent cytotoxicity (CDC). Such function can be effected by, for example, binding of an Fc region to an Fc receptor on an immune cell with phagocytic or lytic activity or by binding of an Fc region to components of the complement system. Typically, the effect(s) mediated by the Fc-binding cells or complement components result in inhibition and/or depletion of the CD47-targeted cell. Fc regions of antibodies can recruit Fc receptor (FcR)-expressing cells and juxtapose them with antibody-coated target cells. Cells expressing surface FcR for IgGs including FcγRIII (CD16), FcγRII (CD32) and FcγRIII (CD64) can act as effector cells for the destruction of IgG-coated cells. Such effector cells include monocytes, macrophages, natural killer (NK) cells, neutrophils and eosinophils. Engagement of FcγR by IgG activates ADCC or ADCP. ADCC is mediated by CD16+ effector cells through the secretion of membrane pore-forming proteins and proteases, while phagocytosis is mediated by CD32+ and CD64+ effector cells (see Fundamental Immunology, 4.sup.th ed., Paul ed., Lippincott-Raven, N.Y., 1997, Chapters 3, 17 and 30; Uchida et al., J. Exp. Med. 199:1659-69, 2004; Akewanlop et al., Cancer Res. 61:4061-65, 2001; Watanabe et al., Breast Cancer Res. Treat. 53: 199-207, 1999).
(89) In addition to ADCC and ADCP, Fc regions of cell-bound antibodies can also activate the complement classical pathway to elicit CDC. C1q of the complement system binds to the Fc regions of antibodies when they are complexed with antigens. Binding of C1q to cell-bound antibodies can initiate a cascade of events involving the proteolytic activation of C4 and C2 to generate the C3 convertase. Cleavage of C3 to C3b by C3 convertase enables the activation of terminal complement components including C5b, C6, C7, C8 and C9. Collectively, these proteins form membrane-attack complex pores on the antibody-coated cells. These pores disrupt the cell membrane integrity, killing the target cell (see Immunobiology, 6.sup.th ed., Janeway et al, Garland Science, N. Y., 2005, Chapter 2).
(90) The term “antibody-dependent cellular cytotoxicity” or “ADCC” refers to a mechanism for inducing cell death that depends on the interaction of antibody-coated target cells with immune cells possessing lytic activity (also referred to as effector cells). Such effector cells include natural killer cells, monocytes/macrophages and neutrophils. The effector cells attach to an Fc region of Ig bound to target cells via their antigen-combining sites. Death of the antibody-coated target cell occurs as a result of effector cell activity. In certain exemplary embodiments, an anti-CD47 IgG1 antibody of the invention mediates equal or increased ADCC relative to a parental antibody and/or relative to an anti-CD47 IgG3 antibody.
(91) The term “antibody-dependent cellular phagocytosis” or “ADCP” refers to the process by which antibody-coated cells are internalized, either in whole or in part, by phagocytic immune cells (e.g., by macrophages, neutrophils and/or dendritic cells) that bind to an Fc region of Ig. In certain exemplary embodiments, an anti-CD47 IgG1 antibody of the invention mediates equal or increased ADCP relative to a parental antibody and/or relative to an anti-CD47 IgG3 antibody.
(92) The term “complement-dependent cytotoxicity” or “CDC” refers to a mechanism for inducing cell death in which an Fc region of a target-bound antibody activates a series of enzymatic reactions culminating in the formation of holes in the target cell membrane.
(93) Typically, antigen-antibody complexes such as those on antibody-coated target cells bind and activate complement component C1q, which in turn activates the complement cascade leading to target cell death. Activation of complement may also result in deposition of complement components on the target cell surface that facilitate ADCC by binding complement receptors (e.g., CR3) on leukocytes.
(94) A “cytotoxic effect” refers to the depletion, elimination and/or killing of a target cell. A “cytotoxic agent” refers to a compound that has a cytotoxic effect on a cell, thereby mediating depletion, elimination and/or killing of a target cell. In certain embodiments, a cytotoxic agent is conjugated to an antibody or administered in combination with an antibody. Suitable cytotoxic agents are described further herein.
(95) A “cytostatic effect” refers to the inhibition of cell proliferation. A “cytostatic agent” refers to a compound that has a cytostatic effect on a cell, thereby mediating inhibition of growth and/or expansion of a specific cell type and/or subset of cells. Suitable cytostatic agents are described further herein.
(96) The terms “expression unit” and “expression cassette” are used interchangeably herein and denote a nucleic acid segment encoding a polypeptide of interest and capable of providing expression of the nucleic acid segment in a host cell. An expression unit typically comprises a transcription promoter, an open reading frame encoding the polypeptide of interest, and a transcription terminator, operably linked. In addition to a transcriptional promoter and terminator, an expression unit may further include other nucleic acid segments such as, e.g., an enhancer or a polyadenylation signal.
(97) The term “expression vector” refers to a nucleic acid molecule, linear or circular, comprising one or more expression units. In addition to one or more expression units, an expression vector may also include additional nucleic acid segments such as, for example, one or more origins of replication or one or more selectable markers.
(98) Expression vectors are generally derived from plasmid or viral DNA, or may contain elements of both.
(99) The term “patient” or “subject” includes human and other mammalian subjects such as non-human primates, rabbits, rats, mice, and the like and transgenic species thereof, that receive either prophylactic or therapeutic treatment. In certain exemplary embodiments, a subject is a human patient suffering from or at risk of developing cancer, e.g., a solid tumor, that optionally secretes one or more proteases capable of cleaving a masking domain (e.g., a coiled coil masking domain) of an anti-CD47 antibody described herein.
(100) The term “effective amount,” in the context of treatment of a CD47-expressing disorder by administration of an anti-CD47 antibody as described herein, refers to an amount of such antibody that is sufficient to inhibit the occurrence or ameliorate one or more symptoms of a CD47-related disorder (e.g., a CD47-expressing cancer). An effective amount of an antibody is administered in an “effective regimen.” The term “effective regimen” refers to a combination of amount of the antibody being administered and dosage frequency adequate to accomplish prophylactic or therapeutic treatment of the disorder (e.g., prophylactic or therapeutic treatment of a CD47-expressing cancer).
(101) The term “pharmaceutically acceptable” means approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term “pharmaceutically compatible ingredient” refers to a pharmaceutically acceptable diluent, adjuvant, excipient, or vehicle with which an anti-CD47 antibody is formulated.
(102) The phrase “pharmaceutically acceptable salt,” refers to pharmaceutically acceptable organic or inorganic salts. Exemplary salts include sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p toluenesulfonate, and pamoate (i.e., 1,1′-methylene bis-(2 hydroxy-3-naphthoate) salts. A pharmaceutically acceptable salt may further comprise an additional molecule such as, e.g., an acetate ion, a succinate ion or other counterion. A counterion may be any organic or inorganic moiety that stabilizes the charge on the parent compound. Furthermore, a pharmaceutically acceptable salt may have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counter ions. Hence, a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counterion.
(103) Unless otherwise apparent from the context, when a value is expressed as “about” X or “approximately” X, the stated value of X will be understood to be accurate to ±10%.
(104) Solvates in the context of the invention are those forms of the compounds of the invention that form a complex in the solid or liquid state through coordination with solvent molecules. Hydrates are one specific form of solvates, in which the coordination takes place with water. In certain exemplary embodiments, solvates in the context of the present invention are hydrates.
(105) The term “hemagglutination” refers to the process by which red blood cells are clumped together. Hemagglutination is a known, undesirable side-effect of anti-CD47 antibodies in the art. The humanized anti-CD47 antibodies of the invention optionally mediate reduced hemagglutination relative to a murine parental anti-CD47 antibody and/or relative to one or more anti-CD47 antibodies known in the art.
II. Anti-CD47 Antibodies and Antigen-Binding Fragments
(106) The present invention provides isolated, recombinant and/or synthetic anti-CD47 human, primate, rodent, mammalian, chimeric, humanized and/or CDR-grafted antibodies and antigen-binding fragments thereof, as well as compositions and nucleic acid molecules comprising at least one polynucleotide encoding at least a portion of one anti-CD47 antibody molecule. The present invention further includes, but is not limited to, methods of making and using such nucleic acids and antibodies including diagnostic and therapeutic compositions, methods and devices. In certain exemplary embodiments, humanized anti-CD47 IgG1 antibodies are provided. In other exemplary embodiments, masked humanized anti-CD47 IgG1 antibodies are provided. In still other exemplary embodiments, humanized anti-CD47 IgG1 antibodies comprising a stub are provided.
(107) In particular embodiments of the invention, humanized anti-CD47 antibodies are provided having one or more of the following activities: 1) enhanced antigen binding relative to a reference antibody (e.g., a murine parental antibody); 2) enhanced Antibody Dependent Cellular Cytotoxicity (ADCC) relative to a reference antibody (e.g., a murine parental antibody); 3) enhanced phagocytosis (e.g., Antibody Dependent Cellular Phagocytosis (ADCP)) relative to a reference antibody (e.g., a murine parental antibody); 4) reduced red blood cell hemagglutination (HA), relative to a reference antibody (e.g., a murine parental antibody); 5) binding to a three-dimensional (i.e., non-linear) CD47 epitope.
(108) Exemplary anti-CD47 antibodies and antigen-binding fragments thereof of the invention include the following CD47 antibody heavy chain/light chain pairs: hB6H12.1-hvH1/hvK1; hB6H12.2-hvH1/hvK2; hB6H12.3-hvH1/hvK3; hB6H12.4-hvH1/hvK4; hB6H12.5-hvH2/hvK1; hB6H12.6-hvH2/hvK2; hB6H12.7-hvH2/hvK3; hB6H12.8-hvH2/hvK4; hB6H12.9-hvH3/hvK1; hB6H12.10-hvH3/hvK2; hB6H12.11-hvH3/hvK3; hB6H12.12-hvH3/hvK4; hB6H12.13-hvH4/hvK1; hB6H12.14-hvH4/hvK2; hB6H12.15-hvH4/hvK3; hB6H12.16-hvH4/hvK4; hB6H12.17-hvH5/hvK1; hB6H12.18-hvH5/hvK2; hB6H12.19-hvH5/hvK3; hB6H12.20-hvH5/hvK4; hB6H12.21-hvH6/hvK1; hB6H12.22-hvH6/hvK2; hB6H12.23-hvH6/hvK3; hB6H12.24-hvH6/hvK4; hB6H12.3 (deamidation mutant)-hvH1/hvK3 G91A; Ab47-HV3-7/HJ4/KV3D-11/KJ1; and mB6H12-vH1/vL. Exemplary anti-CD47 antibody heavy chain variable region sequences, light chain variable regions, heavy chain CDRs and light chain CDRs can be found at Table 1-Table 6. The amino acid sequences for the heavy chain and light chain of an exemplary humanized anti-CD47 antibody can be found at Table 7.
(109) TABLE-US-00001 TABLE 1 Heavy chain variable sequences derived from the murine B6H12 antibody. Kabat CDRs are underlined, and IMGT CDRs are bolded. Variant Sequence mB6h12 vH EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPDKRLEW VATITSGGTYTYYPDSVKGRFTISRDNAKNTLYLQIDSLKSEDTAIYFCA RSLAGNAMDYWGQGTSVTVSS (SEQ ID NO: 1) Ab47vH EVQLVESGGGLVQPGGSLRLSCAASGFTFSGYGMSWVRQAPGKGLEW (HV3-7/HJ4) VATITSGGTYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYY CARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 2) hvH1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSGYGMSWVRQAPGKRLEW VATITSGGTYTYYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYFC ARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 3) hvH2 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEW VATITSGGTYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYF CARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 4) hvH3 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEW VATITSGGTYTYYADSVKGRFTISRDNSKNTLYLQINSLRAEDTAVYFC ARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 5) hvH4 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMNWVRQAPGKGLEW VATITSGGTYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYY CARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 6) hvH5 EVQLVESGGGLVQPGGSLRLSCAASGFTFSGYGMSWVRQAPGKGLEW VATITSGGTYTYYADSVKGRFTISRDNSKNTLYLQINSLRAEDTAVYYC ARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 7) hvH6 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMHWVRQAPGKGLVW VATITSGGTYTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYY CARSLAGNAMDYWGQGTLVTVSS (SEQ ID NO: 8)
(110) TABLE-US-00002 TABLE 2 Light chain variable sequences derived from the murine B6H12 antibody. Kabat CDRs are underlined, and IMGT CDRs are bolded. Variant Sequence mB6h12 vL DIVMTQSPATLSVTPGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIK FASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHGFPRTFG GGTKLEIKR (SEQ ID NO: 9) Ab47vL EIVLTQSPATLSLSPGERATLSCRASQTISDYLHWYQQKPGQAPRLLIKF (KV3D-11/ ASQSISGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQNGHGFPRTFGQ KJ1) GTKVEIKR (SEQ ID NO: 10) hvKl EIVMTQSPDFQSVTPKEKVTLTCRASQTISDYLHWYQQKPDQSPKLLIK FASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAVYYCQNGHGFPRTF GQGTKLEIK(R) (SEQ ID NO: 11) hvK2 EIVMTQSPDFQSVTPKEKVTLTCRASQTISDYLHWYQQKPDQSPKLLIK FASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCQNGHGFPRTFG QGTKLEIK(R) (SEQ ID NO: 12) hvK3 EIVMTQSPDFQSVTPKEKVTLTCRASQTISDYLHWYQQKPDQSPKLLIK FASQSISGVPSRFSGSGSGSDFTLTINSLEAEDAATYYCQNGHGFPRTFG QGTKLEIK(R) (SEQ ID NO: 13) hvK4 DIQMTQSPSSLSASVGDRVTLTCRASQTISNYLAWYQQKPGKVPKLLIK FASTLQSGVPSRFSGSGSGSDFTLTISSLQPEDVATYYCQNGHGFPRTF GQGTKLEIK(R) (SEQ ID NO: 14) hvK3 EIVMTQSPDFQSVTPKEKVTLTCRASQTISDYLHWYQQKPDQSPKLLIK (G91A) FASQSISGVPSRFSGSGSGSDFTLTINSLEAEDAATYYCQNAHGFPRTFG QGTKLEIKR (SEQ ID NO: 15)
(111) TABLE-US-00003 TABLE 3 Heavy chain CDR sequences of variant antibodies (Kabat). CDR Sequence hvH1 & hvH5 HCDR1 (Kabat) GYGMS (SEQ ID NO: 16) hvH1 HCDR2 (Kabat) TITSGGTYTYYPDSVKG (SEQ ID NO: 17) hvH1-hvH6 HCDR3 (Kabat) SLAGNAMDY (SEQ ID NO: 18) hvH2 & hvH3 HCDR1 (Kabat) SYAMS (SEQ ID NO: 19) hvH2, hvH3, & hvH5 HCDR2 (Kabat) TITSGGTYTYYADSVKG (SEQ ID NO: 20) hvH4 HCDR1 (Kabat) SYGMN (SEQ ID NO: 21) hvH4 HCDR2 (Kabat) TITSGGTYIYYADSVKG (SEQ ID NO: 22) hvH6 HCDR1 (Kabat) SYGMH (SEQ ID NO: 23) hvH6 HCDR2 (Kabat) TITSGGTYTSYADSVKG (SEQ ID NO: 24)
(112) TABLE-US-00004 TABLE 4 Heavy chain CDR sequences of variant antibodies (IMGT). CDR Sequence hvH1 & hvH5 HCDR1 (IMGT) GFTFSGYG (SEQ ID NO: 25) hvH1-hvH3, hvH5-hvH6 HCDR2 (IMGT) ITSGGTYT (SEQ ID NO: 26) hvH1-hvH6 HCDR3 (IMGT) ARSLAGNAMDY (SEQ ID NO: 27) hvH2 & hvH3 HCDR1 (IMGT) GFTFSSYA (SEQ ID NO: 28) hvH4 & hvH6 HCDR1 (IMGT) GFTFSSYG (SEQ ID NO: 29) hvH4 HCDR2 (IMGT) ITSGGTYI (SEQ ID NO: 30)
(113) TABLE-US-00005 TABLE 5 Light chain CDR sequences of variant antibodies (Kabat). CDR Sequence hvK1-hvK3 LCDR1 (Kabat) RASQTISDYLH (SEQ ID NO: 31) hvK1-hvK3 LCDR2 (Kabat) FASQSIS (SEQ ID NO: 32) hvK1-hvK4 LCDR3 (Kabat) QNGHGFPRT (SEQ ID NO: 33) hvK4 LCDR1 (Kabat) RASQTISNYLA (SEQ ID NO: 34) hvK4 LCDR2 (Kabat) FASTLQS (SEQ ID NO: 35) hvK3 (G91A) LCDR3 (Kabat) QNAHGFPRT (SEQ ID NO: 36)
(114) TABLE-US-00006 TABLE 6 Light chain CDR sequences of variant antibodies (IMGT). CDR Sequence hvK1-hvK3 LCDR1 (IMGT) QTISDY (SEQ ID NO: 37) hvK1-hvK4 LCDR2 (IMGT) FAS (SEQ ID NO: 38) hvK1-hvK4 LCDR3 (IMGT) QNGHGFPRT (SEQ ID NO: 39) hvK4 LCDR1 (IMGT) QTISNY (SEQ ID NO: 40) hvK3 (G91A) LCDR3 (IMGT) QNAHGFPRT (SEQ ID NO: 41)
(115) TABLE-US-00007 TABLE 7 Complete heavy and light chain sequences of a masked anti-CD47 antibody according to a preferred embodiment of the invention. Heavy chain and light chain sequences are in plain text (SEQ ID NOs: 42 and 43, respectively), masking sequences are in bold text, and protease cleavage sequences are underlined. Antibody Chain Sequence Heavy QGASTSVDELQAEVDQLEDENYALKTKVAQLRKKVEKLGSIPVSLRSGE Chain VQLLESGGGLVQPGGSLRLSCAASGFTFSGYGMSWVRQAPGKRLEWVATIT SGGTYTYYPDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYFCARSLAGN AMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK PSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQK (SEQ ID NO: 42) Heavy QGASTSVDELQAEVDQLEDENYALKTKVAQLRKKVEKLGS (SEQ ID NO: Chain 94) masking sequence Light QGASTTVAQLEEKVKTLRAENYELKSEVQRLEEQVAQLGSIPVSLRSGE Chain IVMTQSPDFQSVTPKEKVTLTCRASQTISDYLHWYQQKPDQSPKLLIKFASQ SISGVPSRFSGSGSGSDFTLTINSLEAEDAATYYCQNGHGFPRTFGQGTKLEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG NSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF NRGEC (SEQ ID NO: 43) Light QGASTTVAQLEEKVKTLRAENYELKSEVQRLEEQVAQLGS (SEQ ID NO: Chain 95) masking sequence
(116) hB6H12.1
(117) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 3 and/or CDRs from a LCVR set forth as SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 3/SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 3 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 11.
(118) hB6H12.2
(119) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 3 and/or CDRs from a LCVR set forth as SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 3/SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 3 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 12.
(120) hB6H12.3
(121) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 3 and/or CDRs from a LCVR set forth as SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 3/SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 3 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 13.
(122) hB6H12.4
(123) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 3 and/or CDRs from a LCVR set forth as SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35, and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 3/SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 3 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 14.
(124) hB6H12.5
(125) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 4 and/or CDRs from a LCVR set forth as SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 4/SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 4 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 11.
(126) hB6H12.6
(127) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 4 and/or CDRs from a LCVR set forth as SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 4/SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 4 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 12.
(128) hB6H12.7
(129) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 4 and/or CDRs from a LCVR set forth as SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 4/SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 4 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 13.
(130) hB6H12.8
(131) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 4 and/or CDRs from a LCVR set forth as SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35, and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 4/SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 4 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 14.
(132) hB6H12.9
(133) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 5 and/or CDRs from a LCVR set forth as SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 5/SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 5 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 11.
(134) hB6H12.10
(135) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 5 and/or CDRs from a LCVR set forth as SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 5/SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 5 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 12.
(136) hB6H12.11
(137) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 5 and/or CDRs from a LCVR set forth as SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 5/SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 5 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 13.
(138) hB6H12.12
(139) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 5 and/or CDRs from a LCVR set forth as SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 19, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35, and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 28, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 5/SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 5 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 14.
(140) hB6H12.13
(141) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 6 and/or CDRs from a LCVR set forth as SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 21, 22, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 30 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 6/SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 6 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 11.
(142) hB6H12.14
(143) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 6 and/or CDRs from a LCVR set forth as SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 21, 22, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 30 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 6/SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 6 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 12.
(144) hB6H12.15
(145) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 6 and/or CDRs from a LCVR set forth as SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 21, 22, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 30 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 6/SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 6 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 13.
(146) hB6H12.16
(147) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 6 and/or CDRs from a LCVR set forth as SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 21, 22, and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35, and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 30 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 6/SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 6 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 14.
(148) hB6H12.17
(149) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 7 and/or CDRs from a LCVR set forth as SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 7/SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 7 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 11.
(150) hB6H12.18
(151) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 7 and/or CDRs from a LCVR set forth as SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 7/SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 7 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 12.
(152) hB6H12.19
(153) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 7 and/or CDRs from a LCVR set forth as SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 7/SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 7 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 13.
(154) hB6H12.20
(155) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 7 and/or CDRs from a LCVR set forth as SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 20, and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35, and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 7/SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 7 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 14.
(156) hB6H12.21
(157) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 8 and/or CDRs from a LCVR set forth as SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 23, 24, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 8/SEQ ID NO: 11. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 8 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 11.
(158) hB6H12.22
(159) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 8 and/or CDRs from a LCVR set forth as SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 23, 24, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 8/SEQ ID NO: 12. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 8 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 12.
(160) hB6H12.23
(161) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 8 and/or CDRs from a LCVR set forth as SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 23, 24, and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 8/SEQ ID NO: 13. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 8 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 13.
(162) hB6H12.24
(163) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 8 and/or CDRs from a LCVR set forth as SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 23, 24, and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35, and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 29, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 8/SEQ ID NO: 14. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 8 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 14.
(164) hB6H12.3 G91A
(165) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 3 and/or CDRs from a LCVR set forth as SEQ ID NO: 15. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 34, 35 and 36. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 40, 38 and 41. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 3/SEQ ID NO: 15. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 3 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 15.
(166) Ab47
(167) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 2 and/or CDRs from a LCVR set forth as SEQ ID NO: 10. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 2/SEQ ID NO: 10. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 2 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 10.
(168) mB6H12
(169) In certain exemplary embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises CDRs from a HCVR set forth as SEQ ID NO: 1 and/or CDRs from a LCVR set forth as SEQ ID NO: 9. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 16, 17 and 18 and/or light chain CDRs of SEQ ID NOs: 31, 32 and 33. In some embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 25, 26 and 27 and/or light chain CDRs of SEQ ID NOs: 37, 38 and 39. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises the HCVR/LCVR pair SEQ ID NO: 1/SEQ ID NO: 9. In other embodiments, an anti-CD47 antibody or antigen-binding fragment thereof comprises a HCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 1 and/or comprises a LCVR that has at least about 80% homology or identity (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%) to SEQ ID NO: 9.
(170) Anti-CD47 antibodies and antigen-binding fragments thereof described herein can be expressed in a modified form. For instance, a region of additional amino acids, particularly charged amino acids, can be added to the N-terminus of an anti-CD47 antibody or an antigen-binding fragment thereof to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage. Also, peptide moieties can be added to an anti-CD47 antibody or an antigen-binding fragment thereof of the present invention to facilitate purification. Such regions can be removed prior to final preparation of an antibody molecule or at least one fragment thereof. Such methods are described in many standard laboratory manuals, such as Sambrook, supra; Ausubel, et al., ed., Current Protocols In Molecular Biology, John Wiley & Sons, Inc., NY, N.Y. (1987-2001).
(171) The anti-CD47 antibodies or antigen-binding fragments thereof described herein typically bind CD47 with an equilibrium binding constant of ≤1 μM, e.g., ≤100 nM, preferably ≤10 nM, and more preferably ≤1 nM, as measured using standard binding assays, for example, the Biacore-based binding assay.
(172) Antibody molecules of the present invention may be characterized relative to a reference anti-CD47 antibody, for example, B6H12, 2D3, MABL, CC2C6, or BRIC126. Antibody B6H12 is described, for example, in U.S. Pat. Nos. 5,057,604 and 9,017,675, is commercially available from Abcam, PLC, Santa Cruz Biotechnology, Inc., and eBioscience, Inc.
(173) Glycosylation Variants
(174) Anti-CD47 antibodies and antigen-binding fragments thereof may be glycosylated at conserved positions in their constant regions (Jefferis and Lund, (1997) Chem. Immunol. 65:111-128; Wright and Morrison, (1997) TibTECH 15:26-32). The oligosaccharide side chains of the immunoglobulins affect the protein's function (Boyd et al., (1996) Mol. Immunol. 32:1311-1318; Wittwe and Howard, (1990) Biochem. 29:4175-4180), and the intramolecular interaction between portions of the glycoprotein which can affect the conformation and presented three-dimensional surface of the glycoprotein (Jefferis and Lund, supra; Wyss and Wagner, (1996) Current Op. Biotech. 7:409-416). Oligosaccharides may also serve to target a given glycoprotein to certain molecules based upon specific recognition structures. For example, it has been reported that in agalactosylated IgG, the oligosaccharide moiety ‘flips’ out of the inter-CH2 space and terminal N-acetylglucosamine residues become available to bind mannose binding protein (Malhotra et al., (1995) Nature Med. 1:237-243). Removal by glycopeptidase of the oligosaccharides from CAMPATH-1H (a recombinant humanized murine monoclonal IgG1 antibody which recognizes the CDw52 antigen of human lymphocytes) produced in Chinese Hamster Ovary (CHO) cells resulted in a complete reduction in complement mediated lysis (CMCL) (Boyd et al., (1996) Mol. Immunol. 32:1311-1318), while selective removal of sialic acid residues using neuraminidase resulted in no loss of DMCL. Glycosylation of antibodies has also been reported to affect antibody-dependent cellular cytotoxicity (ADCC). In particular, CHO cells with tetracycline-regulated expression of α(1,4)-N-acetylglucosaminyltransferase III (GnTIII), a glycosyltransferase catalyzing formation of bisecting GlcNAc, was reported to have improved ADCC activity (Umana et al. (1999) Mature Biotech. 17:176-180).
(175) Glycosylation of antibodies is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
(176) Glycosylation variants of antibodies are variants in which the glycosylation pattern of an antibody is altered. By altering is meant deleting one or more carbohydrate moieties found in the antibody, adding one or more carbohydrate moieties to the antibody, changing the composition of glycosylation (glycosylation pattern), the extent of glycosylation, etc.
(177) Addition of glycosylation sites to an anti-CD47 antibody or an antigen-binding fragment thereof can be accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites). Similarly, removal of glycosylation sites can be accomplished by amino acid alteration within the native glycosylation sites of the antibody.
(178) The amino acid sequence is usually altered by altering the underlying nucleic acid sequence. These methods include isolation from a natural source (in the case of naturally-occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the antibody.
(179) The glycosylation (including glycosylation pattern) of antibodies may also be altered without altering the amino acid sequence or the underlying nucleotide sequence. Glycosylation largely depends on the host cell used to express the antibody. Since the cell type used for expression of recombinant glycoproteins, e.g., antibodies, as potential therapeutics is rarely the native cell, significant variations in the glycosylation pattern of the antibodies can be expected. See, e.g., Hse et al., (1997) J. Biol. Chem. 272:9062-9070. In addition to the choice of host cells, factors which affect glycosylation during recombinant production of antibodies include growth mode, media formulation, culture density, oxygenation, pH, purification schemes and the like. Various methods have been proposed to alter the glycosylation pattern achieved in a particular host organism including introducing or overexpressing certain enzymes involved in oligosaccharide production (U.S. Pat. Nos. 5,047,335; 5,510,261; 5,278,299). Glycosylation, or certain types of glycosylation, can be enzymatically removed from the glycoprotein, for example using endoglycosidase H (Endo H). In addition, the recombinant host cell can be genetically engineered, e.g., make defective in processing certain types of polysaccharides. These and similar techniques are well known in the art.
(180) The glycosylation structure of antibodies can be readily analyzed by conventional techniques of carbohydrate analysis, including lectin chromatography, NMR, Mass spectrometry, HPLC, GPC, monosaccharide compositional analysis, sequential enzymatic digestion, and HPAEC-PAD, which uses high pH anion exchange chromatography to separate oligosaccharides based on charge. Methods for releasing oligosaccharides for analytical purposes are also known, and include, without limitation, enzymatic treatment (commonly performed using peptide-N-glycosidase F/endo-β-galactosidase), elimination using harsh alkaline environment to release mainly O-linked structures, and chemical methods using anhydrous hydrazine to release both N- and O-linked oligosaccharides.
(181) A preferred form of modification of glycosylation of antibodies is reduced core fucosylation. “Core fucosylation” refers to addition of fucose (“fucosylation”) to N-acetylglucosamine (“GlcNAc”) at the reducing terminal of an N-linked glycan.
(182) A “complex N-glycoside-linked sugar chain” is typically bound to asparagine 297 (according to the number of Kabat). As used herein, the complex N-glycoside-linked sugar chain has a biantennary composite sugar chain, mainly having the following structure:
(183) ##STR00001##
where +/− indicates the sugar molecule can be present or absent, and the numbers indicate the position of linkages between the sugar molecules. In the above structure, the sugar chain terminal which binds to asparagine is called a reducing terminal (at right), and the opposite side is called a non-reducing terminal. Fucose is usually bound to N-acetylglucosamine (“GlcNAc”) of the reducing terminal, typically by an α1,6 bond (the 6-position of GlcNAc is linked to the 1-position of fucose). “Gal” refers to galactose, and “Man” refers to mannose.
(184) A “complex N-glycoside-linked sugar chain” includes 1) a complex type, in which the non-reducing terminal side of the core structure has one or more branches of galactose-N-acetylglucosamine (also referred to as “gal-GlcNAc”) and the non-reducing terminal side of Gal-GlcNAc optionally has a sialic acid, bisecting N-acetylglucosamine or the like; or 2) a hybrid type, in which the non-reducing terminal side of the core structure has both branches of a high mannose N-glycoside-linked sugar chain and complex N-glycoside-linked sugar chain.
(185) In some embodiments, the “complex N-glycoside-linked sugar chain” includes a complex type in which the non-reducing terminal side of the core structure has zero, one or more branches of galactose-N-acetylglucosamine (also referred to as “gal-GlcNAc”) and the non-reducing terminal side of Gal-GlcNAc optionally further has a structure such as a sialic acid, bisecting N-acetylglucosamine or the like.
(186) According to the present methods, typically only a minor amount of fucose is incorporated into the complex N-glycoside-linked sugar chain(s) of humanized or chimeric antibodies. For example, in various embodiments, less than about 60%, less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, or less than about 3% of the molecules of an antibody have core fucosylation by fucose. In some embodiments, about 2% of the molecules of the antibody has core fucosylation by fucose.
(187) In certain embodiments, only a minor amount of a fucose analog (or a metabolite or product of the fucose analog) is incorporated into the complex N-glycoside-linked sugar chain(s). For example, in various embodiments, less than about 60%, less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, or less than about 3% of humanized or chimeric antibodies have core fucosylation by a fucose analog or a metabolite or product of the fucose analog. In some embodiments, about 2% of humanized or chimeric antibodies have core fucosylation by a fucose analog or a metabolite or product of the fucose analog.
(188) Methods of making non-fucosylated antibodies by incubating antibody-producing cells with a fucose analogue are described, e.g., in WO2009/135181. Briefly, cells that have been engineered to express humanized or chimeric antibodies antibody are incubated in the presence of a fucose analogue or an intracellular metabolite or product of the fucose analog. An intracellular metabolite can be, for example, a GDP-modified analog or a fully or partially de-esterified analog. A product can be, for example, a fully or partially de-esterified analog. In some embodiments, a fucose analogue can inhibit an enzyme(s) in the fucose salvage pathway. For example, a fucose analog (or an intracellular metabolite or product of the fucose analog) can inhibit the activity of fucokinase, or GDP-fucose-pyrophosphorylase. In some embodiments, a fucose analog (or an intracellular metabolite or product of the fucose analog) inhibits fucosyltransferase (preferably a 1,6-fucosyltransferase, e.g., the FUT8 protein). In some embodiments, a fucose analog (or an intracellular metabolite or product of the fucose analog) can inhibit the activity of an enzyme in the de novo synthetic pathway for fucose. For example, a fucose analog (or an intracellular metabolite or product of the fucose analog) can inhibit the activity of GDP-mannose 4,6-dehydratase or/or GDP-fucose synthetase. In some embodiments, the fucose analog (or an intracellular metabolite or product of the fucose analog) can inhibit a fucose transporter (e.g., GDP-fucose transporter).
(189) In one embodiment, the fucose analogue is 2-flurofucose. Methods of using fucose analogues in growth medium and other fucose analogues are disclosed, e.g., in WO/2009/135181, which is herein incorporated by reference.
(190) Other methods for engineering cell lines to reduce core fucosylation included gene knock-outs, gene knock-ins and RNA interference (RNAi). In gene knock-outs, the gene encoding FUT8 (alpha 1,6-fucosyltransferase enzyme) is inactivated. FUT8 catalyzes the transfer of a fucosyl residue from GDP-fucose to position 6 of Asn-linked (N-linked) GlcNac of an N-glycan. FUT8 is reported to be the only enzyme responsible for adding fucose to the N-linked biantennary carbohydrate at Asn297. Gene knock-ins add genes encoding enzymes such as GNTIII or a Golgi alpha mannosidase II. An increase in the levels of such enzymes in cells diverts monoclonal antibodies from the fucosylation pathway (leading to decreased core fucosylation), and having increased amount of bisecting N-acetylglucosamines. RNAi typically also targets FUT8 gene expression, leading to decreased mRNA transcript levels or knocking out gene expression entirely. Any of these methods can be used to generate a cell line that would be able to produce a non-fucosylated antibody, e.g., a humanized or chimeric antibody.
(191) Many methods are available to determine the amount of fucosylation on an antibody. Methods include, e.g., LC-MS via PLRP-S chromatography and electrospray ionization quadrupole TOF MS.
(192) Coiled Coil Masking Agents
(193) In certain embodiments of the invention, an anti-CD47 antibody or antigen-binding fragment thereof is associated with a coiled coil masking agent (also referred to as a “coiled coil masking domain” or a “masking domain”) that prevents binding of the anti-CD47 antibody or antigen-binding fragment thereof to CD47. In various embodiments, an anti-CD47 antibody or antigen-binding fragment thereof associated with a masking domain is referred to as a “masked antibody.”
(194) A coiled coil is a structural motif in proteins and peptides in which two or more alpha-helices wind around each other to form a supercoil. There can be two, three or four helices in a coiled coil bundle and the helices can either run in the same (parallel) or in the opposite (antiparallel) directions.
(195) Coiled coils typically comprise sequence elements of three and four residues whose hydrophobicity pattern and residue composition are compatible with the structure of amphipathic alpha-helices. The alternating three and four residue sequence elements constitute heptad repeats in which the amino-acids are designated ‘a,’ ‘b,’ ‘c,’ ‘d,’ ‘e,’ ‘f’ and ‘g.’ Residues in positions ‘a’ and are generally hydrophobic and form a zig-zag pattern of knobs and holes that interlock with a similar pattern on another strand to form a tight-fitting hydrophobic core. Of the remaining residues, ‘b,’ ‘c’ and ‘f’ tend to be charged. Therefore, the formation of a heptad repeat depends on the physical properties of hydrophobicity and charge that are required at a particular position, not on a specific amino acid. In certain exemplary embodiments, coiled coils of the present invention are formed from two coiled coil-forming peptides.
(196) Examples of consensus formulae for heptad repeats in coiled coil-forming peptides are provided by WO2011034605, incorporated herein by reference in its entirety for all purposes.
(197) Exemplary consensus formulae according to certain embodiments are set forth below:
(X1,X2,X3,X4,X5,X6,X7)n, wherein: Formula 1: X1 is a hydrophobic amino acid or asparagine; X2, X3 and X6 are any amino acid; X4 is a hydrophobic amino acid; X5 and X7 are each a charged amino acid residue; and n is a positive integer.
(X1′,X2′,X3′,X4′,X5,X6,X7)n, wherein: Formula 2: X1′ is a hydrophobic amino acid or asparagine; X2′, X′3 and X′6 are each any amino acid residue; X4′ is hydrophobic amino acid; X5′ and X7′ are each a charged amino acid residue; wherein n in formula 1 and 2 is greater or equal to 2; and n is a positive integer.
(198) In certain embodiments in which peptides of Formula 1 and Formula 2 form a coiled coil, X5 of Formula 1 is opposite in charge to X′7 of Formula 2, and X7 or Formula 1 is opposite in charge to X'S of Formula 2. Heptad repeats within a coiled coil forming peptide can be the same or different from each other while conforming to Formula 1 and/or 2.
(199) Coiled coils can be homodimeric or heterodimeric. Examples of peptides that can form coiled coil according to certain exemplary embodiments are shown in Table 8. The peptide sequences can be used as is, or their components can be used in other combinations. For example, the Vel coiled coil-forming peptide can be used with other linker sequences. Sequences shown for light chains can also be used with heavy chains and vice versa.
(200) In certain exemplary embodiments, a bivalent antibody comprising two light and heavy chain pairs is provided, wherein the N-termini of one or more of the light chains and/or the heavy chains are linked via linkers comprising a protease cleavage site to coiled coil-forming peptides that associate to form a coiled coil, reducing binding affinity of the light and heavy chain pair to a target. Optionally, the peptides associate without forming a disulfide bridge.
(201) Optionally, the two light and heavy chain pairs are the same. Optionally, the two light and heavy chain pairs are different. Optionally, the light chains include a light chain variable region and light chain constant region and the heavy chains include a heavy chain variable region and heavy chain constant region. Optionally, the heavy chain region includes CH1, hinge, CH2 and CH3 regions. Optionally, the two light chain are linked to a first heterologous peptide and the two heavy chains to a second heterologous peptide.
(202) Optionally, the protease cleavage site is an MMP1 or MMP2 cleavage site.
(203) Optionally, the target is CD47.
(204) Optionally, antigen binding is reduced at least 100-fold by the presence of a masking agent (e.g., a coiled coil masking agent). Optionally, antigen binding is reduced 200-1500-fold by the presence of a masking agent (e.g., a coiled coil masking agent). Optionally, cytotoxicity of the conjugate is reduced at least 100-fold by the presence of a masking agent (e.g., a coiled coil masking agent). Optionally, cytotoxicity of the conjugate is reduced at least 200-1500-fold by the presence of a masking agent (e.g., a coiled coil masking agent).
(205) Optionally, the coiled coil forming peptides are linked to the N-termini of the heavy and light chains in the same orientation. Optionally, the coiled coil-forming peptides are linked to the N-termini of the heavy and light chains in opposing orientations. Optionally, multiple copies of the coiled coil forming peptide are linked in tandem to the N-termini of the heavy and light chains.
(206) Exemplary coiled coil-forming peptides linkers and protease sites according to certain embodiments of the invention are shown in
(207) According to certain exemplary embodiments, a peptide comprising or consisting of SEQ ID NO: 51 (Vel LC in Table 8) is used to provide a linker including a protease cleavage site and a coiled coil-forming peptide linked to the N-terminus of the light chain, and a peptide of sequence SEQ ID NO: 50 (Vel HC in Table 8) to provide a linker including a protease cleavage site and the coiled coil forming peptide linked to the N-terminus of the heavy chain, or vice versa. Peptides comprising these sequences can be linked to any of the antibodies disclosed herein.
(208) In certain exemplary embodiments, amino acid substitutions in a variant peptide that forms a coiled coil are conservative substitutions. In other exemplary embodiments, a repeating heptad pattern is retained in a variant peptide whereby a coiled coil forming peptide can be subdivided into contiguous heptad segments conforming to a formula categorizing amino acids occupying positions in the formula by amino acid type, such as in Formula 1 and/or in Formula 2. In certain embodiments, there are no more than 1 or 2 substitutions per heptad of amino acids, and any such substitutions are conservative. In other embodiments, a variant can have at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to a coiled coil-forming peptide described herein, and be capable of forming a coiled coil.
(209) Exemplary peptides that form coiled coils are set forth at Table 8A and Table 8B.
(210) TABLE-US-00008 TABLE 8A Masking domain sequences according to certain exemplary embodiments. Cleavage sequences are underlined. Masking Peptide Sequence A2B1 HC GASTSVDELQAEVDQLQDENYALKTKVAQLRKKVEKLSEGGGGGPLGVR GGGGS (SEQ ID NO: 44) A2B1 LC GASTTVAQLRERVKTLRAQNYELESEVQRLREQVAQLASGGGGGPLGVR GGGGS (SEQ ID NO: 45) M11 HC LEIEAAFLERENTALETRVAELRQRVQRARNRVSQYRTRYGGGGGPLGVR GGGGS (SEQ ID NO: 46) M11 LC LEIRAAFLRQRNTALRTEVAELEQEVQRLENEVSQYETRYGGGGGPLGVR GGGGS (SEQ ID NO: 47) M15 HC LEIRAAFLRRRNTALRTRVAELRQRVQRLRNIVSQYETRYGGGGGGPLGV RGGGGS (SEQ ID NO: 48) M15 LC LEIEAAFLEQENTALETEVAELEQEVQRLENIVSQYETRYGGGGGGPLGVR GGGGS (SEQ ID NO: 49) Vel HC GASTSVDELQAEVDQLEDENYALKTKVAQLRKKVEKLGSIPVSLRSG (SEQ ID NO: 50) Vel LC GASTTVAQLEEKVKTLRAENYELKSEVQRLEEQVAQLGSIPVSLRSG (SEQ ID NO: 51) Fos-Jun GALTDTLQAETDQLEDKKSALQTEIANLLKEKEKLEFILAAHGGGGGPLG HC VRGGGGS (SEQ ID NO: 52) Fos-Jun GARIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNYGGGGGP LC LGVRGGGGS (SEQ ID NO: 53) A4B4 HC GKIAALKQKIAALKYKNAALKKKIAALKQGGGGGPLGVRGGGGS (SEQ ID NO: 54) A4B4 LC GEIAALEQEIAALEKENAALEWEIAALEQGGGGGPLGVRGGGGS (SEQ ID NO: 55)
(211) TABLE-US-00009 TABLE 8B Masking domain sequences according to certain exemplary embodiments. Cleavage sequences are underlined. EAC residues are included. Masking Peptide Sequence CA2B1 HC EACGASTSVDELQAEVDQLQDENYALKTKVAQLRKKVEKLSEGGGGGPL GVRGGGGS (SEQ ID NO: 75) CA2B1 LC EACGASTTVAQLRERVKTLRAQNYELESEVQRLREQVAQLASGGGGGPL GVRGGGGS (SEQ ID NO: 76) CM11 HC EACLEIEAAFLERENTALETRVAELRQRVQRARNRVSQYRTRYGGGGGPL GVRGGGGS (SEQ ID NO: 77) CM11 LC EACLEIRAAFLRQRNTALRTEVAELEQEVQRLENEVSQYETRYGGGGGPL GVRGGGGS (SEQ ID NO: 78) CM15 HC EACLEIRAAFLRRRNTALRTRVAELRQRVQRLRNIVSQYETRYGGGGGGP LGVRGGGGS (SEQ ID NO: 79) CM15 LC EACLEIEAAFLEQENTALETEVAELEQEVQRLENIVSQYETRYGGGGGGPL GVRGGGGS (SEQ ID NO: 80) CVel HC EACGASTSVDELQAEVDQLEDENYALKTKVAQLRKKVEKLGSIPVSLRSG (SEQ ID NO: 81) CVel LC EACGASTTVAQLEEKVKTLRAENYELKSEVQRLEEQVAQLGSIPVSLRSG (SEQ ID NO: 82) CFos-Jun EACGALTDTLQAETDQLEDKKSALQTEIANLLKEKEKLEFILAAHGGGGG HC PLGVRGGGGS (SEQ ID NO: 83) CFos-Jun EACGARIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNYGGG LC GGPLGVRGGGGS (SEQ ID NO: 84) CA4B4 HC EACGKIAALKQKIAALKYKNAALKKKIAALKQGGGGGPLGVRGGGGS (SEQ ID NO: 85) CA4B4 LC EACGEIAALEQEIAALEKENAALEWEIAALEQGGGGGPLGVRGGGGS (SEQ ID NO: 86)
(212) Linkers and Cleavage Sites
(213) In certain embodiments of the invention, a linker is used to bind a coiled coil masking agent to an anti-CD47 antibody or antigen-binding fragment thereof. The linkers can be any segments of amino acids conventionally used as linker for joining peptide domains. Suitable linkers can vary in length, such as from 1-20, 2-15, 3-12, 4-10, 5, 6, 7, 8, 9 or 10. Some such linkers include a segment of polyglycine. Some such linkers include one or more serine residues, often at positions flanking the glycine residues. Other linkers include one or more alanine residues. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). Some exemplary linkers are in the form S(G)nS, wherein n is from 5-20. Other exemplary linkers are (G)n, glycine-serine polymers (including, for example, (GS)n, (GSGGS)n [(GSGGS) is SEQ ID NO: 59) and (GGGS)n, [(GGGS) is SEQ ID NO: 60) where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Some examples of linkers are Ser-(Gly)10-Ser (SEQ ID NO: 61), Gly-Gly-Ala-Ala (SEQ ID NO: 62), Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 63), Leu-Ala-Ala-Ala-Ala (SEQ ID NO: 64), Gly-Gly-Ser-Gly (SEQ ID NO: 65), Gly-Gly-Ser-Gly-Gly (SEQ ID NO: 66), Gly-Ser-Gly-Ser-Gly (SEQ ID NO: 67), Gly-Ser-Gly-Gly-Gly (SEQ ID NO: 68), Gly-Gly-Gly-Ser-Gly (SEQ ID NO: 69), Gly-Ser-Ser-Ser-Gly (SEQ ID NO: 70), and the like.
(214) The protease site is preferably recognized and cleaved by a protease expressed extracellularly so it contacts a masked antibody, releasing the masked antibody and allowing it to contact its target, such as a receptor extracellular domain or soluble ligand. Several matrix metalloproteinase sites (MMP1-28) are suitable. MMPs play a role in tissue remodeling and are implicated in neoplastic processes such as morphogenesis, angiogenesis and metastasis. Some exemplary protease sites are PLG-XXX (SEQ ID NO: 71), a well-known endogenous sequence for MMPs, PLG-VR (SEQ ID NO: 72) (WO2014193973) and IPVSLRSG (SEQ ID NO: 73) (Turk et al., Nat. Biotechnol., 2001, 19, 661-667), LSGRSDNY (SEQ ID NO: 74) (Cytomyx) and GPLGVR (SEQ ID NO: 57) (Chang et al., Clin. Cancer Res. 2012 Jan. 1; 18(1):238-47). Additional examples of MMPs are provided in US 2013/0309230, WO 2009/025846, WO 2010/081173, WO 2014/107599, WO 2015/048329, US 20160160263, and Ratnikov et al., Proc. Natl. Acad. Sci. USA, 111: E4148-E4155 (2014).
(215) TABLE-US-00010 TABLE 9 Protease cleavage sequences. The MMP-cleavage site is indicated by * while the uPA/matriptase/ legumain cleavage sites are indicated by **. Cleavage Site Name Sequence M2 GPLG*VR** (SEQ ID NO: 57) IPV IPVS*LR**SG (SEQ ID NO: 58)
Linking Coiled Coil Masking Agents to Anti-CD47 Antibodies
(216) Coiled coils forming peptides are linked to the N-termini of antibody variable regions via a linker including a protease site. A typical antibody includes a heavy and light chain variable region, in which case a coiled coil forming peptide is linked to the N-termini of each. A bivalent antibody has two binding sites, which may or may not be the same. In a normal monospecific antibody, the binding sites are the same and the antibody has two identical light and heavy chain pairs. In this case, each heavy chain is linked to the same coiled coil forming peptide and each light chain to the same coiled coil forming peptide (which may or may not be the same as the peptide linked to the heavy chain). In a bispecific antibody, the binding sites are different and formed from two different heavy and light chain pairs. In such a case, the heavy and light chain variable region of one binding site are respectively linked to coiled coil forming peptides as are the heavy and light chain variable regions of the other binding site. Typically both heavy chain variable regions are linked to the same type of coiled coil forming peptide as are both light chain variable regions.
(217) A coiled coil-forming peptide can be linked to an antibody variable region via a linker including a protease site. Typically, the same linker with the same protease cleavage site is used for linking each heavy or light chain variable region of an antibody to a coiled coil peptide. The protease cleavage site should be one amenable to cleavage by a protease present extracellularly in the intended target tissue or pathology, such as a cancer, such that cleavage of the linker releases the antibody from the coiled coil masking its activity allowing the antibody to bind to its intended target, such as a cell-surface antigen or soluble ligand.
(218) As well as the variable regions, a masked antibody typically includes all or part of a constant region, which can include any or all of a light chain constant region, CH1, hinge, CH2 and CH3 regions. As with other antibodies one or more C-terminal residues can be proteolytically processed or derivatized.
(219) Coiled coils can be formed from the same peptide forming a homodimer or two different peptides forming a heterodimer. For formation of a homodimer, light and heavy antibody chains are linked to the same coiled coil forming peptide. For formation of a heterodimer, light and heavy antibody chains are linked to different coiled coils peptides. For some pairs of coiled coil forming peptides, it is preferred that one of the pair be linked to the heavy chain and the other to the light chain of an antibody although the reverse orientation is also possible.
(220) Each antibody chain can be linked to a single coiled coil forming peptide or multiple such peptides in tandem (e.g., two, three, four or five copies of a peptide). If the latter, the peptides in tandem linkage are usually the same. Also if tandem linkage is employed, light and heavy chains are usually linked to the same number of peptides.
(221) Linkage of antibody chains to coiled coil forming peptides can reduce the binding affinity of an antibody by at least about 10-fold, about 50-fold, about 100-fold, about 200-fold, about 500-fold, about 1000-fold or about 1500-fold relative to the same antibody without such linkage or after cleavage of such linkage. In some such antibodies, binding affinity is reduced between about 50-1500-fold, between about 100-1500-fold, between about 200-1500-fold, between about 500-1500-fold, between about 50-1000-fold, between about 100-1000-fold, between about 200-1000-fold, between about 500-1000-fold, between about 50-500-fold, or between about 100-500-fold. Effector functions of the antibody, such as ADCC, phagocytosis, and CDC or cytotoxicity as a result of linkage to a drug in an antibody drug conjugate can be reduced by the same factors or ranges. Upon proteolytic cleavage that serves to unmask an antibody or otherwise remove the mask from the antibody, the restored antibody typically has an affinity or effect function that is within a factor of 2, 1.5 or preferably unchanged within experimental error compared with an otherwise identical control antibody, which has never been masked.
(222) Antibody-Drug Conjugates
(223) In certain embodiments, the anti-CD47 antibodies of the invention can be combined with antibody drug conjugates (ADCs). Particular ADCs may comprise cytotoxic agents (e.g., chemotherapeutic agents), prodrug converting enzymes, radioactive isotopes or compounds, or toxins (these moieties being collectively referred to as a therapeutic agent). For example, an ADC can be conjugated to a cytotoxic agent such as a chemotherapeutic agent, or a toxin (e.g., a cytostatic or cytocidal agent such as, for example, abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin). Examples of useful classes of cytotoxic agents include, for example, DNA minor groove binders, DNA alkylating agents, and tubulin inhibitors. Exemplary cytotoxic agents include, for example, auristatins, camptothecins, calicheamicins, duocarmycins, etoposides, maytansinoids (e.g., DM1, DM2, DM3, DM4), taxanes, benzodiazepines (e.g., pyrrolo[1,4]benzodiazepines, indolinobenzodiazepines, and oxazolidinobenzodiazepines including pyrrolo[1,4]benzodiazepine dimers, indolinobenzodiazepine dimers, and oxazolidinobenzodiazepine dimers) and vinca alkaloids.
(224) An ADC can be conjugated to a pro-drug converting enzyme. The pro-drug converting enzyme can be recombinantly fused to the antibody or chemically conjugated thereto using known methods. Exemplary pro-drug converting enzymes are carboxypeptidase G2, beta-glucuronidase, penicillin-V-amidase, penicillin-G-amidase, β-lactamase, β-glucosidase, nitroreductase and carboxypeptidase A.
(225) Techniques for conjugating therapeutic agents to proteins, and in particular to antibodies, are well-known. (See, e.g., Alley et al., Current Opinion in Chemical Biology 2010 14: 1-9; Senter, Cancer J., 2008, 14(3): 154-169.) The therapeutic agent can be conjugated in a manner that reduces its activity unless it is cleaved off the antibody (e.g., by hydrolysis, by proteolytic degradation, or by a cleaving agent). In some aspects, the therapeutic agent is attached to the antibody with a cleavable linker that is sensitive to cleavage in the intracellular environment of the CD47-expressing cancer cell but is not substantially sensitive to the extracellular environment, such that the conjugate is cleaved from the antibody when it is internalized by the CD47-expressing cancer cell (e.g., in the endosomal or, for example by virtue of pH sensitivity or protease sensitivity, in the lysosomal environment or in the caveolear environment). In some embodiments, the therapeutic agent can also be attached to the antibody with a non-cleavable linker.
(226) In certain exemplary embodiments, an ADC can include a linker region between a cytotoxic or cytostatic agent and the antibody. As noted supra, typically, the linker can be cleavable under intracellular conditions, such that cleavage of the linker releases the therapeutic agent from the antibody in the intracellular environment (e.g., within a lysosome or endosome or caveolea). The linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including a lysosomal or endosomal protease. Cleaving agents can include cathepsins B and D and plasmin (see, e.g., Dubowchik and Walker, Pharm. Therapeutics 83:67-123, 1999). Most typical are peptidyl linkers that are cleavable by enzymes that are present in CD47-expressing cells. For example, a peptidyl linker that is cleavable by the thiol-dependent protease cathepsin-B, which is highly expressed in cancerous tissue, can be used (e.g., a linker comprising a Phe-Leu or a Val-Cit peptide).
(227) A cleavable linker can be pH-sensitive, i.e., sensitive to hydrolysis at certain pH values. Typically, the pH-sensitive linker is hydrolyzable under acidic conditions. For example, an acid-labile linker that is hydrolyzable in the lysosome (e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like) can be used. (See, e.g., U.S. Pat. Nos. 5,122,368; 5,824,805; 5,622,929; Dubowchik and Walker, Pharm. Therapeutics 83:67-123, 1999; Neville et al, Biol. Chem. 264: 14653-14661, 1989.) Such linkers are relatively stable under neutral pH conditions, such as those in the blood, but are unstable at below pH 5.5 or 5.0, the approximate pH of the lysosome.
(228) Other linkers are cleavable under reducing conditions (e.g., a disulfide linker). Disulfide linkers include those that can be formed using SATA (N-succinimidyl-S-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SMPT. (See, e.g., Thorpe et al., Cancer Res. 47:5924-5931, 1987; Wawrzynczak et al., In Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer (C. W. Vogel ed., Oxford U. Press, 1987. See also U.S. Pat. No. 4,880,935.)
(229) The linker can also be a malonate linker (Johnson et al, Anticancer Res. 15: 1387-93, 1995), a maleimidobenzoyl linker (Lau et al., Bioorg-Med-Chem. 3: 1299-1304, 1995), or a 3′-N-amide analog (Lau et al., Bioorg-Med-Chem. 3: 1305-12, 1995).
(230) The linker also can be a non-cleavable linker, such as an maleimido-alkylene or maleimide-aryl linker that is directly attached to the therapeutic agent and released by proteolytic degradation of the antibody.
(231) Typically, the linker is not substantially sensitive to the extracellular environment, meaning that no more than about 20%, typically no more than about 15%, more typically no more than about 10%, and even more typically no more than about 5%, no more than about 3%, or no more than about 1% of the linkers in a sample of the ADC is cleaved when the ADC is present in an extracellular environment (e.g., in plasma). Whether a linker is not substantially sensitive to the extracellular environment can be determined, for example, by incubating independently with plasma both (a) the ADC (the “ADC sample”) and (b) an equal molar amount of unconjugated antibody or therapeutic agent (the “control sample”) for a predetermined time period (e.g., 2, 4, 8, 16, or 24 hours) and then comparing the amount of unconjugated antibody or therapeutic agent present in the ADC sample with that present in control sample, as measured, for example, by high performance liquid chromatography.
(232) The linker can also promote cellular internalization. The linker can promote cellular internalization when conjugated to the therapeutic agent (i.e., in the milieu of the linker-therapeutic agent moiety of the ADC or ADC derivate as described herein). Alternatively, the linker can promote cellular internalization when conjugated to both the therapeutic agent and the antibody (i.e., in the milieu of the ADC as described herein).
(233) The antibody can be conjugated to the linker via a heteroatom of the antibody. These heteroatoms can be present on the antibody in its natural state or can be introduced into the antibody. In some aspects, the antibody will be conjugated to the linker via a nitrogen atom of a lysine residue. In other aspects, the antibody will be conjugated to the linker via a sulfur atom of a cysteine residue. Methods of conjugating linker and drug-linkers to antibodies are known in the art.
(234) Exemplary antibody-drug conjugates include auristatin based antibody-drug conjugates meaning that the drug component is an auristatin drug. Auristatins bind tubulin, have been shown to interfere with microtubule dynamics and nuclear and cellular division, and have anticancer activity. Typically the auristatin based antibody-drug conjugate comprises a linker between the auristatin drug and the anti-CD47 antibody. The linker can be, for example, a cleavable linker (e.g., a peptidyl linker) or a non-cleavable linker (e.g., linker released by degradation of the antibody). Auristatins include MMAF, and MMAE. The synthesis and structure of exemplary auristatins are described in U.S. Pat. Nos. 7,659,241, 7,498,298, 2009-0111756, 2009-0018086, and U.S. Pat. No. 7,968,687 each of which is incorporated herein by reference in its entirety and for all purposes.
(235) Other exemplary antibody-drug conjugates include maytansinoid antibody-drug conjugates meaning that the drug component is a maytansinoid drug, and benzodiazepine antibody drug conjugates meaning that the drug component is a benzodiazepine (e.g., pyrrolo[1,4]benzodiazepine dimers, indolinobenzodiazepine dimers, and oxazolidinobenzodiazepine dimers).
(236) In certain embodiments, the anti-CD47 antibody of the invention may be combined with an ADC with binding specificity to a different target. Exemplary ADCs that may be combined with the anti-CD47 antibody include brentuximab vedotin (anti-CD30 ADC), enfortumab vedotin (anti-nectin-4 ADC), ladiratuzumab vedotin (anti-LIV-1 ADC), denintuzumab mafodotin (anti-CD19 ADC), glembatumumab vedotin (anti-GPNMB ADC), anti-TIM-1 ADC, polatuzumab vedotin (anti-CD79b ADC), anti-MUC16 ADC, depatuxizumab mafodotin, telisotuzumab vedotin, anti-PSMA ADC, anti-C4.4a ADC, anti-BCMA ADC, anti-AXL ADC, tisotuumab vedotin (anti-tissue factor ADC).
(237) Antibody Molecule Expression
(238) Nucleic acids of the present invention can be expressed in a host cell that contains endogenous DNA encoding an antibody or masked antibody of the present invention. Such methods are well known in the art, e.g., as described in U.S. Pat. Nos. 5,580,734, 5,641,670, 5,733,746, and 5,733,761. Also see, e.g., Sambrook, et al., supra, and Ausubel, et al., supra. Those of ordinary skill in the art are knowledgeable in the numerous expression systems available for expression of a nucleic acid encoding a protein of the present invention. Illustrative of cell cultures useful for the production of the antibodies, masked antibodies, specified portions or variants thereof, are mammalian cells. Mammalian cell systems often will be in the form of monolayers of cells although mammalian cell suspensions or bioreactors can also be used. A number of suitable host cell lines capable of expressing intact glycosylated proteins have been developed in the art, and include the COS-1 (e.g., ATCC CRL 1650), COS-7 (e.g., ATCC CRL-1651), HEK293, BHK21 (e.g., ATCC CRL-10), CHO (e.g., ATCC CRL 1610) and BSC-1 (e.g., ATCC CRL-26) cell lines, hep G2 cells, P3X63Ag8.653, SP2/0-Ag14, HeLa cells and the like, which are readily available from, for example, American Type Culture Collection, Manassas, Va. Yeast and bacterial host cells may also be used and are well known to those of skill in the art. Other cells useful for production of nucleic acids or proteins of the present invention are known and/or available, for instance, from the American Type Culture Collection Catalogue of Cell Lines and hybridomas or other known or commercial sources.
(239) Expression vectors can include one or more of the following expression control sequences, such as, but not limited to an origin of replication; a promoter (e.g., late or early SV40 promoters, the CMV promoter (U.S. Pat. Nos. 5,168,062; 5,385,839), an HSV tk promoter, a pgk (phosphoglycerate kinase) promoter, an EF-1 alpha promoter (U.S. Pat. No. 5,266,491), at least one human immunoglobulin promoter; an enhancer, and/or processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites (e.g., an SV40 large T Ag poly A addition site), and transcriptional terminator sequences). See, e.g., Ausubel et al., supra; Sambrook, et al., supra.
(240) Expression vectors optionally include at least one selectable marker. Such markers include, e.g., but are not limited to, methotrexate (MTX), dihydrofolate reductase (DHFR, U.S. Pat. Nos. 4,399,216; 4,634,665; 4,656,134; 4,956,288; 5,149,636; 5,179,017), ampicillin, neomycin (G418), mycophenolic acid, or glutamine synthetase (GS, U.S. Pat. Nos. 5,122,464; 5,770,359; and 5,827,739), resistance for eukaryotic cell culture, and tetracycline or ampicillin resistance genes for culturing in E. coli and other bacteria or prokaryotes. Appropriate culture media and conditions for the above-described host cells are known in the art. Suitable vectors will be readily apparent to the skilled artisan. Introduction of a vector construct into a host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection or other known methods. Such methods are described in the art, such as Sambrook, supra; Ausubel, supra.
(241) The nucleic acid insert should be operatively linked to an appropriate promoter. The expression constructs will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation. The coding portion of the mature transcripts expressed by the constructs will preferably include a translation initiating at the beginning and a termination codon (e.g., UAA, UGA or UAG) appropriately positioned at the end of the mRNA to be translated, with UAA and UAG preferred for mammalian or eukaryotic cell expression.
(242) The nucleic acid insert is optionally in frame with a coiled coil sequence and/or an MMP cleavage sequence, e.g., at the N-terminus of one or more heavy chain and/or light chain sequences. Alternatively, a coiled coil sequence and/or an MMP cleavage sequence can be post-translationally added to an antibody or antigen-binding fragment thereof, e.g., via a disulfide bond or the like.
(243) When eukaryotic host cells are employed, polyadenylation or transcription terminator sequences are typically incorporated into the vector. An example of a terminator sequence is the polyadenylation sequence from the bovine growth hormone gene. Sequences for accurate splicing of the transcript can also be included. An example of a splicing sequence is the VP1 intron from SV40 (Sprague, et al. (1983) J. Virol. 45:773-781). Additionally, gene sequences to control replication in the host cell can be incorporated into the vector, as known in the art.
(244) Antibody Isolation and Purification
(245) Anti-CD47 antibodies or masked antibodies described herein can be recovered and purified from recombinant cell cultures by well-known methods including, but not limited to, protein A purification, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography (HPLC) can also be employed for purification. See, e.g., Colligan, Current Protocols in Immunology, or Current Protocols in Protein Science, John Wiley & Sons, New York, N.Y., (1997-2001).
(246) Antibodies and masked antibodies described herein can include purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production procedure, the antibody or masked antibody of the present invention can be glycosylated or can be non-glycosylated, with glycosylated preferred. Such methods are described in many standard laboratory manuals, such as Sambrook, supra; Ausubel, supra, Colligan, Protein Science, supra.
(247) Nucleic Acid Molecules
(248) Nucleic acid molecules of the present invention can be in the form of RNA, such as mRNA, hnRNA, tRNA or any other form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or produced synthetically, or any combinations thereof. The DNA can be triple-stranded, double-stranded or single-stranded, or any combination thereof. Any portion of at least one strand of the DNA or RNA can be the coding strand, also known as the sense strand, or it can be the non-coding strand, also referred to as the anti-sense strand.
(249) Isolated nucleic acid molecules of the present invention can include nucleic acid molecules comprising an open reading frame (ORF), optionally with one or more introns, e.g., but not limited to, at least one specified portion of at least one CDR, as CDR1, CDR2 and/or CDR3 of at least one heavy chain or light chain; nucleic acid molecules comprising the coding sequence for an anti-CD47 antibody or masked antibody, or an anti-CD47 antibody or masked antibody variable region; and nucleic acid molecules which comprise a nucleotide sequence substantially different from those described above but which, due to the degeneracy of the genetic code, still encode at least one anti-CD47 antibody or masked antibody as described herein and/or as known in the art. Given that the genetic code is well-known in the art, it is routine for one skilled in the art to generate such degenerate nucleic acid variants that code for specific anti-CD47 antibodies or masked antibodies of the present invention.
(250) As indicated herein, nucleic acid molecules of the present invention which comprise a nucleic acid encoding an anti-CD47 antibody molecule can include, but are not limited to, those encoding the amino acid sequence of an antibody fragment, by itself the coding sequence for the entire antibody or a portion thereof the coding sequence for an antibody, fragment or portion, as well as additional sequences, such as one or both of a masking agent (e.g., a coiled coil masking agent) and/or an MMP cleavage sequence, or such as the coding sequence of at least one signal leader or fusion peptide, with or without the aforementioned additional coding sequences, such as at least one intron, together with additional, non-coding sequences, including but not limited to, non-coding 5′ and 3′ sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals (for example—ribosome binding and stability of mRNA); an additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities. In some embodiments, the sequence encoding an antibody can be fused to a marker sequence, such as a sequence encoding a peptide that facilitates purification of the fused antibody comprising an antibody fragment or portion.
(251) Construction of Nucleic Acids
(252) The isolated nucleic acids of the present invention can be made using (a) recombinant methods, (b) synthetic techniques, (c) purification techniques, or combinations thereof, as well-known in the art. The nucleic acids can conveniently comprise sequences in addition to a polynucleotide of the present invention. For example, a multi-cloning site comprising one or more endonuclease restriction sites can be inserted into the nucleic acid to aid in isolation of the polynucleotide. Also, translatable sequences can be inserted to aid in the isolation of the translated polynucleotide of the present invention. For example, a hexa-histidine marker sequence provides a convenient means to purify the proteins of the present invention. The nucleic acid of the present invention—excluding the coding sequence—is optionally a vector, adapter, or linker for cloning and/or expression of a polynucleotide of the present invention. Additional sequences can be added to such cloning and/or expression sequences to optimize their function in cloning and/or expression, to aid in isolation of the polynucleotide, or to improve the introduction of the polynucleotide into a cell. Use of cloning vectors, expression vectors, adapters, and linkers is well known in the art. (See, e.g., Ausubel, supra; or Sambrook, supra.)
(253) The isolated nucleic acid compositions of this invention, such as RNA, cDNA, genomic DNA, or any combination thereof, can be obtained from biological sources using any number of cloning methodologies known to those of skill in the art. In some embodiments, oligonucleotide probes that selectively hybridize, under stringent conditions, to the polynucleotides of the present invention are used to identify the desired sequence in a cDNA or genomic DNA library. The isolation of RNA, and construction of cDNA and genomic libraries, is well known to those of ordinary skill in the art. (See, e.g., Ausubel, supra; or Sambrook, supra.)
III. Therapeutic Applications
(254) The invention provides methods of treating disorders associated with cells that express CD47, e.g., cancers. The cells may or may not express elevated levels of CD47 relative to cells that are not associated with a disorder of interest. As a result, the invention provides a method of treating a subject, for example, a subject with a cancer, using the anti-CD47 antibodies or masked antibodies described herein. The method comprises administering an effective amount of an anti-CD47 antibody or masked antibody or a composition comprising an anti-CD47 antibody or masked antibody to a subject in need thereof.
(255) As used herein, the terms “subject” and “patient” refer to organisms to be treated by the methods of the present invention. Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably includes humans. As used herein, the terms, “treat,” “treatment” and “treating” includes any effect, e.g., lessening, reducing, modulating, ameliorating or eliminating, that results in the improvement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumor metastasis or tumor growth.
(256) Positive therapeutic effects in cancer can be measured in a number of ways (See, W. A. Weber, J. Null. Med. 50:1S-10S (2009); Eisenhauer et al., supra). In some preferred embodiments, response to an anti-CD47 antibody or masked antibody is assessed using RECIST 1.1 criteria. In some embodiments, the treatment achieved by a therapeutically effective amount is any of a partial response (PR), a complete response (CR), progression free survival (PFS), disease free survival (DFS), objective response (OR) or overall survival (OS). The dosage regimen of a therapy described herein that is effective to treat a primary or a secondary hepatic cancer patient may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. While an embodiment of the treatment method, medicaments and uses of the present invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the chi2-test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
(257) “RECIST 1.1 Response Criteria” as used herein means the definitions set forth in Eisenhauer et al., E. A. et al., Eur. J Cancer 45:228-247 (2009) for target lesions or non-target lesions, as appropriate, based on the context in which response is being measured.
(258) “Tumor” as it applies to a subject diagnosed with, or suspected of having, a primary or a secondary hepatic cancer, refers to a malignant or potentially malignant neoplasm or tissue mass of any size. A solid tumor is an abnormal growth or mass of tissue that usually does not contain cysts or liquid areas. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias (cancers of the blood) generally do not form solid tumors (National Cancer Institute, Dictionary of Cancer Terms). Nonlimiting exemplary sarcomas include soft tissue sarcoma and osteosarcoma.
(259) “Tumor burden” also referred to as “tumor load,” refers to the total amount of tumor material distributed throughout the body. Tumor burden refers to the total number of cancer cells or the total size of tumor(s) throughout the body, including lymph nodes and bone narrow. Tumor burden can be determined by a variety of methods known in the art, such as, e.g., by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., ultrasound, bone scan, computed tomography (CT) or magnetic resonance imaging (MRI) scans.
(260) The term “tumor size” refers to the total size of the tumor which can be measured as the length and width of a tumor. Tumor size may be determined by a variety of methods known in the art, such as, e.g. by measuring the dimensions of tumor(s) upon removal from the subject, e.g., using calipers, or while in the body using imaging techniques, e.g., bone scan, ultrasound, CT or MRI scans.
(261) As used herein, the term “effective amount” refers to the amount of a compound (e.g., an anti-CD47 antibody or masked antibody) sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route. Generally, a therapeutically effective amount of active component is in the range of 0.1 mg/kg to 100 mg/kg, e.g., 1 mg/kg to 100 mg/kg, 1 mg/kg to 10 mg/kg. The dosage administered can vary depending upon known factors, such as the pharmacodynamic characteristics of the particular agent, and its mode and route of administration; the age, health, and weight of the recipient; the type and extent of disease or indication to be treated, the nature and extent of symptoms, kind of concurrent treatment, frequency of treatment, and the effect desired. The initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue-level. Alternatively, the initial dosage can be smaller than the optimum, and the daily dosage may be progressively increased during the course of treatment. Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from 0.5 mg/kg to 20 mg/kg. Dosing frequency can vary, depending on factors such as route of administration, dosage amount, serum half-life of the antibody, and the disease being treated. Exemplary dosing frequencies are once per day, once per week and once every two weeks. Formulation of monoclonal antibody-based drugs is within ordinary skill in the art. In some embodiments, a monoclonal antibody is lyophilized, and then reconstituted in buffered saline, at the time of administration.
(262) In certain exemplary embodiments, the present invention provides a method for treating cancer in a cell, tissue, organ, animal or patient. In particular embodiments, the present invention provides a method for treating a solid cancer in a human. Exemplary cancers are those that possess CD47 expression in a cell having the cancer (i.e., “CD47-expressing cancers”). Examples of cancers include, but are not limited to, solid tumors, soft tissue tumors, hematopoietic tumors that give rise to solid tumors, and metastatic lesions. Examples of hematopoietic tumors that have the potential to give rise to solid tumors include, but are not limited to, diffuse large B-cell lymphomas (DLBCL), follicular lymphoma, myelodysplastic syndrome (MDS), a lymphoma, Hodgkin's disease, a malignant lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, multiple myeloma, Richter's Syndrome (Richter's Transformation) and the like. Examples of solid tumors include, but are not limited to, malignancies, e.g., sarcomas (including soft tissue sarcoma and osteosarcoma), adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting head and neck (including pharynx), thyroid, lung (small cell or non-small cell lung carcinoma (NSCLC)), breast, lymphoid, gastrointestinal tract (e.g., oral, esophageal, stomach, liver, pancreas, small intestine, colon and rectum, anal canal), genitals and genitourinary tract (e.g., renal, urothelial, bladder, ovarian, uterine, cervical, endometrial, prostate, testicular), central nervous system (e.g., neural or glial cells, e.g., neuroblastoma or glioma), skin (e.g., melanoma) and the like. In certain embodiments, the solid tumor is an NMDA receptor positive teratoma. In other embodiments, the cancer is selected from breast cancer, colon cancer, pancreatic cancer (e.g., a pancreatic neuroendocrine tumors (PNET) or a pancreatic ductal adenocarcinoma (PDAC)), stomach cancer, uterine cancer, and ovarian cancer.
(263) In certain embodiments, the cancer is selected from, but not limited to, leukemia's such as acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), hairy cell leukemia (HCL), T-cell prolymphocytic leukemia (T-PLL), large granular lymphocytic leukemia, adult T-cell leukemia, and acute monocytic leukemia (AMoL).
(264) In one embodiment, the cancer is a solid tumor that is associated with ascites. Ascites is a symptom of many types of cancer and can also be caused by a number of conditions, such as advanced liver disease. The types of cancer that are likely to cause ascites include, but are not limited to, cancer of the breast, lung, large bowel (colon), stomach, pancreas, ovary, uterus (endometrium), peritoneum and the like. In some embodiments, the solid tumor associated with ascites is selected from breast cancer, colon cancer, pancreatic cancer, stomach, uterine cancer, and ovarian cancer. In some embodiments, the cancer is associated with pleural effusions, e.g., lung cancer.
(265) Additional hematological cancers that give rise to solid tumors include, but are not limited to, non-Hodgkin lymphoma (e.g., diffuse large B cell lymphoma, mantle cell lymphoma, B lymphoblastic lymphoma, peripheral T cell lymphoma and Burkitt's lymphoma), B-lymphoblastic lymphoma; B-cell chronic lymphocytic leukemia/small lymphocytic lymphoma; lymphoplasmacytic lymphoma; splenic marginal zone B-cell lymphoma (±villous lymphocytes); plasma cell myeloma/plasmacytoma; extranodal marginal zone B-cell lymphoma of the MALT type; nodal marginal zone B-cell lymphoma (±monocytoid B cells); follicular lymphoma; diffuse large B-cell lymphomas; Burkitt's lymphoma; precursor T-lymphoblastic lymphoma; T adult T-cell lymphoma (HTLV 1-positive); extranodal NK/T-cell lymphoma, nasal type; enteropathy-type T-cell lymphoma; hepatosplenic γ-δ T-cell lymphoma; subcutaneous panniculitis-like T-cell lymphoma; mycosis fungoides/sezary syndrome; anaplastic large cell lymphoma, T/null cell, primary cutaneous type; anaplastic large cell lymphoma, T-/null-cell, primary systemic type; peripheral T-cell lymphoma, not otherwise characterized; angioimmunoblastic T-cell lymphoma, multiple myeloma, polycythemia vera or myelofibrosis, cutaneous T-cell lymphoma, small lymphocytic lymphoma (SLL), marginal zone lymphoma, CNS lymphoma, immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma and the like.
(266) In particular embodiments, the cancer is sarcoma, colorectal cancer, head and neck cancer, lung cancer, ovarian cancer, pancreatic cancer, gastric cancer, melanoma, and/or breast cancer.
(267) Anti-CD47 antibodies and masked antibodies as described herein can also be used to treat disorders associated with cancer, e.g., cancer-induced encephalopathy.
(268) The methods and compositions of the invention can be used in combination with other therapeutic agents and/or modalities. The term administered “in combination,” as used herein, is understood to mean that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, such that the effects of the treatments on the patient overlap at a point in time. In certain embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous” or “concurrent delivery.” In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive (i.e., a synergistic response). The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
(269) In one embodiment, the methods of the invention include administering to the subject an anti-CD47 antibody or masked antibody as described herein, e.g., a composition or preparation, in combination with one or more additional therapies, e.g., surgery, radiation therapy, or administration of another therapeutic preparation. In one embodiment, the additional therapy may include chemotherapy, e.g., a cytotoxic agent. In one embodiment the additional therapy may include a targeted therapy, e.g. a tyrosine kinase inhibitor, a proteasome inhibitor, or a protease inhibitor. In one embodiment, the additional therapy may include an anti-inflammatory, anti-angiogenic, anti-fibrotic, or anti-proliferative compound, e.g., a steroid, a biologic immunomodulatory, such as an inhibitor of an immune checkpoint molecule, a monoclonal antibody, an antibody fragment, an aptamer, an siRNA, an antisense molecule, a fusion protein, a cytokine, a cytokine receptor, a bronchodilator, a statin, an anti-inflammatory agent (e.g. methotrexate), or an NSAID. In another embodiment, the additional therapy could include combining therapeutics of different classes. The anti-CD47 antibody or masked antibody preparation and the additional therapy can be administered simultaneously or sequentially.
(270) An “immune checkpoint molecule,” as used herein, refers to a molecule in the immune system that either turns up a signal (a stimulatory molecule) or turns down a signal (an inhibitory molecule). Many cancers evade the immune system by inhibiting T cell signaling.
(271) Exemplary immune checkpoint molecules include, but are not limited to, programmed cell death protein 1 (PD-1), programmed death-ligand 1 (PD-L1), PD-L2, cytotoxic T lymphocyte-associated protein 4 (CTLA-4), T cell immunoglobulin and mucin domain containing 3 (TIM-3), lymphocyte activation gene 3 (LAG-3), carcinoembryonic antigen related cell adhesion molecule 1 (CEACAM-1), CEACAM-5, V-domain Ig suppressor of T cell activation (VISTA), B and T lymphocyte attenuator (BTLA), T cell immunoreceptor with Ig and ITIM domains (TIGIT), leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), CD160, TGFR, adenosine 2A receptor (A2AR), B7-H3 (also known as CD276), B7-H4 (also called VTCN1), indoleamine 2,3-dioxygenase (IDO), 2B4, killer cell immunoglobulin-like receptor (KIR), and the like.
(272) An “immune checkpoint inhibitor,” as used herein, refers to a molecule (e.g., a small molecule, a monoclonal antibody, an antibody fragment, etc.) that inhibit and/or block one or more inhibitory checkpoint molecules.
(273) Exemplary immune checkpoint inhibitors include, but are not limited to, the following monoclonal antibodies: PD-1 inhibitors such as pembrolizumab (Keytruda, Merck) and nivolumab (Opdivo, Bristol-Myers Squibb); PD-L1 inhibitors such as atezolizumab (Tecentriq, Genentech), avelumab (Bavencio, Pfizer), durvalumab (Imfinzi, AstraZeneca); and CTLA-1 inhibitors such as ipilimumab (Yervoy, Bristol-Myers Squibb).
(274) Exemplary cytotoxic agents include anti-microtubule agents, topoisomerase inhibitors, antimetabolites, protein synthesis and degradation inhibitors, mitotic inhibitors, alkylating agents, platinating agents, inhibitors of nucleic acid synthesis, histone deacetylase inhibitors (HDAC inhibitors, e.g., vorinostat (SAHA, MK0683), entinostat (MS-275), panobinostat (LBH589), trichostatin A (TSA), mocetinostat (MGCD0103), belinostat (PXD101), romidepsin (FK228, depsipeptide)), DNA methyltransferase inhibitors, nitrogen mustards, nitrosoureas, ethylenimines, alkyl sulfonates, triazenes, folate analogs, nucleoside analogs, ribonucleotide reductase inhibitors, vinca alkaloids, taxanes, epothilones, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis and radiation, or antibody molecule conjugates that bind surface proteins to deliver a toxic agent. In one embodiment, the cytotoxic agent that can be administered with a preparation described herein is a platinum-based agent (such as cisplatin), cyclophosphamide, dacarbazine, methotrexate, fluorouracil, gemcitabine, capecitabine, hydroxyurea, topotecan, irinotecan, azacytidine, vorinostat, ixabepilone, bortezomib, taxanes (e.g., paclitaxel or docetaxel), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, vinorelbine, colchicin, anthracyclines (e.g., doxorubicin or epirubicin) daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, adriamycin, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, ricin, or maytansinoids.
(275) The methods and compositions of the invention can be used in the treatment of subjects with CD47 positive cancer. In one embodiment, the CD47 positive cancer expresses one or more Matrix Metalloproteinases (MMPs). Exemplary MMPs include, but are not limited to, MMP1 through MMP28. Particularly exemplary MMPs include MMP2 and MMP9. In one embodiment, the CD47 positive cancer is a tumor in which infiltrating macrophages are present.
(276) The methods and compositions of the invention can be used in the treatment of subjects with a CD47 positive cancer that expresses one or more MMPs and contains infiltrating macrophages.
(277) Methods of determining the presence of CD47 positive cancers, MMP expression, and the presence of tumor infiltrating macrophages are known in the art.
(278) Assessment of CD47 positive cancers in a subject can be determined by conventional methods that include immunohistochemistry (IHC), Western blot, flow cytometry, or RNA sequencing methods. IHC, Western blot, and flow cytometry may be analyzed with any anti-CD47 antibody know in the art, as well as the anti-CD47 antibodies disclosed herein.
(279) Assessment of macrophage infiltration in tissues can be conducted by monitoring for surface markers of macrophages, including F4/80 for mouse macrophages or CD163, CD68, or CD1 lb by conventional methods that include immunohistochemistry (IHC), Western blot, flow cytometry, or RNA sequencing methods.
(280) Assessment of proteases in tissues can be monitored using a variety of techniques, including both those that monitor protease activity as well as those that can detect proteolytic activity. Conventional methods that can detect the presence of proteases in a tissue, which could include both inactive and active forms of the protease, include IHC, RNA sequencing, Western blot, or ELISA-based methods. Additional techniques can be used to detect protease activity in tissues, which includes zymography, in situ zymography by fluorescence microscopy, or the use of fluorescent proteolytic substrates. In addition, the use of fluorescent proteolytic substrates can be combined with immuno-capture of specific proteases. Additionally, antibodies directed against the active site of a protease can be used by a variety of techniques including IHC, fluorescence microscopy, Western blotting, ELISA, or flow cytometry (See, Sela-Passwell et al. Nature Medicine. 18:143-147. 2012; LeBeau et al. Cancer Research. 75:1225-1235. 2015; Sun et al. Biochemistry. 42:892-900. 2003; Shiryaev et al. 2:e80. 2013.)
(281) Throughout the description, where compositions and kits are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions and kits of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing and method steps.
IV. Pharmaceutical Compositions and Formulations
(282) For therapeutic use, an anti-CD47 antibody or masked antibody is preferably combined with a pharmaceutically acceptable carrier. As used herein, “pharmaceutically acceptable carrier” means buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. The carrier(s) should be “acceptable” in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient. Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art.
(283) Accordingly, anti-CD47 antibody or masked antibody compositions of the present invention can comprise at least one of any suitable excipients, such as, but not limited to, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like. Pharmaceutically acceptable excipients are preferred. Non-limiting examples of, and methods of preparing such sterile solutions are well known in the art, such as, but not limited to, those described in Gennaro, Ed., Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Co. (Easton, Pa.) 1990. Pharmaceutically acceptable carriers can be routinely selected that are suitable for the mode of administration, solubility and/or stability of the antibody molecule, fragment or variant composition as well known in the art or as described herein.
(284) Pharmaceutical excipients and additives useful in the present composition include but are not limited to proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume. Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like. Representative amino acid/antibody molecule components, which can also function in a buffering capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
(285) Carbohydrate excipients suitable for use in the invention include, for example, monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol), myoinositol and the like. Preferred carbohydrate excipients for use in the present invention are mannitol, trehalose, and raffinose.
(286) Antibody molecule compositions can also include a buffer or a pH adjusting agent; typically, the buffer is a salt prepared from an organic acid or base. Representative buffers include organic acid salts such as salts of citric acid, acetic acid, ascorbic acid, gluconic acid, carbonic acid, tartaric acid, succinic acid, or phthalic acid; Tris, tromethamine hydrochloride, or phosphate buffers.
(287) Additionally, antibody molecule compositions of the invention can include polymeric excipients/additives such as polyvinylpyrrolidones, ficolls (a polymeric sugar), dextrates (e.g., cyclodextrins, such as 2-hydroxypropyl-β-cyclodextrin), polyethylene glycols, flavoring agents, antimicrobial agents, sweeteners, antioxidants, antistatic agents, surfactants (e.g., polysorbates such as “TWEEN 20” and “TWEEN 80”), lipids (e.g., phospholipids, fatty acids), steroids (e.g., cholesterol), and chelating agents (e.g., EDTA).
(288) These and additional known pharmaceutical excipients and/or additives suitable for use in the antibody molecule compositions according to the invention are known in the art, e.g., as listed in “Remington: The Science & Practice of Pharmacy,” 19th ed., Williams & Williams, (1995), and in the “Physician's Desk Reference,” 52nd ed., Medical Economics, Montvale, N.J. (1998). Preferred carrier or excipient materials are carbohydrates (e.g., saccharides and alditols) and buffers (e.g., citrate) or polymeric agents.
(289) The present invention provides for stable compositions, comprising at least one anti-CD47 antibody molecule in a pharmaceutically acceptable formulation. Preserved formulations contain at least one known preservative or optionally selected from at least one phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (e.g., hexahydrate), alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent. Any suitable concentration or mixture can be used as known in the art, such as 0.001-5%, or any range or value therein, such as, but not limited to 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9, or any range or value therein. Non-limiting examples include, no preservative, 0.1-2% m-cresol (e.g., 0.2, 0.3, 0.4, 0.5, 0.9, or 1.0%), 0.1-3% benzyl alcohol (e.g., 0.5, 0.9, 1.1, 1.5, 1.9, 2.0, or 2.5%), 0.001-0.5% thimerosal (e.g., 0.005 or 0.01%), 0.001-2.0% phenol (e.g., 0.05, 0.25, 0.28, 0.5, 0.9, or 1.0%), 0.0005-1.0% alkylparaben(s) (e.g., 0.00075, 0.0009, 0.001, 0.002, 0.005, 0.0075, 0.009, 0.01, 0.02, 0.05, 0.075, 0.09, 0.1, 0.2, 0.3, 0.5, 0.75, 0.9, or 1.0%), and the like.
(290) Pharmaceutical compositions containing an anti-CD47 antibody or masked antibody as disclosed herein can be presented in a dosage unit form and can be prepared by any suitable method. A pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, and rectal administration. A preferred route of administration for monoclonal antibodies is IV infusion. Useful formulations can be prepared by methods known in the pharmaceutical art. For example, see Remington's Pharmaceutical Sciences (1990) supra. Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
(291) For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). The carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof.
(292) Pharmaceutical formulations are preferably sterile. Sterilization can be accomplished by any suitable method, e.g., filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution.
(293) The compositions of this invention may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, and liposomes. The preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions. The preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraocular, intraperitoneal, intramuscular). In a preferred embodiment, the preparation is administered by intravenous infusion or injection. In another preferred embodiment, the preparation is administered by intramuscular or subcutaneous injection.
(294) The phrases “parenteral administration” and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, subcutaneous, intraarterial, intrathecal, intracapsular, intraorbital, intravitreous, intracardiac, intradermal, intraperitoneal, transtracheal, inhaled, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
(295) The present invention provides a kit, comprising packaging material and at least one vial comprising a solution of at least one an anti-CD47 antibody or masked antibody with the prescribed buffers and/or preservatives, optionally in an aqueous diluent. The aqueous diluent optionally further comprises a pharmaceutically acceptable preservative. Preservatives include those selected from phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof. The concentration of preservative used in the formulation is a concentration sufficient to yield an anti-microbial effect. Such concentrations are dependent on the preservative selected and are readily determined by the skilled artisan.
(296) Other excipients, e.g. isotonicity agents, buffers, antioxidants, preservative enhancers, can be optionally and preferably added to the diluent. An isotonicity agent, such as glycerin, is commonly used at known concentrations. A physiologically tolerated buffer is preferably added to provide improved pH control. The formulations can cover a wide range of pHs, such as from about pH 4.0 to about pH 10.0, from about pH 5.0 to about pH 9.0, or about pH 6.0 to about pH 8.0.
(297) Other additives, such as a pharmaceutically acceptable solubilizers like TWEEN 20 (polyoxyethylene (20) sorbitan monolaurate), TWEEN 40 (polyoxyethylene (20) sorbitan monopalmitate), TWEEN 80 (polyoxyethylene (20) sorbitan monooleate), Pluronic F68 (polyoxyethylene polyoxypropylene block copolymers), and PEG (polyethylene glycol) or non-ionic surfactants such as polysorbate 20 or 80 or poloxamer 184 or 188, Pluronic® polyls, other block co-polymers, and chelators such as EDTA and EGTA can optionally be added to the formulations or compositions to reduce aggregation. These additives are particularly useful if a pump or plastic container is used to administer the formulation. The presence of pharmaceutically acceptable surfactant mitigates the propensity for the protein to aggregate.
(298) Various delivery systems can be used to administer anti-CD47 antibodies or masked antibodies to a subject. In certain exemplary embodiments, administration of an anti-CD47 antibody or masked antibody is by intravenous infusion. In some embodiments, administration is by a two hour intravenous infusion.
(299) Any of the formulations described above can be stored in a liquid or frozen form and can be optionally subjected to a preservation process. In some embodiments, the formulations described above are lyophilized, i.e., they are subjected to lyophilization. In some embodiments, the formulations described above are subjected to a preservation process, for example, lyophilization, and are subsequently reconstituted with a suitable liquid, for example, water. By lyophilized, it is meant that the composition has been freeze-dried under a vacuum. Lyophilization typically is accomplished by freezing a particular formulation such that the solutes are separated from the solvent(s). The solvent is then removed by sublimation (i.e., primary drying) and next by desorption (i.e., secondary drying).
(300) The formulations of the present invention can be used with the methods described herein or with other methods for treating disease. The anti-CD47 antibody or masked antibody formulations may be further diluted before administration to a subject. In some embodiments, the formulations will be diluted with saline and held in IV bags or syringes before administration to a subject. Accordingly, in some embodiments, the methods for treating a CD47-expressing cancer in a subject will comprise administering to a subject in need thereof a weekly dose of a pharmaceutical composition comprising an anti-CD47 antibody or masked antibody.
(301) It will be readily apparent to those skilled in the art that other suitable modifications and adaptations of the methods described herein may be made using suitable equivalents without departing from the scope of the embodiments disclosed herein. Having now described certain embodiments in detail, the same will be more clearly understood by reference to the following examples, which are included for purposes of illustration only and are not intended to be limiting. All patents, patent applications and references described herein are incorporated by reference in their entireties for all purposes.
EXAMPLES
Example 1: Antibody Generation
(302) Humanized variants of the murine B6H12 anti-CD47 antibody were generated. For DNA & Vector Generation antibody variable domains sequences were synthesized using non-template PCR. In short, the virtual gene sequence is converted into oligonucleotide sequences using ATUM's proprietary software suite. Oligonucleotides are synthesized, pooled and amplified using PCR. Full length amplicon from the PCR reaction is cloned into the vector using the SapI site, transformed into E. coli and unique colonies are isolated. Colonies are grown up overnight in liquid media and plasmid DNA isolated, purified (Machery-Nagel Midi Prep Kit) and sequence verified using Sanger sequencing. Light chain variable domains are cloned into the Kappa-Hs vector and heavy chain domains are cloned into the IgG1.01-Fc-Hs vectors. For antibody expression a 1:1 ratio of antibody heavy chain and light chain vectors are diluted into LifeTech Optimem media with PolyPlus FectoPro transfection reagent. The DNA/transfection reagent is then added to an Atum-specific HEK293 cells in LifeTech ExpiExpression media and cultured for 5 days. Culture is harvested by centrifugation and 0.2 um filtration. For antibody Purification GE mAb select sure is used for purification of the IgG. Prior to elution, the resin is washed with 10CV 1M NaCl in PBS, and 10CV of PBS. The IgG is eluted using 20 mM NaCitrate pH3.2 Buffer. The sample is buffer exchanged using the Pierce Zeba columns into PBS. The sample is then Filter sterilized before a sample is taken for the characterization. Characterization includes A280 concentration and reduced and non-reduced electrophoresis using the Agilent P200 Tape Station 2200 with p200 Tapescreens.
(303) Specific mutations of the parental B6H12 antibody are described in Tables 10-13 as set forth below.
(304) TABLE-US-00011 TABLE 10 Humanizing Mutations in hB6H12 Heavy Chain Variants vH IGHV Exon Murine Donor Human Acceptor Variant Acceptor Sequence Framework Residues CDR Residues hvH1 IGHV3-23/HJ4 H44, H49, H89, none H91, H94 hvH2 IGHV3-23/HJ4 H49, H91, H94 H31, H33, H60 hvH3 IGHV3-23/HJ4 H49, H82, H91, H94 H31, H33, H60 hvH4 IGHV3-48/HJ4 H49 H31, H60 hvH5 IGHV3-66/HJ4 H29, H49, H82 H60 hvH6 IGHV3-74/HJ4 H49 H31, H58, H60
(305) TABLE-US-00012 TABLE 11 Humanizing Mutations in hB6H12 Kappa Light Chain Variants vK IGKV Exon Murine Donor Human Acceptor Variant Acceptor Sequence Framework Residues CDR Residues hvK1 IGKV6-21/KJ2 L4, L21, L85 none hvK2 IGKV6-21/KJ2 L4, L21 none hvK3 IGKV6-21/KJ2 L4, L21, L69 none hvK4 IGKV1-27/KJ2 L21, L49, L69 L31, L34, L53, L54, L55
(306) TABLE-US-00013 TABLE 12 Specific Murine Framework Mutations in hB6H12 Heavy Chain Variants % Variant 29 44 49 82 89 91 94 Human hvH1 F R* A* M I* F* R* 87.8 hvH2 F G A* M V F* R* 92.9 hvH3 F G A* I* V F* R* 91.8 hvH4 F G A* M V Y R 92.9 hvH5 F* G A* I* V Y R 89.8 hvH6 F G A* M V Y R 92.9 *Murine residues.
(307) TABLE-US-00014 TABLE 13 Specific Murine Framework Mutations in hB6H12 Kappa Light Chain Variants Variant 4 21 49 69 85 % Human hvK1 M* L* K T V* 85.3 hvK2 M* L* K T T 86.3 hvK3 M* L* K S* T 85.3 hvK4 M L* K* S* T 89.5 *Murine residues.
Example 2: Humanized Anti-CD47 Antibodies
(308) Antibody Production
(309) Antibodies were expressed via transient transfection of Expi HEK or Expi CHO cells or stable transfection of CHO-DG44 and purified using MabSelect SuRe columns (GE Healthcare). Additional preparative size-exclusion chromatography purification using Superdex columns (GE Healthcare) was performed for masked antibodies that were less than 90% monomeric.
(310) Saturation Binding by Flow Cytometry and ELISA
(311) Humanized anti-CD47 B6H12 antibodies with varying heavy and light chain sequences were assessed for their binding affinities to human CD47 either by saturating ELISA or cellular FACS analysis and EC50s or Kds calculated. Only antibodies comprised of the heavy chain 1 sequence (hvH1) (bin A; antibodies 1-4) or heavy chain 5 sequence (hvH5) (bin B, antibodies 17-20) were able to bind to CD47. Antibodies from these bins bound with similar Kd (
(312) For cellular FACS analysis, L450cy cancer lymphoma cells were treated with increasing concentrations of humanized B6H12 antibodies, which were found to retain binding to CD47 and Kd values determined. Alternate humanization frameworks retained similar binding Kds as the murine parent and the alternately humanized antibody Ab47 (
(313) In addition to cellular binding assessment of affinity of the humanized B6H12 antibodies for CD47 was determined by Elisa. Plates coated with human CD47 were treated with increasing concentrations of humanized B6H12 antibodies, which were found to retain binding to CD47 and EC.sub.50 values determined. Alternate humanization frame works retained similar binding Kds as the murine parent and the alternately humanized antibody Ab47 (
(314) In addition to assessing binding EC50s in the ELISA assay, binding kinetics were also assessed. Unexpectedly, antibodies in Bin A, (hB6H12.3 and hB6H12.4) displayed significantly higher maximal binding (B Max) than the parent antibody, mB6H12, antibodies in Bin B (hB6h12.19 and hB6H12.20), or an alternate humanized antibody, Ab47 (
(315) Saturation Binding by Flow Cytometry
(316) 2×10.sup.5 of indicated cells (SW780 or human red blood cells) were combined with a serial dilution of indicated antibody in staining buffer (PBS, 5% FBS, 0.2% NaN.sub.3). Samples were incubated for 1 hour on ice and washed twice with ice-cold staining buffer. Cells were resuspended with anti-human IgG-AF647 (JacksonImmunoResearch, 1:200 dilution in staining buffer) for 1 hour on ice. Cells were washed twice with ice cold staining buffer and resuspended in staining buffer. Labeled cells were examined by flow cytometry on an Invitrogen Attune N×T flow cytometer gated to exclude nonviable cells and analyzed using FlowJo 10 software. The K.sub.d was calculated using GraphPad Prism 6 using non-linear regression.
(317) Saturation Binding by ELISA
(318) Soluble recombinant human CD47-Fc (R&D Systems) was diluted to an appropriate concentration in 50 mM carbonate buffer, pH 9.6. To each well of a 96-well Maxisorb ELISA plate was added 100 μL of soluble antigen. The plate was sealed and stored at 4° C. overnight. The plate was then washed 3-5 times with PBS-T was buffer (PBS, pH 7.4+0.05% Tween-20). The wells were blocked using 300 μL/well of PBS-T buffer containing BSA for 1 hour at room temperature, then washed 3-5 times with PBS-T. Dilutions of antibodies were prepared in blocking buffer and added to each well in a volume of 100 μL. The antibodies were incubated for 1 hour at room temperature, and then washed 3-5 times with PBS-T. HRP-conjugated secondary antibodies (either anti-human Fc or anti-human kappa light chain) were then added and incubated for 1 hour at room temperature. The plate was washed 3-5 times with PBS-T. The ELISA was developed by adding 100 μL of TMB solution and incubating for 3-15 min at room temperature. To stop the reaction, 100 μL of 1 N sulfuric acid was added to each well. The absorbance at 450 nm was determined using a Spectramax 190 plate reader (Molecular Biosciences) and the data plotted using GraphPad Prism 6.
(319) B6H12-Mediated Phagocytosis
(320) Functional characterization of humanized B6H12 antibodies was performed including human phagocytosis of human red blood cells and hemagglutination. Human red blood cells labeled with fluorescent red PKH dye were opsonized for 30 minutes with increasing concentrations of humanized B6H12 antibodies from bins A and B. RBCs were washed and fed at a 10:1 ratio to monocyte macrophages for 2 hours. Samples were washed 3 times with ACK hypotonic lysis buffer which allows for lysis and removal of non-ingested red blood cells. Samples were subjected to flow cytometry and phagocytosis assessed. Antibodies from Bin A and B exhibited a similar ability to mediate human red blood cell phagocytosis. Surprisingly, the antibody hB6H12.3 from bin A, mediated phagocytosis better than the murine parent antibody and on par with the alternate humanized antibody Ab47.
(321) Humanized B6H12 antibodies from antibody bins A and B mediate phagocytosis of CD47 positive human red blood cells similarly. hB6H12.3 stimulated superior phagocytic-promoting activity at 1 μg/ml compared to the murine mB6H12 and similar phagocytic-promoting activity compared to Ab47 (
(322) B6H12-Mediated Hemagglutination
(323) A hallmark characteristic of B6H12 is the ability to promote the hemagglutination of human red blood cells. Hemagglutination is an example of a homotypic interaction that allows two CD47 expressing cells to aggregate or clump when treated with a CD47 antibody. The agglutinated lattice maintains the RBC's in a suspended distribution that can be quantified visually by image analysis or by the level of aggregation as monitored by flow cytometry. Human red blood cells suspended in PBS and plated in round bottom 96 well plate were exposed to increasing concentrations of anti-CD47 antibodies. After 30 minutes at 37° C., hemagglutination was monitored optically by a change in RBC density and by flow cytometry as an increase in cellular aggregation. Antibodies within Bin A, in particular hB6H12.3 showed a reduction in hemagglutination compared to the parent antibody mB6H12 and the alternately humanized antibody Ab47 (
(324) To assess hemagglutination, standard image capture was performed and the formation of dispersed non-sedimenting RBCs assessed. In addition, plates were scanned using the GE In Cell analyzer and the diameter of the apparent spot within the well was assessed. In an effort to assess the hemagglutination in an assay that is amenable for clinical monitoring, flow cytometry was used and hemagglutination was assessed as the overall increase in apparent RBC SSC/FSC, which is a method for monitoring aggregation. This method was used to assess hemagglutination induced by the humanized anti-CD47 antibodies hB6H12.3 and Ab47 (
(325) B6H12-Mediated Activation of Fcγ Receptors
(326) In vivo, monocytes, macrophages, neutrophils and dendritic cells can mediate ADCP via FcγRIIa, FcγRI and FcγRIIIa. While all three receptors can participate in ADCP, FcγRIIa is believed to be the predominant Fcγ receptor involved in this process. Jurkat cells stably transfected with human FcγRI or the high affinity FcγRIIa-H connected to a NFAT-luciferase reporter construct were exposed to WIL2S cells coated with increasing concentrations either mouse B6H12, Ab47, or hB6H12.3. FcγR activation was monitored by luciferase production. Results are shown in
(327) Antibody mediated activation of Fcγ receptors involved in antibody mediated cellular phagocytosis was assessed using engineered Jurkat cells stably expressing the FcγRI or FcγRIIa-H (the high-affinity H131 variant) and an NFAT response element driving expression of firefly luciferase as effector cells. Antibody biological activity is quantified through the luciferase produced as a result of NFAT pathway activation; luciferase activity in the effector cell is quantified with luminescence readout (
(328) NK Cell-Mediated ADCC Activity
(329) NK cell mediated antibody dependent cellular cytotoxicity (ADCC) and activation of FcγRIIIa by mB6H12, Ab47, and hB6H12.3 was examined. Chromium loaded Wils-2 cells coated with increasing concentrations of antibody were exposed to primary human natural killer (NK) cells for 4 hours and specific lysis assessed by release of radioactive chromium into the tissue culture media. Alternatively, Wils-2 cells coated with increasing concentration of mB6H12, Ab47, or hB6H12.3 were exposed to Jurkat cells stably expressing the high affinity V/V variant of FcγRIIIa and receptor activation assessed as NFAT driven luciferase activity. hB6H12.3 exhibited superior ADCC and FcγRIIIa activation compared to both Ab47 or the murine B6H12 parent antibody. Results are shown in
(330) To perform the ADCC assay, purified human NK cells negatively selected from Astarte Biologics were thawed and re-suspended in RPMI/1% FBS at a concentration of 7.2×10.sup.5 CD16+ cells/Ml (such that 70 μL contained approximately 5×10.sup.4 effector cells). 5×10.sup.6 of target cells (WIL2S cells) were collected, centrifuged, and resuspended in 100 μL of FBS. 100 μL (approximately 100 μCi) of Cr-51 was added to the cells and mixed gently. The cells were placed in a 37° C. CO.sub.2-humidified incubator to label for 1 hour. The cells were tapped occasionally to keep suspended. The cells were washed three times with RPMI/1% FBS, being careful to discard radioactive supernatant in appropriate waste receptacle. The cells were then resuspended in 10 mL RPMI/1% FBS and counted. 7.2×10.sup.5 cells were removed and suspended in a total volume of 10 mL assay medium such that 70 μL was equivalent to approximately 5×10.sup.3 target cells.
(331) For antibody dilution and plate assembly, the antibodies were diluted in assay medium (prep @ 3×). The antibodies were added to the plate just prior to addition of Cr-labeled target cells. To control wells, 70 μL and 140 μL assay medium was added in place of the antibody. These wells represent total and spontaneous release controls, respectively. The target cells were mixed and 70 μL was added to each test and control well of the 96-well plate. The targets with antibodies were incubated in a 37° C. incubator for 30 minutes. 70 μL (5×10.sup.4) of effector cells were added to each test well. To the total release wells, 70 μL of 3% triton X-100 was added and pipetted up-and-down three times to mix. The plates were returned to 37° C., CO.sub.2-humidified incubator for 4 hours.
(332) Taken together, the data demonstrates that the novel humanized anti-CD47 antibodies of the invention possess superior and unexpected properties over the murine parental antibody. The humanized anti-CD47 antibodies display superior phagocytic/ADCP capability, as demonstrated by RBC phagocytosis (
(333) Suppressor Function of Anti-CD47 Antibodies
(334) In addition to blocking phagocytic activity, the interaction of CD47 with SIRPα also reduces inflammatory cytokine production through activation of SHP1 and inactivation of downstream signals such as Vay. Human monocytes were treated LPS to drive cytokine production in the presence of absence of the parent and various humanized anti-CD47 antibodies. Treatment with all CD47 target antibodies was able to significantly enhance LPS driven cytokines. One consequence of better cytokine production and innate cellular activation is an ability to drive secondary T cell responses. Tumor associated macrophages are known to exhibit a suppressive phenotype that is unable to support and can actively suppress secondary T cell activation. Human mononuclear cells were differentiated and polarized with IL10 and MSCF to drive them towards an immune suppressive TAM-like phenotype. These differentiated monocytes are able to suppress CD3/CD28 driven proliferation of autologous T cells. Addition of anti-CD47 treatment in this paradigm was able to activate the TAMs and move them towards a more M0/M1 phenotype (CD86/MHCII increase). See, e.g.,
(335) Suppressor assays utilizing human monocytes differentiated into tumor like macrophages with IL-10 were co-cultured with autologous T cells and the ability to support T cell receptor mediated activation was assessed. CD47 was added to the cultures and was found to cause upregulation of activation markers of the macrophages as measured by upregulation of CD86 and MHCII. In addition, support of TCR mediated T cell activation was assessed by upregulation of MHCII on the T cells and secretion of IFNγ (
(336) Comparison to Other Anti-CD47 Antibodies
(337) hB6H12.3 was compared against other known CD47 antibodies, 5F9 and CC-9002 (See, WO2011/143624). In the comparison, FcγRI and FcγRII activity was measured in the same NFAT-luciferase Jurkat cell assay as described supra. hB6H12.3 displayed a superior ability to activate FcγRI and FcγRII relative to the 5F9 and CC-90002 IgG4 antibodies (
(338) In addition, NK-mediated ADCC and IFNγ secretion was measured as described supra. Once again, hB6H12.3 displayed a superior ability to mediate ADCC and stimulate IFNγ secretion relative to the 5F9 and CC-90002 (
Example 3: Humanized Anti-CD47 Antibodies with a Mask
(339) Cleavage of Masked Antibodies Using Recombinant Human MMPs for Binding and Functional Studies
(340) Recombinant MMPs were all activated via incubation with 1.25 mM 4-aminophenyl mercuric acetate (APMA) at for 1-2 hours 37° C. Typically, 1-2 μg of activated rhMMP2 was added to 0.25-0.5 mg of masked antibody and incubated for 4-16 hours at 37° C. The extent of antibody cleavage was assessed using by reduced antibody reverse-phase LC-MS using a Waters Acquity/Xevo UPLC equipped with a PLRP-MS 3 μm column (Agilent). Data was analyzed using UNIFI software (Waters). Reactivation with MMPs results in site-specific cleavage of the mask at the intended cleavage site. Upon complete reactivation of masked antibodies, the cleaved products were purified using MabSelect SuRe Protein A resin prior to use in binding assays.
(341) Mass spectrometry data was generated for a MMP2 re-activated masked antibody. Deconvoluted light chain mass for Vel-IPV-hB6H12.3 before (
(342) Anti-CD47 antibodies bearing a “stub” sequence at the N-terminus that would remain post-proteolysis were also generated through transient expression in either Expi-HEK or Expi-CHO cells. For example, for a masked antibody employing the IPVS-LRSG MMP cleavage sequence, the LRSG sequence remains after MMP activation.
(343) Assessment of Protease Specificity of MMP-Based Cleavage Sequences
(344) MMPs were activated via incubation with 1.25 mM 4-aminophenyl mercuric acetate (APMA) at 37° C. for 1 hour and up to 24 hours. Legumain was activated via 2 hour incubation at 37° C. in 50 mM sodium acetate, 100 mM NaCl, pH 4.0.
(345) To assess the cleavage profile of the cleavage sequences, antibodies (10 μg) were incubated overnight at 37° C. with 400 pmol/min normalized proteases as indicated by manufacturer reported values. The extent of antibody cleavage was assessed using by reduced antibody reverse-phase LC-MS using a Waters Acquity/Xevo UPLC equipped with a PLRP-MS 3 μm column (Agilent). Data was analyzed using UNIFI software (Waters).
(346) The protease cleavage profile of two protease cleavage sites (IPV and M2) were tested against a panel of tumor-associated proteases such as human and murine/rat MMPs, the ADAMs family, uPA, matriptase, and legumain. Additionally, the cleavage of the sequences by extracellular proteases tPA and Factor Xa were also tested. The protease cleavage profiles at these three protease cleavage sites are shown in Table 14.
(347) The peptides (N-terminally fused to the hBU12 antibody backbone) were incubated at 37° C. overnight with 400 pmol/min normalized protease and assessed for cleavage. The M2 site was cleaved by the majority of the MMPs as well as uPA and matriptase. The IPV site was cleaved by almost all MMPs except MMP13 and was untouched by other protease classes.
(348) TABLE-US-00015 TABLE 14 Protease cleavage profiles at two different protease cleavage sites. Cleavage Sequence: M2 IPV Enzyme GPLG*VR** IPVS*LR**SG Human MMP2 Complete Complete Human MMP7 Complete Complete Human MMP9 Complete Complete Human MMP13 Complete Minimal Murine MMP2 Complete Partial Murine MMP7 Partial Complete Rat MMP9 Partial Complete uPA Partial None Matriptase Complete Minimal Legumain None Minimal tPA — None Factor Xa Minimal None ADAMs (hu, mu) None None The MMP-cleavage site is indicated by * while the uPA/matriptase/legumain cleavage sites are indicated by **. Cleavage at either site is sufficient to restore antibody binding
Saturation Binding of Masked Anti-CD47 Antibodies
(349) Saturation binding of anti-CD47 antibodies to SW780 human bladder cancer cells was performed. Vel-IPV-masked hB6H12 antibodies were tested along with MMP2 pre-activated comparators. The cleaved Vel-IPV-antibodies possessed a remnant-LRSG sequence at the antibody N-termini (
(350) TABLE-US-00016 TABLE 15 Determination of binding affinity (Kd) to SW780 cells obtained by saturation binding (FIG. 10). Antibody Kd (nM) Cleaved Vel-IPV-hB6H12.3 11.4 Cleaved Vel-IPV-hB6H12.4 9.2 Cleaved Vel-IPV-hB6H12.19 26.6 Cleaved Vel-IPV-hB6H12.20 30.2 Vel-IPV-hB6H12.3 >2000 Vel-IPV-hB6H12.4 >2000 Vel-IPV-hB6H12.19 >2000 Vel-IPV-hB6H12.20 >2000
(351) Vel-IPV-masked hB6H12 antibodies were tested along with MMP2 pre-activated comparators. Cleaved Vel-IPV- and stub-IPV antibodies possessed a remnant-LRSG sequence at the antibody N-termini. The cleaved antibody was generated through cleavage with MMP2 whereas stub-IPV antibody was generated recombinantly (
(352) TABLE-US-00017 TABLE 16 Determination of binding affinity (Kd) to SW780 cells obtained by saturation binding (FIG. 11). Antibody Kd (nM) hB6H12.3 19.2 Ab47 8.0 Vel-IPV-hB6H12.3 >2000 stubIPV-hB6H12.3 18.1 Cleaved Vel-IPV-hB6H12.3 14.2
(353) Saturation binding of anti-CD47 antibodies to human red blood cells was performed. Vel-IPV-masked hB6H12 antibodies were tested along with re-activated comparators (stub IPV-hB6H12.3 or MMP2-cleaved Vel-IPV-hB6H12.3). Cleaved Vel-IPV- and stub-IPV antibodies possessed a remnant—LRSG sequence at the antibody N-termini. The cleaved antibody was generated through cleavage with MMP2 whereas the stub-IPV antibody was generated recombinantly (
(354) TABLE-US-00018 TABLE 17 Determination of binding affinity (Kd) to human red blood cells obtained by saturation binding (FIG. 12). Antibody Kd (nM) hB6H12.3 58.2 Ab47 26.5 Vel-IPV-hB6H12.3 >2000 stubIPV-hB6H12.3 46.8 Cleaved Vel-IPV-hB6H12.3 41.7
(355) Saturation binding of anti-CD47 antibodies to rhCD47 by ELISA was performed. Vel-IPV-hB6H12.3 displayed significantly impaired binding. Binding could be restored upon cleavage by rhMMP2 (
(356) TABLE-US-00019 TABLE 18 Determination of binding affinity (Kd) to rhCD47 by ELISA (FIG. 13). Antibody Kd (nM) hB6H12.3 1.7 Vel-IPV-hB6H12.3 1.7 Cleaved Vel-IPV-hB6H12.3 >250
(357) Saturation binding of anti-CD47 antibodies to rhCD47 by ELISA was performed with hB6H12.3 G91A, which has a G91A point mutation in LCDR3. Both hB6H12.3 and hB6H12.3 G91A displayed a higher B.sub.max than Ab47 (
(358) TABLE-US-00020 TABLE 19 Determination of binding affinity (Kd) to rhCD47 by ELISA (FIG. 14). Antibody Kd (nM) Ab47 1.0 hB6H12.3 1.4 hB6H12.3 G91A 2.7
(359) Saturation binding of anti-CD47 antibodies to SW780 human bladder cancer cells was performed. Binding of Ab47 and hB6H12.3 was compared to variants bearing a G91A mutation in LCDR3 (
(360) TABLE-US-00021 TABLE 20 Determination of binding affinity (Kd) to SW780 human bladder cancer cells obtained by saturation binding (FIG. 15). Antibody Kd (nM) Ab47 6.8 Ab47 G91A 19.8 hB6H12.3 20.5 hB6H12.3 G91A 62.3
(361) Saturation binding of anti-CD47 antibodies to human red blood cells was performed. Binding of Ab47 and hB6H12.3 was compared to variants bearing a G91A mutation in LCDR3 (
(362) TABLE-US-00022 TABLE 21 Determination of binding affinity (Kd) to red blood cells obtained by saturation binding (FIG. 16). Antibody Kd (nM) Ab47 12.1 Ab47 G91A 100.3 hB6H12.3 68.9 hB6H12.3 G91A >150
Example 4: In Vivo Experiments
(363) Assessment of macrophage infiltration in tissues can be conducted by monitoring for surface markers of macrophages, including F4/80 for mouse macrophages or CD163, CD68, or CD11b by conventional methods that include immunohistochemistry (IHC), Western blot, flow cytometry, or RNA sequencing methods.
(364) Assessment of proteases in tissues can be monitored using a variety of techniques, including both those that monitor protease activity as well as those that can detect proteolytic activity. Conventional methods that can detect the presence of proteases in a tissue, which could include both inactive and active forms of the protease, include IHC, RNA sequencing, Western blot, or ELISA-based methods. Additional techniques can be used to detect protease activity in tissues, which includes zymography, in situ zymography by fluorescence microscopy, or the use of fluorescent proteolytic substrates. In addition, the use of fluorescent proteolytic substrates can be combined with immuno-capture of specific proteases. Additionally, antibodies directed against the active site of a protease can be used by a variety of techniques including IHC, fluorescence microscopy, Western blotting, ELISA, or flow cytometry (See, Sela-Passwell et al. Nature Medicine. 18:143-147. 2012; LeBeau et al. Cancer Research. 75:1225-1235. 2015; Sun et al. Biochemistry. 42:892-900. 2003; Shiryaev et al. 2:e80. 2013.)
(365) The activity of anti-CD47 antibodies in a L428 lymphoma xenograft tumor model in NSG mice was determined. This xenograft model has high macrophage infiltration, as evidenced by robust staining of mouse F4/80 by IHC. See, e.g.,
(366) The activity of anti-CD47 antibodies in a Detroit 562 xenograft head and neck tumor model in NSG mice was determined. This xenograft model has high macrophage infiltration, as evidenced by robust staining of mouse F4/80 by IHC. See,
(367) The activity of anti-CD47 antibodies in a HT1080 xenograft fibrosarcoma tumor model (
(368) In addition to assessing anti-tumor activity and its correlation with macrophage infiltration, levels of MMPs within these tumors as well as assessment of antibody unmasking has been assessed. Tumors from xenograft and syngeneic tumor models were harvested and subjected to protein and RNA seq assessment to monitor the levels of MMPs within these tumors as well as gain an understanding of the correlation between RNA and protein levels within the TME. Protein analysis using the Luminex multiplex platform revealed that the tumors used to investigate anti-tumor activity of Vel-IPV-hB6H12.3 all contained robust levels of both MMP2 and 9 (Table 22). Additionally, when we compared the tumor MMP levels with those present within cell culture systems, we found a marked increase in the MMP levels at the tumor site that well exceeded the levels seen just in in vitro tissue culture conditions (
(369) TABLE-US-00023 TABLE 22 MMP2 and MMP9 levels in select tumors (pg/ml). Tumors Xenograft MMPs HT1080 HEPG2 L428 Models MMP2 7506 787 204 MMP9 2020 771 47 Syngeneic MMPs HT1080 HEPG2 L428 Models MMP2 8453 27765 47899 MMP9 28137 20845 22661
(370) The activity of anti-CD47 antibodies in a tumor model with low intrinsic macrophage content can be amplified when combined with MMAE auristatin ADC which is known to drive macrophage infiltration. This was demonstrated in the HepG2 xenograft tumor model in NSG mice. Anti-CD47 antibodies were administered i.p. q4dx4 at 5 mg/kg while with the MMAE ADC was dosed once at 1 mg/kg. The combination of antibodies was more effective at reducing tumor volume than either antibody alone (
(371) Mouse reactive anti-CD47 antibody mIAP301 (Oldenborg et al., J. Exp. Med. 193:855-861, 2001) could be masked using the same VEL and IPV sequence used on the human hB6H12.3 antibody. Masking with these constructs blocked antibody binding to murine CD47 positive tumors (
(372) The anti-mouse CD47 antibody mIAP301 drives depletion of platelets in BALB/c mice when administered at a single IV dose of 10 mg/kg. In contrast, this depletion was not observed when mice were administered masked Vel-IPV-mIAP301 and Vel-M2-mIAP301 antibodies at a dose of 10 mg/kg IV (
(373) The masked Vel-IPV-mIAP301 antibody had greatly improved pharmacokinetics in plasma of BALB/c mice compared to unmasked mIAP301, demonstrating that the masked antibody is able to avoid target-mediated drug disposition encountered by typical anti-CD47 antibodies. Vel-IPV-mIAP301 and mIAP301 antibodies were labeled with .sup.3H-proprionate via lysine conjugation and were administered to BALB/c mice at an IV dose of 1 mg/kg. Antibody concentration was determined by scintillation counting of plasma drawn at different timepoints
(374) The biodistribution of masked Vel-IPV-mIAP301, and Vel-M2-mIAP301 and unmasked mIAP301 was tested in A20-bearing BALB/c mice using .sup.3H-labeled antibodies at doses of 1 and 10 mg/kg. Antibodies were administered once tumors had reached 250 mm.sup.3. At designated timepoints, mice were sacrificed and the concentration of antibody in plasma, blood, tumor, spleen, and liver was determined by scintillation counting. As shown in
(375) The anti-mouse CD47 antibody mIAP301 drove antitumor activity in the A20 lymphoma model but caused concomitant RBC depletion (
(376) The anti-mouse CD47 antibody mIAP301 drove antitumor activity in the MC38 colon cancer model, which is known to be responsive to immune oncology agents. The activity of the masked mIAP301 antibody in this model showed superior efficacy as denoted by the animal exhibiting a complete response (
(377) In addition to testing the combinatorial activity of the human anti-CD47 antibody with ADCs against Liv1a or CD30 we also assessed the combinatorial activity with other immune modulatory agents. To accomplish this, we moved into an immune complete mouse system and utilized the murine targeting anti-CD47 surrogate antibody mIAP. Using the A20 model we demonstrated that the masked anti-CD47 antibody synergizes with an anti-PD-1 surrogate antibody as well as an anti-SEA-CD40 antibody, SEA-1C10. These data provide evidence that engagement of both the innate and adaptive arms of the immune system along with a masked CD47 targeted agent is able to combine to drive robust anti-tumor responses.
(378) The parent and masked anti-murine CD47 antibody mIAP301 drove increased anti-tumor activity in combination with the anti-PD-1 surrogate antibody which resulted in 4/6 animals exhibiting CR responses (See, Dahan et al. Cancer Cell. 28:285-295. 2015, for reference to the PD-1 antibody, clone RMP1-14) (
(379) The data showing anti-CD47 in combination with anti-PD-1 or anti-CD40 indicate that anti-CD47 therapy can enhance the activity of agents that enhance T cell activity as in the context of checkpoint inhibitor antibodies (anti-PD-1 antibodies) as well as those agents that enhance innate cell activity (anti-CD40 antibodies or other CD40 inhibitors). This supports the notion that an anti-CD47 antibody can be paired with multiple immune modulating agents in the clinic that support both the adaptive and innate arms of an anti-tumor response.
Example 5: Coiled Coil Domain Masked Antibodies
(380) The stability of masked humanized B6H12 antibodies bearing different coiled coil domains was assessed using intravenous administration to BALB/c mice. Antibodies were dosed at 5 mg/kg. At the given time point (3 days), plasma was collected from dosed mice. Human antibody was purified from plasma using IgSelect resin. Captured antibody was reduced and separated by SDS-PAGE, then probed by Western blot using an HRP-conjugated anti-human Fc antibody. The percent cleaved antibody was assessed by densitometry of bands corresponding to masked and unmasked heavy chains, which differ in size by about 5 kDa (
(381) Table 23 shows the effects of masking with different coiled coil forming peptide pairs incorporated onto a humanized B6H12 antibody comprising a heavy chain (SEQ ID NO: 2) and a light chain (SEQ ID NO: 10) and tested on different cell lines. The antibody is also called Ab47 in the examples. The Kd (nM) is shown for each antibody, which was derived from saturation binding on each respective cell line. A high concentration of 2000 nM was used for each binding experiment. As shown in Table 23, a variety of coiled-coil domains were able to inhibit the binding of Ab47 to CD47 expressed on the cell surface, even when tested at concentrations of greater than 2 micromolar, whereas the unmasked Ab47 antibody displayed an IC.sub.50 of 3.3-21 nM.
(382) The stability and activation of masked humanized B6H12 antibodies bearing the Vel-IPV coiled coil and cleavage sequence were assessed in nude mice bearing a human HT1080 fibrosarcoma xenograft. Antibodies were dosed at 5 mg/kg IP. At given time points (1, 3, 4 days), mice were sacrificed and tissues and plasma collected. Tissues were homogenized and human antibody was purified from biological samples using IgSelect resin. Captured antibody was reduced and separated by SDS-PAGE, then probed by Western blot using an HRP-conjugated anti-human Fc antibody. The percent cleaved antibody was assessed by densitometry of bands corresponding to masked and unmasked heavy chains, which differ in size by about 5 kDa (
(383) TABLE-US-00024 TABLE 23 Affinity (nM), derived by saturation binding flow cytometry, of a humanized B6H12 antibody (Ab47) bearing different antibody masking domains. Coiled coil HT1080 SW780 HCT116 Raji Ab47 21 9.6 7.8 3.3 A2B1 >2000 >2000 1775 CA2B1 >2000 >2000 >2000 Vel >2000 >2000 >2000 CVel >2000 >2000 >2000 >2000 M11 >2000 >2000 >2000 CM11 >2000 >2000 >2000 M15 >2000 >2000 >2000 CM15 >2000 >2000 >2000 Fos-Jun >2000 >2000 >2000 CFos-Jun >2000 >2000 >2000 A4B4 1181 1684 1116 466 Hinge >2000 476 118 104
Activity and Pharmacokinetics of Humanized Anti-CD47 Antibodies and Demonstration of Improved Tolerability Through Masking in Cynomolgus Macaques
(384) To test the ability of masking to improve pharmacokinetics and tolerability of anti-CD47 IgG1 antibody variants, a series of IV single dose studies were conducted in cynomolgus macaques. The anti-CD47 IgG1 antibodies tested were cross-reactive with human and cyno CD47 that is highly conserved across these species in expression and sequence. Evaluation of protease activity by in situ gel zymography of a panel of cynomolgus macaque and human tissues indicated protease activity levels were also highly conserved across these species. Further, cynomolgus macaques have highly similar FcγR interactions with IgG1 antibodies and are considered toxicologically predictive of effector-function related effects of human IgG1 antibodies, making them a suitable model for evaluating the effects of IgG1 anti-CD47 antibodies (Warncke et al. J. Immunol. 188:4405-4411. 2012). Taken together, the cynomolgus macaque represents a relevant species for evaluating differing activities of anti-CD47 antibodies alone and further how this activity is altered with masking and modified effector function.
(385) Alternatively Humanized B6H12, Ab47
(386) To determine the tolerability and PK of B6H12 on an alternatively humanized IgG1 construct and further demonstrate proof of concept of the ability of the Vel-IPV mask and cleavage sequence to alter tolerability and pharmacokinetics, naïve cynomolgus macaques were dosed intravenously with 0.1, 1, 10, and 30 mg/kg of the alternatively humanized IgG1 B6H12 anti-CD47 antibody, Ab47. The humanized IgG1-based Ab47 demonstrated increased activity, demonstrated as red cell mass loss by hematology analysis, as compared to published data of the mB6H12 antibody on a humanized IgG4 platform (Liu, 2015). Whereas IgG4 B6H12, which lacks effector function to enable high ADCC, ADCP, and CDC activity in addition to blocking interactions with CD47, demonstrated tolerability of doses up to 30 mg/kg in cynomolgus macaques (Liu, 2015), Ab47 was not tolerated at doses greater than 1 mg/kg (
(387) Ab47 vs. Vel-IPV-Ab47
(388) To demonstrate the ability of the Vel-IPV mask to mitigate the activity of Ab47, cynomolgus macaques were administered doses of 0.1, 1, and 10 mg/kg. Notably, doses approximately 10 times higher were tolerated better than non-masked Ab47, as demonstrated by similar levels of red cell mass loss in blood samples collected for hematology analysis in animals treated with 1.0 mg/kg of Ab47 and 10 mg/kg of Vel-IPV-Ab47 (
(389) Ab47 vs. hB6H12.3
(390) Humanized B6H12.3, which features differential Kd, increased B.sub.max, and decreased hemagglutination, was administered in a single IV bolus at a dose of 1 mg/kg to cynomolgus macaques to test for differential activity in vivo. While both hB6H12.3 and Ab47 at 1 mg/kg result in similar levels of erythrocyte depletion (
(391) hB6H12.3 vs. Vel-IPV-hB6H12
(392) To demonstrate the ability of the Vel-IPV mask to mitigate the activity of hB6H12.3, cynomolgus macaques were administered doses of 10 and 20 mg/kg of antibody. 20 mg/kg, the highest dose tested, hematology testing demonstrated similar decreases in red cell mass loss as observed with 1 mg/kg of hB6H12.3 however with increased tolerability than non-masked hB6H12.3 at a 20-fold lower dose (
(393) Vel-IPV-hB6H12.3 vs. SEA-Vel-IPV-hB6H12.3
(394) To further enhance the activity of the IgG1 masked anti-CD47 antibody, Vel-IPV-hB6H12.3, the antibody was produced utilizing Seattle Genetics' proprietary technology to produce sugar engineered antibodies, SEA, non-fucosylated antibodies with enhanced effector function (U.S. Pat. No. 8,163,551). The relative antitumor activity in xenograft models of Vel-IPV-hB6H12.3 and SEA-Vel-IPV-hB6H12.3 as well as the fucosylated and non-fucosylated SEA hB6H12.3 was assessed in a high (Detroit562) and low (HT1080) macrophage model. Removal of the core fucosylation and resultant SEA-hB6H12.3 and SEA-Vel-IPV-hB6H12.3 provided no evidence of benefit for antitumor activity in either model (
(395) While SEA technology with other antibodies has resulted in increased activity, when the antibody is masked, both the SEA and non-SEA versions are well tolerated with similar red cell mass loss in hematology analysis to an identical maximum dose level tested, 20 mg/kg (
Example 6: Treatment of Tumors in Subjects with Select Biomarkers
(396) The disclosure further envisions treatment of subjects with tumors with the anti-CD47 antibodies of the invention based on select biomarkers within said subjects. Selection of subjects for treatment with the anti-CD47 antibodies of the invention will be based on 1) the higher levels and activity of MMPs within the tumor tissue relative to the surrounding non-tumor tissue; 2) the higher expression levels of CD47 on the tumor tissue relative to the surrounding non-tumor tissue; and 3) the higher level of macrophage infiltration in the tumor tissue relative to the surrounding non-tumor tissue.
(397) Methods of determining the levels and activity of select biomarkers include immunohistochemistry and enzymology analysis. For example, the levels of macrophage infiltration may be determined by immunohistochemistry using an anti-CD163 antibody as a marker.
(398) To demonstrate the ability to detect tumor infiltrating macrophages in a tumor vs. non-tumor tissue sample, breast cancer core samples and normal breast tissue samples were used. Immunohistochemistry was performed using an anti-CD163 antibody. Results demonstrate that tumor infiltrating macrophages can be readily detected in tumor samples over non-tumor samples (
Example 7: Phagocytosis and Hemagglutination of CD47-Positive Cells by Vel-IPV-hB6H12.3
(399) Phagocytosis of CD47-positive RBCs was monitored in order to evaluate the impact of masking on antibody functionality. Human red blood cells were labeled with fluorescent red PKH dye and opsonized for 30 minutes with 1 μg/mL of unmasked hB6H12.3, masked Vel-IPV-hB6H12.3, or MMP-activated Vel-IPV-hB6H12.3. Red blood cells were washed, then incubated with monocyte macrophages at a 10:1 ratio for two hours. The samples were then washed three times with ACK hypotonic lysis buffer. The extent of phagocytosis was evaluated by monitoring the uptake of fluorescently-labeled human RBCs by human macrophages via flow cytometry.
(400) As shown in
(401) Promotion of hemagglutination of human RBCs by masked Ab47 antibodies was tested as described in Example 2. Human RBCs were exposed to increasing concentrations of masked Vel-IPV-Ab47 or MMP-cleaved Vel-IPV-Ab47 for thirty minutes at 37° C. Hemagglutination was monitored by optical assessment of the diameter of the apparent spot within each well.
(402) As shown in
Example 8: hB6H12.3 Induces Apoptosis Directly
(403) Cell surface CD47 ligation can induce apoptosis. It has been reported that anti-CD47 mAb clone B6H12 can induce apoptosis only when immobilized to a surface; however, hB6H12.3 demonstrated apoptosis activity without being bound to a surface. Eight different cell lines (A431, HEK293, Hela, HepG2, HPAF11, I540Cy, MCF7, and THP1) were each plated at 50,000 cells per well for 24 hours. The cells were treated with concentrations of from 5 to 0.05 μg/mL of hB6H12.3, 5F9 or an IgG1 isotype control for 18 hours. Cells were then collected, washed twice, stained for apoptosis marker Annexin V, and apoptosis was quantified using flow cytometry.
(404) As shown in
Example 9: hB6H12.3 Stability in Whole Blood and Plasma
(405) Freshly harvested whole blood samples (4% sodium citrate) from 17 patients with various types of cancers (10 sarcoma, 3 NSCLC, 3 colon cancer, and 1 melanoma) were obtained from BioIVT. hB6H12.3 and masked Vel-IPV-hB6H12.3 antibodies were directly labeled with fluorescein isothiocyanate (FITC). Samples of the fresh whole blood were incubated with increasing concentrations (maximum concentration, 20 μg/ml) of FITC labeled hB6H12.3 or FITC labeled masked Vel-IPV-hB6H12.3 for 20 hours at 37° C. Binding of the antibodies to the blood cells was characterized by flow cytometry.
(406) A portion of each of the sarcoma whole blood samples was used to extract plasma, and 20 μg/mL of recombinant CD47 was added to the plasma samples. Samples of plasma containing recombinant CD47 were then incubated with 20 μg/mL of hB6H12.3 or masked Vel-IPV-hB6H12.3 for four days at 37° C. The extent of cleavage of the Vel-IPV mask was assessed using a CD47 binding ELISA, as described in Example 2. Vel-IPV-hB6H12.3 did not bind to recombinant CD47 at the concentration spiked into plasma (20 μg/mL); therefore, any antibody-CD47 binding detected in plasma incubated with Vel-IPV-hB6H12.3 is due to binding of cleaved Vel-IPV-hB6H12.3 to CD47.
(407) Of the 17 blood samples tested, masked Vel-IPV-hB6H12.3 showed greater than 10% binding to only one outlier sample (sarcoma, see
Example 10: Cytokine Production in Response to hB6H12.3
(408) Samples of the fresh whole blood from cancer patients (10 sarcoma, 3 NSCLC, 3 colon cancer, and 1 melanoma) were incubated with increasing concentrations (maximum concentration, 20 μg/ml) of FITC labeled hB6H12.3 or FITC labeled Vel-IPV-hB6H12.3, or with 0.1 μg/mL LPS for 20 hours at 37° C. Cytokine levels were assessed using a 38-plex cytokine and chemokine magnetic bead panel.
(409) In a majority of patient samples tested, modest cytokine production was induced by hB6H12.3, but minimal cytokine production was induced by Vel-IPV-hB6H12.3. Cytokines IP-10, IL1-Ra, MIP-1α, and MIP-1α were most commonly induced by hB6H12.3. The levels of IL1-Ra (
Example 11: hB6H12.3 Induces Apoptosis In Vivo
(410) Nude mice bearing human HT1080 fibrosarcoma xenografts were administered a 5 mg/kg IP dose of hB6H12.3, Vel-IPV-hB6H12.3, or a hIgG1 isotype control when tumors reached 200 mm.sup.3. At given time points (24 and 96 hrs), mice were sacrificed and tumors collected. Tumors were homogenized and human HT1080 xenograft fibrosarcoma tumor cells were re-suspended at 1 million cells/ml in 1× Annexin V staining buffer (10× staining buffer containing 50 mM HEPES, 700 mM NaCl, 12.5 mM CaCl2 pH7.4 diluted 1:10 in water). Cells were transferred to a round bottom 96 well plate (100 μl/well) and 5 μl of FITC Annexin V staining reagent and 1 μl of 100 μg/ml ultra violet Live/Dead staining buffer were added to each well. Cells were stained for 30 minutes at room temperature. Samples were spun at 1550 g for 5 minutes, supernatant were removed, and cells were washed 3× with 1× ice cold Annexin V staining buffer. Cells were re-suspended in 100 μl of 1× Annexin V staining buffer. Apoptosis was assessed by flow cytometry on an LSRII cytometer as percent of cells positive for Annexin V binding to surface phosphatidyl serine. Cells that stained positive with the Live/Dead stain were excluded from the analysis.
(411) As shown in
Certain Non-Limiting Embodiments
Embodiment 1
(412) A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, the antibody or antigen-binding fragment comprising a light chain variable region and a heavy chain variable region, the heavy chain variable comprising:
(413) CDRs set forth as SEQ ID NOs: 16 (GYGMS), 17 (TITSGGTYTYYPDSVKG), and 18 (SLAGNAMDY); and
(414) a human IGHV3-23/HJ4 framework set forth in SEQ ID NO: 88, wherein framework positions H44, H49, H82, H89, H91, and H94 are donor residues, according to Kabat numbering.
Embodiment 2
(415) A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, the antibody or antigen-binding fragment comprising a light chain variable region and a heavy chain variable region, the heavy chain variable comprising:
(416) CDRs set forth as SEQ ID NOs: 16 (GYGMS), 17 (TITSGGTYTYYPDSVKG), and 18 (SLAGNAMDY); and
(417) a human IGHV3-48/HJ4 framework set forth in SEQ ID NO: 89, wherein framework position H49 is a donor residue, according to Kabat numbering.
Embodiment 3
(418) A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, the antibody or antigen-binding fragment comprising a light chain variable region and a heavy chain variable region, the heavy chain variable comprising:
(419) CDRs set forth as SEQ ID NOs: 16 (GYGMS), 17 (TITSGGTYTYYPDSVKG), and 18 (SLAGNAMDY); and
(420) a human IGHV3-66/HJ4 framework set forth in SEQ ID NO: 90, wherein framework position H29, H49, and H82 is a donor residue, according to Kabat numbering.
Embodiment 4
(421) A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, the antibody or antigen-binding fragment comprising a light chain variable region and a heavy chain variable region, the heavy chain variable comprising:
(422) CDRs set forth as SEQ ID NOs: 16 (GYGMS), 17 (TITSGGTYTYYPDSVKG), and 18 (SLAGNAMDY); and
(423) a human IGHV3-74/HJ4 framework set forth in SEQ ID NO: 91, wherein framework position H49 is a donor residue, according to Kabat numbering.
Embodiment 5
(424) The humanized antibody or antigen-binding fragment thereof of any one of embodiments 1-4, wherein the light chain variable region comprises:
(425) CDRs set forth as SEQ ID NOs: 31 (RASQTISDYLH), 32 (FASQSIS), and 33 (QNGHGFPRT); and
(426) a human IGKV6-21/KJ2 framework set forth in SEQ ID NO: 92, wherein framework positions L4, L21, L69, and L85 are donor residues, according to Kabat numbering.
Embodiment 6
(427) The humanized antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the light chain variable region comprises:
(428) CDRs set forth as SEQ ID NOs: 31 (RASQTISDYLH), 32 (FASQSIS), and 33 (QNGHGFPRT); and
(429) a human IGKV1-27/KJ2 framework set forth in SEQ ID NO: 93, wherein framework positions L21, L49, and L69 are donor residues, according to Kabat numbering.
Embodiment 7
(430) The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein H29 is occupied by F, H44 is occupied by R or G, H49 is occupied by A, H82 is occupied by M or I, H89 is occupied by I or V, H91 is occupied by F or Y, and H94 is occupied by R, according to Kabat numbering.
Embodiment 8
(431) The antibody or antigen-binding fragment of embodiment 5, wherein L4 is occupied by M, L21 is occupied by L, L49 is occupied by K, L69 is occupied by T or S, L85 is occupied by V or T, according to Kabat numbering.
Embodiment 9
(432) The antibody or antigen-binding fragment of any one of embodiments 1-4, comprising a heavy chain variable region (HCVR) having at least 90% sequence identity to any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7 and 8, and a light chain variable region (LCVR) having at least 90% sequence identity to any one of SEQ ID NOs: 10, 11, 12, 13, 14 and 15.
Embodiment 10
(433) The antibody or antigen-binding fragment of embodiment 5, further comprising a G91A mutation in LCDR3, according to Kabat numbering.
Embodiment 11
(434) The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the antibody or antigen-binding fragment is of an IgG1 isotype.
Embodiment 12
(435) The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the antibody or antigen-binding fragment has enhanced antibody dependent cellular cytotoxicity (ADCC) compared to its parental antibody.
Embodiment 13
(436) The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the antibody or antigen-binding fragment has enhanced antibody dependent cellular phagocytosis (ADCP) compared to its parental antibody.
Embodiment 14
(437) The antibody or antigen-binding fragment of any one of embodiments 1-4, having reduced core fucosylation compared to its parental antibody.
Embodiment 15
(438) The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the antibody or antigen-binding fragment blocks an interaction between CD47 and SIRPα.
Embodiment 16
(439) The antibody or antigen-binding fragment of any one of embodiments 1-4, wherein the antibody or antigen-binding fragment has reduced hemagglutination of red blood cells compared to its parental antibody.
Embodiment 17
(440) A nucleic acid sequence encoding the antibody or antigen-binding fragment of any one of embodiments 1-4.
Embodiment 18
(441) The antigen-binding fragment of embodiment 1, comprising a Fab, a Fab′, a F(ab′).sub.2, a Fv fragment, a diabody, a single-chain antibody, an scFv fragment or an scFv-Fc.
Embodiment 19
(442) A method for treating a CD47-expressing cancer in a subject, comprising administering to the subject a therapeutically effective amount of an anti-CD47 antibody or antigen-binding fragment thereof comprising a masking agent, wherein the masking agent comprises one or more coiled coil peptides that reduce binding affinity of the antibody or antigen-binding fragment to human CD47 compared to the antibody or antigen-binding fragment thereof without the masking agent.
Embodiment 20
(443) The method of embodiment 19, wherein a protease-cleavable linker attaches the masking agent the antibody or antigen-binding fragment thereof.
Embodiment 21
(444) The method of embodiment 20, wherein the protease-cleavable linker has an amino acid sequence comprising IPVSLRSG (SEQ ID NO: 73) or GPLGVR (SEQ ID NO: 57).
Embodiment 22
(445) The method of embodiment 20, wherein the protease-cleavable linker comprises a matrix metalloprotease (MMP) cleavage site.
Embodiment 23
(446) The method of embodiment 22, wherein the MMP cleavage site is selected from the group consisting of an MMP2 cleavage site, an MMP7 cleavage site, an MMP9 cleavage site and an MMP13 cleavage site.
Embodiment 24
(447) The method of embodiment 22, wherein the masking agent is released from the anti-CD47 antibody or antigen-binding fragment thereof subsequent to cleavage of an MMP cleavage site in a tumor microenvironment by an MMP.
Embodiment 25
(448) The method of embodiment 24, wherein the cleaved anti-CD47 antibody has a stub amino acid remnant of the MMP cleavage site.
Embodiment 26
(449) The method of embodiment 25, wherein the stub amino acid remnant comprises the sequence of LRSG, SG, or VR at the N terminus of the antibody.
Embodiment 27
(450) The method of embodiment 19, wherein one or more the coiled coil peptides comprise one or more sequences selected from the group consisting of SEQ ID NOs: 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55 and 56.
Embodiment 28
(451) The method of embodiment 19, wherein antibody or antigen-binding fragment binding to CD47 is reduced at least about 100-fold compared to the antibody or antigen-binding fragment thereof without the masking agent.
Embodiment 29
(452) The method of embodiment 19, wherein antibody or antigen-binding fragment binding to CD47 is reduced between about 200-fold and about 1500-fold compared to the antibody or antigen-binding fragment thereof without the masking agent.
Embodiment 30
(453) The method of embodiment 19, wherein the CD47-expressing cancer is a hematological cancer that causes a solid cancer.
Embodiment 31
(454) The method of embodiment 30, wherein the hematological cancer is selected from the group consisting of non-Hodgkin lymphoma, B-lymphoblastic lymphoma; B-cell chronic lymphocytic leukemia/small lymphocytic lymphoma, Richter's syndrome, follicular lymphoma, multiple myeloma, myelofibrosis, polycythemia vera, cutaneous T-cell lymphoma, monoclonal gammopathy of unknown significance (MGUS), myelodysplastic syndrome (MDS), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, acute myeloid leukemia (AML), and anaplastic large cell lymphoma.
Embodiment 32
(455) The method of embodiment 19, wherein the CD47-expressing cancer is a solid tumor.
Embodiment 33
(456) The method of embodiment 32, wherein the solid tumor is selected from the group consisting of lung cancer, pancreatic cancer, breast cancer, liver cancer, ovarian cancer, testicular cancer, kidney cancer, bladder cancer, spinal cancer, brain cancer, cervical cancer, endometrial cancer, colon/rectum cancer, anal cancer, endometrial cancer, esophageal cancer, gallbladder cancer, gastrointestinal cancer, skin cancer, prostate cancer, pituitary cancer, stomach cancer, uterine cancer, vaginal cancer and thyroid cancer.
Embodiment 34
(457) The method of embodiment 32, wherein the solid tumor is selected from the group consisting of lung cancer, soft tissue sarcoma, colorectal cancer, head and neck cancer, and breast cancer.
Embodiment 35
(458) The method of embodiment 19, wherein the subject is a human suffering from a solid cancer.
Embodiment 36
(459) The method of embodiment 19, wherein the anti-CD47 antibody is administered in combination with an inhibitor of an immune checkpoint molecule chosen from one or more of programmed cell death protein 1 (PD-1), programmed death-ligand 1 (PD-L1), PD-L2, cytotoxic T lymphocyte-associated protein 4 (CTLA-4), T cell immunoglobulin and mucin domain containing 3 (TIM-3), lymphocyte activation gene 3 (LAG-3), carcinoembryonic antigen related cell adhesion molecule 1 (CEACAM-1), CEACAM-5, V-domain Ig suppressor of T cell activation (VISTA), B and T lymphocyte attenuator (BTLA), T cell immunoreceptor with Ig and ITIM domains (TIGIT), leukocyte-associated immunoglobulin-like receptor 1 (LAIR1), CD160, 2B4 or TGFR.
Embodiment 37
(460) An antibody or antigen-binding fragment thereof that specifically binds to the human CD47 protein comprising a masking agent, wherein the masking agent comprises one or more coiled coil peptides comprising the sequence of SEQ ID NO: 95 (QGASTTVAQLEEKVKTLRAENYELKSEVQRLEEQVAQLGS) and/or SEQ ID NO: 94 (QGASTSVDELQAEVDQLEDENYALKTKVAQLRKKVEKLGS), and wherein the one or more coiled coil peptides reduce binding affinity of the antibody or antigen-binding fragment to human CD47 protein compared to the antibody or antigen-binding fragment thereof without the masking agent.
Embodiment 38
(461) The antibody or antigen-binding fragment of embodiment 37, comprising a heavy chain variable region (HCVR) having at least 90% sequence identity to any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7 and 8, and a light chain variable region (LCVR) having at least 90% sequence identity to any one of SEQ ID NOs: 10, 11, 12, 13, 14 and 15.
Embodiment 39
(462) The antibody or antigen-binding fragment of embodiment 37, wherein the masking agent is attached to the antibody or antigen-binding fragment thereof via a protease-cleavable linker.
Embodiment 40
(463) The antibody or antigen-binding fragment of embodiment 39, wherein the protease-cleavable linker has an amino acid sequence comprising IPVSLRSG (SEQ ID NO: 73) or GPLGVR (SEQ ID NO: 57).
Embodiment 41
(464) The antibody or antigen-binding fragment of embodiment 39, wherein the protease-cleavable linker comprises a matrix metalloprotease (MMP) cleavage site.
Embodiment 42
(465) The antibody or antigen-binding fragment of embodiment 41, wherein the MMP cleavage site is selected from the group consisting of an MMP2 cleavage site, an MMP7 cleavage site, an MMP9 cleavage site and an MMP13 cleavage site.
Embodiment 43
(466) The antibody of embodiment 37, wherein the masking agent is removed from the anti-CD47 antibody after cleavage of an MMP cleavage site by an MMP.
Embodiment 44
(467) The antibody of embodiment 43, wherein the anti-CD47 antibody has a stub amino acid remnant of the MMP cleavage site after cleavage of an MMP cleavage site by an MMP.
Embodiment 45
(468) The antibody of embodiment 44, wherein the stub amino acid remnant comprises the sequence of LRSG, SG, or VR at the N terminus of the antibody.
Embodiment 46
(469) The antibody or antigen-binding fragment of embodiment 37, wherein binding is reduced at least about 100-fold compared to the antibody or antigen-binding fragment thereof without the masking agent.
Embodiment 47
(470) The antibody or antigen-binding fragment of embodiment 37, wherein the binding is reduced between about 200-fold and about 1500-fold compared to the antibody or antigen-binding fragment thereof without the masking agent.
Embodiment 48
(471) 48 The antibody or antigen-binding fragment of embodiment 37, comprising a heavy chain sequence of SEQ ID NO: 42 and a light chain sequence of SEQ ID NO: 43.
Embodiment 49
(472) The antibody or antigen-binding fragment of any of embodiments 37-48, comprising a variant Fc region which confers enhanced effector function selected from ADCC and/or CDC activity.
Embodiment 50
(473) The antibody or antigen-binding fragment of embodiment 49, which is afucosylated.
Embodiment 51
(474) A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, wherein the antibody is an IgG1 isotype.
Embodiment 52
(475) The antibody of embodiment 51, comprising enhanced ADCC, enhanced ADCP, and/or enhanced CDC activity.
Embodiment 53
(476) A method for treating a CD47-expressing cancer in a subject, comprising the steps of:
(477) a) identifying the subject as having elevated levels of MMP in the cancer relative to surrounding non-cancer tissue; and
(478) b) administering to the subject a therapeutically effective amount of an anti-CD47 antibody or antigen-binding fragment thereof comprising a masking agent, wherein the masking agent comprises coiled coil peptides that reduce binding affinity of the antibody or antigen-binding fragment to human CD47 compared to the antibody or antigen-binding fragment thereof without the masking agent, if the subject has elevated levels of MMP in the cancer relative to surrounding non-cancer tissue.
Embodiment 54
(479) The method of embodiment 53, wherein the MMP is selected from the group consisting of: MMP2, MMP7, MMP9, and MMP13.
Embodiment 55
(480) The method of embodiment 53, wherein step a) comprises: i) isolating cancer tissue and non-cancer tissue from the subject; ii) detecting MMPs in the isolated cancer tissue and the non-cancer tissue; and iii) comparing the amount of staining in the cancer tissue relative to the non-cancer tissue.
Embodiment 56
(481) A method for treating a CD47-expressing cancer in a subject, comprising the steps of: a) identifying the subject as having elevated levels of CD47 in the cancer relative to surrounding non-cancer tissue; and b) administering to the subject a therapeutically effective amount of an anti-CD47 antibody or antigen-binding fragment thereof comprising a masking agent, wherein the masking agent comprises coiled coil peptides that reduce binding affinity of the antibody or antigen-binding fragment to human CD47 compared to the antibody or antigen-binding fragment thereof without the masking agent, if the subject has elevated levels of CD47 in the cancer relative to surrounding non-cancer tissue.
Embodiment 57
(482) The method of embodiment 56, wherein step a) comprises: i) isolating cancer tissue and surrounding non-cancer tissue from the subject; ii) detecting CD47 in the isolated cancer tissue and surrounding non-cancer tissue; and iii) comparing the amount of CD47 staining in the cancer tissue relative to CD47 staining the non-cancer tissue.
Embodiment 58
(483) A method for treating a CD47-expressing cancer in a subject, comprising the steps of:
(484) a) identifying the subject as having elevated levels of macrophage infiltration in cancer tissue relative to non-cancer tissue; and
(485) b) administering to the subject a therapeutically effective amount of an anti-CD47 antibody or antigen-binding fragment thereof comprising a masking agent, wherein the masking agent comprises one or more coiled coil peptides that reduce binding affinity of the antibody or antigen-binding fragment to human CD47 compared to the antibody or antigen-binding fragment thereof without the masking agent, if the subject has elevated levels of macrophage infiltration in the cancer relative to the non-cancer tissue.
Embodiment 59
(486) The method of embodiment 58, wherein step a) comprises: i) isolating cancer tissue and surrounding non-cancer tissue from the subject; ii) detecting macrophages in the isolated cancer tissue and in non-cancer tissue; and iii) comparing the amount of staining in the cancer tissue relative to the non-cancer tissue.
Embodiment 60
(487) The method of embodiment 58, wherein the macrophage staining is performed with an anti-CD163 antibody.
Embodiment 61
(488) A humanized antibody or antigen-binding fragment thereof that specifically binds human CD47, comprising a heavy chain variable region (HCVR) having at least 90% sequence identity to any one of SEQ ID NOs: 2, 3, 4, 5, 6, 7 and 8, and a light chain variable region (LCVR) having at least 90% sequence identity to any one of SEQ ID NOs: 10, 11, 12, 13, 14 and 15, wherein the antibody further comprises the sequence LRSG, SG, or VR at the N terminus of the HCVR and/or the LCVR.
Embodiment 62
(489) A method of treating cancer by administering a combination of the masked CD47 antibody of embodiment 37 with an agonistic CD40 antibody.
Embodiment 63
(490) The method of embodiment 62, wherein the agonistic CD40 antibody has low fucosylation levels, e.g., SEA-CD40 antibody.
Embodiment 64
(491) A method of treating cancer by administering a combination of the masked CD47 antibody of embodiment 37 with an antibody drug conjugate (ADC), wherein the antibody of the ADC specifically binds to a protein that is expressed on the extracellular surface of a cancer cell and the antibody is conjugated to a drug-linker comprising a cytotoxic agent.
Embodiment 65
(492) The method of embodiment 64, wherein the cytotoxic agent is an auristatin.
Embodiment 66
(493) The method of embodiment 64, wherein the antibody of the ADC is conjugated to a drug linker selected from the group consisting of vcMMAE and mcMMAF.