NOVEL ANTIBODIES SPECIFICALLY BINDING TO ZIKA VIRUS EPITOPES AND USES THEREOF
20210355198 · 2021-11-18
Inventors
Cpc classification
A61K9/0019
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/1081
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
International classification
A61K9/00
HUMAN NECESSITIES
Abstract
The invention relates to antibodies, and antigen binding fragments thereof, that potently neutralize infection of ZIKV. The invention also relates to antigenic sites to which the antibodies and antigen binding fragments bind, as well as to nucleic acids that encode and immortalized B cells that produce such antibodies and antibody fragments. In addition, the invention relates to the use of the antibodies and antibody fragments of the invention in screening methods as well as in the diagnosis, prophylaxis and treatment of ZIKV infection.
Claims
1-55. (canceled)
56. Method of inhibiting a Zika virus infection in a subject, the method comprising administering to the subject an antibody, or an antigen binding fragment thereof, that specifically binds to a Zika virus EDIII epitope, wherein the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
57-109. (canceled)
110. The method of claim 56, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 70% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
111. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 75% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 75% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
112. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 80% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
113. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 85% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
114. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 90% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
115. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 92% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 92% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
116. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) amino acid sequence having at least 95% sequence identity to the amino acid sequence of SED ID NO: 26, and a light chain variable region (VL) amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 27, provided that the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
117. The method of claim 110, wherein the antibody or antigen binding fragment thereof comprises the heavy chain variable region (VH) amino acid sequence of SEQ ID NO: 26 and the light chain variable region (VL) amino acid sequence of SEQ ID NO: 27.
118. The method of claim 56, wherein the antibody or antigen binding fragment thereof comprises and Fc moiety.
119. The method of claim 118, wherein the antibody or antigen binding fragment thereof comprises a mutation in the Fc moiety that reduces binding of the antibody or antigen binding fragment to an Fc receptor.
120. The method of claim 119, wherein the antibody or antigen binding fragment thereof comprises a CH2 L4A mutation, a CH2 L5A mutation, or both.
121. The method of claim 56, wherein the antibody or antigen binding fragment thereof is comprised in a composition that further comprises a pharmaceutically acceptable excipient, diluent, or carrier.
122. The method of claim 56, wherein the antibody or antigen binding fragment thereof is a human antibody.
123. The method of claim 56, wherein the subject was diagnosed with Zika virus infection or shows symptoms of Zika virus infection.
124. The method of claim 56, wherein the subject is pregnant.
125. The method of claim 56, wherein the antibody or antigen binding fragment thereof is an IgG1 isotype.
126. A method of inhibiting a Zika virus infection in a subject, the method comprising administering to the subject an antibody, or an antigen binding fragment thereof, that specifically binds to a Zika virus EDIII epitope, wherein the antibody or antigen binding fragment thereof comprises CDRH1, CRDH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively, and wherein the antibody or antigen binding fragment thereof comprises a Fc moiety that comprises a CH2 L4A mutation, a CH2 L5A mutation, or both.
127. A method of inhibiting a Zika virus infection in a subject, the method comprising administering to the subject an antibody, or an antigen binding fragment thereof, that specifically binds to a Zika virus EDIII epitope, wherein the antibody or antigen binding fragment thereof comprises the heavy chain variable region (VH) amino acid sequence of SEQ ID NO.: 26 and the light chain variable region (VL) amino acid sequence of SEQ ID NO.: 27, and wherein the antibody or antigen binding fragment thereof comprises a Fc moiety that comprises a CH2 L4A mutation, a CH2 L5A mutation, or both.
128. An antibody, or an antigen binding fragment thereof, that specifically binds to a Zika virus EDIII epitope, wherein the antibody or antigen binding fragment thereof comprises: (a) CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (a)(i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (a)(ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively, and (b) an Fc moiety comprising a mutation at at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292, 5239, E269, E293, Y296, V303, A327, P331, K338 and D376, and K414, wherein the mutation reduces binding of the antibody or antigen binding fragment to an FcγRT, an FcγRIIa, an FcγRIIIa, or any combination thereof.
129. The antibody or antigen binding fragment of claim 128, wherein the Fc moiety comprises a CH2 L4A mutation, a CH2 L5A mutation, or both.
130. The antibody or antigen binding fragment of claim 128, wherein the Fc moiety comprises a CH2 L4A mutation and a CH2 L5A mutation.
131. The antibody or antigen binding fragment of claim 128, wherein the antibody further comprises a mutation in the CH2 and/or CH3 domain of the heavy chain that increases the serum half-life of the antibody as compared to an unmutated antibody.
132. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
133. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 75% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 75% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
134. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
135. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
136. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
137. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 92% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 92% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
138. The antibody or antigen binding fragment of claim 128, comprising a heavy chain variable region (VH) amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO.:26, and a light chain variable region (VL) amino acid sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO.:27, provided that antibody or antigen binding fragment thereof comprises CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 amino acid sequences of: (i) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, EDN, and SEQ ID NO: 25, respectively; or (ii) SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 24, and SEQ ID NO: 25, respectively.
139. An antibody, or an antigen binding fragment thereof, that specifically binds to a Zika virus EDIII epitope, wherein the antibody or antigen binding fragment thereof comprises: (a) a heavy chain variable region (VH) amino acid sequence SEQ ID NO: 26; (b) a light chain variable region (VL) amino acid sequence SEQ ID NO: 27; and (c) an Fc moiety comprising a mutation at at least one of E233-G236, P238, D265, N297, A327, P329, D270, Q295, A327, R292, 5239, E269, E293, Y296, V303, A327, P331, K338 and D376, and K414, wherein the mutation reduces binding of the antibody or antigen binding fragment to an FcγRT, an FcγRIIa, an FcγRIIIa, or any combination thereof.
140. The antibody or antigen binding fragment of claim 139, wherein the Fc moiety comprises a CH2 L4A mutation, a CH2 L5A mutation, or both.
Description
DESCRIPTION OF FIGURES
[0466]
[0467]
[0468]
[0469]
[0470]
[0471]
[0472]
[0473]
[0474]
[0475]
[0476]
[0477]
[0478]
[0479]
[0480]
[0481]
[0482]
[0483]
[0484]
[0485]
[0486]
[0487]
[0488]
EXAMPLES
[0489] Exemplary embodiments of the present invention are provided in the following examples. The following examples are presented only by way of illustration and to assist one of ordinary skill in using the invention. The examples are not intended in any way to otherwise limit the scope of the invention.
Example 1: Isolation of ZIKV-Specific Antibodies and Production of Monoclonal Antibodies
[0490] IgG+ memory B cells were isolated from cryopreserved peripheral blood mononuclear cells (PBMCs) of four ZIKV-infected donors (ZKA, ZKB, ZKC and ZKD) using CD22 microbeads (Miltenyi Biotec), followed by depletion of cells carrying IgM, IgD and IgA by cell sorting. Memory B cells from the ZIKV-infected donors were then immortalized with EBV (Epstein Barr Virus) and CpG (CpG oligodeoxynucleotide 2006) in multiple replicate wells as previously described (Traggiai, E. et al., Nat. Med. 10, 871-875, 2004) and culture supernatants were then tested in a primary screening using in parallel a 384-well based micro-neutralization assay and a binding assay (ELISA) to test their binding to ZIKV NS1 protein or to ZIKV E protein. Results of the binding assay are shown in
[0491] Neutralization assays were undertaken on Vero cells. In a 384-well plate, ZIKV H/PF/2013 that resulted in an infection rate (m.o.i, multiplicity of infection) of 0.35 was incubated with superntanants for 1 h at 37% (5% CO2) before the addition to pre-seeded 5'000 Vero cells. These were incubated for a further 5 days, after which supernatant was removed and WST-1 reagent (Roche) was added. Positive cultures were collected and expanded. From positive cultures the VH and VL sequences were retrieved by RT-PCR. Antibodies were cloned into human IgG1 and Ig kappa or Ig lambda expression vectors (kindly provided by Michel Nussenzweig, Rockefeller University, New York, US) essentially as described (Tiller T, Meffre E, Yurasov S, Tsuiji M, Nussenzweig M C, Wardemann H (2008) Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods 329: 112-124). Monoclonal antibodies were produced from EBV-immortalized B cells or by transient transfection of 293 Freestyle cells (Invitrogen). Supernatants from B cells or transfected cells were collected and IgG were affinity purified by Protein A or Protein G chromatography (GE Healthcare) and desalted against PBS.
[0492]
[0493] Additional antibodies were isolated for their ability to bind to ZIKV NS1 protein (cf.
[0494]
Example 2: Characterization of Antibodies ZKA190, ZKA185, ZKA230, ZKA64 and ZKA78
[0495] In Example 1, a large number of ZIKV-neutralizing antibodies were identified and characterized for their specificity to ZIKV, in particular ZIKV E protein and ZIKV EDIII as well as for their cross-reactivity towards DENV. Antibodies ZKA190 (SEQ ID NOs: 1-18), ZKA185 (SEQ ID NOs: 19-36), ZKA230 (SEQ ID NOs: 37-54), ZKA64 (SEQ ID NOs: 73-90) and ZKA 78 (SEQ ID NOs: 55-72) described in Example 1 were then selected and further tested against ZIKV E protein (“ZIKV”), ZIKV EDIII (“DIIIZI”) and also tested against the E protein of dengue virus (DENV, serotype number 1) by ELISA. To this end, a standard ELISA was used. Briefly, ELISA plates were coated with ZIKV E protein at 1 or 3 μg/ml, blocked with 10% FCS in PBS, incubated with sera or human antibodies and washed. Bound antibodies were detected by incubation with AP-conjugated goat anti-human IgG (Southern Biotech). Plates were then washed, substrate (p-NPP, Sigma) was added and plates were read at 405 nm. The relative affinities of monoclonal antibody binding were determined by measuring the concentration of antibody (EC50) required to achieve 50% maximal binding at saturation.
[0496] Results are shown in
[0497] Moreover, none of ZKA190, ZKA185, ZKA230, and ZKA64 showed any detectable binding to DENV E proteins (
[0498] To further confirm those results, the ZIKV E protein binding antibodies ZKA190, ZKA64 and ZKA78 were additionally tested against E protein of dengue virus (DENV, serotypes number 1-4). ZKA64 and ZKA190 did not bind to DENV1-4 E protein, thereby confirming that ZKA64 and ZKA190 are specific for ZIKV. ZKA78, in contrast, bound to DENV1-4 E, confirming that ZKA78 is a cross-reactive antibody binding to the E protein of both ZIKV and DENV (cf.
Example 3: Characterization of ZIKV NS1-Specific Antibodies for Serological Diagnosis
[0499] In Example 1, a large number of NS1-reactive antibodies were identified and then characterized for their specificity to ZIKV NS1 and cross-reactivity towards other flavivirus NS1 proteins (
[0500] Results are shown in
[0501] To investigate the binding of the antibodies to ZIKV NS1 further, bio-layer interferometry competition assays were used. A cross-competition matrix was generated using biolayer interferometry (BLI; Octet) on 13 antibodies specific for ZIKV NS1 (i.e. not cross-reactive with DENV NS1), namely antibodies ZKA24, ZKA15, ZKA32, ZKA19, ZKA50, ZKA37, ZKA46, ZKA10, ZKA48, ZKA35, ZKA25, ZKA44, and ZKA30 (cf.
[0502] Competition assays and antigenic sites determination were determined at 37° C. with a Octet RED96 system, ForteBio. The ZIKV-NS1 protein diluted to 2.5 μg/ml in PBS was immobilized for 7-9 minutes on the surface of an APS coated sensor-chip. Coated biosensors were placed in wells containing blocking buffer (0.1% BSA in PBS) for 6 minutes to block free Biosensor binding sites. Coated-Biosensors were then incubated for 8 minutes with a set of single purified mAbs specific for ZIKV-NS1 diluted in blocking buffer at 10 μg/ml. After binding of the first set of mAbs (step 1), Biosensors were moved to wells containing different mAbs for 8 minutes (step 2). Association of the second mAb resulted in recognition of a different antigenic site compared to the first mAb (e.g. non-competition). Competition or partial competition were determined in step 2 when no association or low association was detected, respectively. A cross-competition matrix was created by multiple runs of competitions in order to predict antigenic site mapping on ZIKV NS1.
[0503] Results are shown in
[0504] Additionally, binding of 10 antibodies cross-reacting to ZIKV NS1 protein and to DENV NS protein (namely, ZKA18, ZKA29, ZKA39, ZKA53, ZKA54, ZKB19, ZKB23, ZKC29, ZKC33, and ZKC34;
[0505] Results are shown in
Example 4: Use of ZIKV NS1-Specific Antibodies in Diagnosis of ZIKV Infection
[0506] In the present Example, the usefulness of the ZIKV NS1-specific antibodies of the present invention in diagnosis of ZIKV infection was investigated. More specifically, the use of ZIKV NS1-specific antibodies of the present invention to specifically detect the presence or absence of antibodies elicited against ZIKV NS1 in plasma samples of ZIKV- or DENV-infected donors was determined.
[0507] To this end, a “blockade of binding” assay was used. In particular, the ability of ZIKV NS1-reactive plasma antibodies to inhibit the binding of the biotinylated antibody ZKA35 to ZIKV NS1 was measured. To this end, ZIKV NS1-specific antibody ZKA35 was biotinylated using the EZ-Link NHS-PEO solid phase biotinylation kit (Pierce). Labelled ZKA35 was tested for binding to ZIKV NS1 to determine the optimal concentration of ZKA35 to achieve 70% maximal binding. Plasma samples from ZIKV- (n=4), DENV-immune (n=5) donors and control (n=48) plasma (1/10 dilution) were added to ELISA plates coated with ZIKV NS1. After 1 h, biotinylated anti-ZIKV NS1 antibody ZKA35 was added at the concentration achieving 70% maximal binding and the mixture was incubated at room temperature for 15 minutes. Plates were washed, substrate (p-NPP, Sigma) was added and plates were read at 405 nm. The percentage of inhibition was calculated as follow: (1−(OD sample−OD neg ctr)/(OD pos ctr−OD neg ctr)
)×100.
[0508] Results are shown in
Example 5: The Antibodies According to the Present Invention Potently Neutralize ZIKV Infection
[0509] The isolated antibodies ZKA190, ZKA185, ZKA230, ZKA64 and ZKA78 were tested for their ability to neutralize ZIKV and DENV1 infection in vitro.
[0510] Neutralization of DENV and ZIKV infection by antibodies was measured using a micro-neutralization flow cytometry-based assay. Different dilutions of antibodies were mixed with ZIKV (MOI of 0.35) or attenuated DENV1 (all at MOI of 0.04) for 1 hour at 37° C. and added to 5000 Vero cells/well in 96-well flat-bottom plates. After four days for ZIKV and five days for DENV, the cells were fixed with 2% formaldehyde, permeabilized in PBS 1% FCS 0.5% saponin, and stained with the mouse mAb 4G2. The cells were incubated with a goat anti-mouse IgG conjugated to Alexa Fluor488 (Jackson Immuno-Research, 115485164) and analyzed by flow cytometry. In other cases the ZIKV neutralization data are also determined measuring cell viability using the WST-1 reagent (Roche). The neutralization titer (50% inhibitory concentration IC50
) was expressed as the antibody concentration that reduced the infection by 50% compared to cell-only control wells.
[0511] Results are shown in
[0512] It is important to note that the ultra-potent ZKA64 and ZKA190 antibodies in addition to their ability to neutralize the ZIKV H/PH/2013 strain (present example), also bound to the E protein and EDIII derived from the ZIKV strains MR766 and SPH2015, respectively (
Example 6: The “LALA” Mutation Inhibits Antibody-Dependent Enhancement of ZIKV Infection by Serum Antibodies
[0513] Neutralizing antibodies were also tested for their ability to enhance the infection of ZIKV in the non-permissive K562 cells (antibody-dependent enhancement assay, ADE assay). ADE was measured by a flow based assay using K562 cells. Antibodies and ZIKV H/PF/2013 (MOI 0.175) were mixed for 1 hour at 37° C. and added to 5000 K562 cells/well. After four days, cells were fixed, permeabilized, and stained with m4G2. The number of infected cells was determined by flow cytometry.
[0514] Results are shown in
[0515] In view thereof it was investigated whether ADE could be also induced by immune sera and whether this could be blocked by neutralizing antibodies delivered as a “LALA variant”. To obtain the LALA variant, each of the heavy chains was mutated at amino acids 4 and 5 of CH2 domain by substituting an alanine in place of the natural leucine using site-directed mutagenesis. As described above, LALA variants (of human IgG1 antibodies) do not bind to Fc-gamma-receptors and complement.
[0516] To investigate the effect of ZKA64-LALA antibody in ZIKV ADE, an inhibition of ADE assay was used. Since ADE of ZIKV is observed using ZIKV- or DENV-immune plasma, ZIKV (MOI 0.175) was mixed with plasma from primary ZIKV- or DENV-infected donors for 30 minutes at 37° C. ZKA64-LALA antibody was added at 50 μg/ml, mixed with 5000 K562 cells/well and incubated for three days. Cells were then stained with 4G2 and analyzed by flow cytometry.
[0517] Results are shown in
[0518] Of note, the ADE effect of ZIKV- and DENV-immune plasma was completely blocked by the EDIII-specific ZKA64-LALA antibody. The ADE blocking ability of a single EDIII-specific LALA antibody could be related not only to its capacity to out-compete serum enhancing antibodies but also to neutralize virus once internalized into endosomes.
[0519] These results indicate that a potently neutralizing antibody, such as ZKA190, ZKA230, ZKA185 or ZKA64, developed in the “LALA” form, have a strong potential to be used in prophylactic or therapeutic settings to prevent congenital ZIKV infection, e.g. in pregnant women and/or in people living in high risk areas. The use of the LALA form avoids the risk of ZIKV ADE and, as shown above, could also block ADE of pre-existing cross-reactive antibodies, such as in the case of patients already immune to DENV.
Example 7: Analysis of Samples from European Residents Using ZIKV NS1-Specific Antibodies for Diagnosis of ZIKV Infection
[0520] The present Example is based on the blockade of binding assay described in Example 4. To further assess the specificity of the ZIKV NS1 BOB assay, a large set of samples obtained from patients infected with DENV, WNV or Chikungunya virus (CHIKV) was tested.
[0521] To this end, a “blockade of binding” assay was used. Polystyrene plates were coated overnight with 1 μg/ml of ZIKV NS1 and blocked for 1 hour with PBS containing 1% BSA. Plasma or serum (1:10 dilution) were added to NS1-coated ELISA plates. Thereafter, e.g. after 1 hour, an equal volume of biotinylated anti-NS1 ZKA35 was added, and the mixture was incubated, e.g. at room temperature for 15 minutes. Plates were washed and alkaline-phosphatase-conjugated streptavidin was added, e.g. for 30 minutes. Plates were washed again and the substrate was added. The percentage of inhibition was calculated as follow: (1−(OD sample−OD neg ctr)/(OD pos ctr−OD neg ctr)
)×100.
[0522] Results are shown in
Example 8: An Antibody According to the Present Invention Neutralizes ZIKV More Potently than Prior Art Antibody EDE1 mAb C8
[0523] To compare the neutralizing antibodies according to the present invention with highly neutralizing anti-ZIKV antibodies of the prior art, neutralization performance of ZKA190 was compared to that of prior art highly neutralizing mAb EDE1 C8 (Barba-Spaeth G, Dejnirattisai W, Rouvinski A, Vaney M C, Medits I, Sharma A, Simon-Lorière E, Sakuntabhai A, Cao-Lormeau V M, Haouz A, England P, Stiasny K, Mongkolsapaya J, Heinz F X, Screaton G R, Rey F A. Structural basis of potent Zika-dengue virus antibody cross-neutralization. Nature. 2016 Aug. 4; 536(7614):48-53). Neutralization of both antibodies was tested against a panel of four distinct ZIKV strains (H/PF/2013; MR766, MRS-OPY and PV10552).
[0524] Briefly, neutralization of ZIKV infection by mAbs was measured using a micro-neutralization flow cytometry-based assay. Different dilutions of mAbs were mixed with ZIKV (MOI of 0.35) for 1 hour at 37° C. and added to 5000 Vero cells/well in 96-well flat-bottom plates. After four days for ZIKV, the cells were fixed with 2% formaldehyde, permeabilized in PBS containing 1% fetal calf serum (Hyclone) and 0.5% saponin, and stained with the mouse mAb 4G2. The cells were incubated with a goat anti-mouse IgG conjugated to Alexa Fluor488 (Jackson Immuno-Research, 115485164) and analyzed by flow cytometry. The neutralization titer (50% inhibitory concentration IC50
) is expressed as the antibody concentration that reduced the infection by 50% compared to virus-only control wells.
[0525] Results are shown in
Example 9: Further Characterization of Antibody ZKA190
[0526] The potency of antibody ZKA190 was further investigated in vitro and in vivo. To this end, the mAb was synthesized in IgG1 wild-type (wt) format and in an IgG1 Fc-LALA format. Briefly, the VH and VL sequences were cloned into human Igγ1, Igκ and Igλ expression vectors (kindly provided by Michel Nussenzweig, Rockefeller University, New York, N.Y., USA), essentially as described (Tiller T, Meffre E, Yurasov S, Tsuiji M, Nussenzweig M C, Wardemann H: Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. J Immunol Methods 2008, 329:112-124). Recombinant mAbs were produced by transient transfection of EXPI293 cells (Invitrogen), purified by Protein A chromatography (GE Healthcare) and desalted against PBS. To obtain the LALA variant, each of the heavy chains was mutated at amino acids 4 and 5 of CH2 domain by substituting an alanine in place of the natural leucine using site-directed mutagenesis. As described above, LALA variants (of human IgG1 antibodies) do not bind to Fc-gamma-receptors and complement.
[0527] As shown in
[0528] Since ZIKV has been shown to infect human neural progenitor cells (hNPC) leading to heightened cell toxicity, dysregulation of cell-cycle and reduced cell growth, ZKA190 and ZKA190-LALA were tested in hNPCs. To this end, adult male fibroblasts obtained from the Movement Disorders Bio-Bank (Neurogenetics Unit of the Neurological Institute ‘Carlo Besta’, Milan) were reprogrammed using the CytoTune-iPS 2.0 Sendai kit (Life Technologies). hiPSCs were maintained in feeder-free conditions in mTeSR1 (Stem Cell Technologies). To generate embryoid bodies (EBs), dissociated hiPSCs were plated into low adhesion plates in mTeSR1 supplemented with N2 (0.5×) (ThermoFisher Scientific), human Noggin (0.5 mg/ml, R&D System), SB431542 (5 M, Sigma), Y27632 (10 μM, Miltenyi Biotec) and penicillin/streptomycin (1%, Sigma) (as described in Marchetto M C N, Carromeu C, Acab A, Yu D, Yeo G W, Mu Y, Chen G, Gage F H, Muotri A R: A model for neural development and treatment of Rett syndrome using human induced pluripotent stem cells. Cell 2010, 143:527-539). To obtain rosettes, EBs were plated after 10 days onto matrigel-coated plates (1:100, matrigel growth factor reduced, Corning) in DMEM/F12 (Sigma) with N2 (1:100), non-essential amino acids (1%, ThermoFisher Scientific) and penicillin/streptomycin. After 10 days, cells were passaged with Accutase (Sigma) and seeded onto matrigel coated-flasks in NPC media containing DMEM/F12, N2 (0.25%), B27 (0.5%, ThermoFisher Scientific), penicillin/streptomycinand FGF2 (20 ng/ml, ThermoFisher Scientific). hNPCs (3×104) were plated on coverslips in 24-well plates 3 days prior to infection with PRVABC59 strain. Virus stock was incubated with the mAbs 1 h prior to addition to hNPCs to obtain an MOI of 0.5. After 4 h of virus adsorption, culture supernatant was removed and fresh medium containing the mAbs was re-added. Supernatant was collected 96 h post-infection to measure virus titers by plaque assay on Vero cells. Cells were fixed in 4% paraformaldehyde (PFA, Sigma) solution in phosphate-buffered saline (PBS, Euroclone) for 30 min for indirect immunofluorescence. Fixed cells were permeabilized for 30 minutes (min) in blocking solution, containing 0.2% Triton X-100 (Sigma) and 10% donkey serum (Sigma), and incubated overnight at 4° C. with the primary antibodies in blocking solution. The following antibody was used for detection: anti-envelope (1:200, Millipore, MAB10216). Then, cells were washed with PBS and incubated for 1 h with Hoechst and anti-mouse Alexa Fluor-488 secondary antibodies (1:1,000 in blocking solution, ThermoFisher Scientific). After PBS washes, cells were washed again and mounted. Results are shown in
[0529] Next, the ability of ZKA190 and ZKA190-LALA to cause ADE was tested in the K562 cell line as described in Example 6. Briefly, ADE was measured by a flow based assay using K562 cells. Briefly, for ZKA190, ZKA190 and ZIKV H/PF/2013 (MOI 0.175) were mixed for 1 hour at 37° C. and added to 5000 K562 cells/well. After four days, cells were fixed, permeabilized, and stained with mAb m4G2. The number of infected cells was determined by flow cytometry. For ZKA190-LALA, ZIKV (MOI 0.175) was mixed with plasma from primary ZIKV-infected donors for 30 minutes at 37° C. ZKA190-LALA was added at 50 μg/ml, mixed with 5000 K562 cells/well and incubated for three days. Cells were then stained with 4G2 and analyzed by flow cytometry. Results are shown in
[0530] Anti-prM antibodies form part of the predominant antibodies elicited during the human immune response against flaviviruses and have been shown to enhance virus infection in vitro (Dejnirattisai, W., Jumnainsong, A., Onsirisakul, N., Fitton, P., Vasanawathana, S., Limpitikul, W., Puttikhunt, C., Edwards, C., Duangchinda, T., Supasa, S., et al. (2010). Cross-reacting antibodies enhance dengue virus infection in humans. Science 328, 745-748). K562 cells were pre-incubated with serial dilutions of prM cross-reactive antibody DV62 (Beltramello, M., Williams, K. L., Simmons, C. P., Macagno, A., Simonelli, L., Quyen, N. T. H., Sukupolvi-Petty, S., Navarro-Sanchez, E., Young, P. R., de Silva, A. M., et al. (2010). The human immune response to Dengue virus is dominated by highly cross-reactive antibodies endowed with neutralizing and enhancing activity. Cell Host Microbe 8, 271-283) derived from a DENV immune donor. Results are shown in
[0531] Finally, the ability of different concentrations of ZKA190, ZKA190-LALA and ZKA190 Fab to cause or block ADE of ZIKV in the presence of enhancing concentrations of human anti-DENV2 plasma or DV62 was tested. Results are shown in
Example 10: ZKA190 Binds to a Conserved and Highly Accessible Region of EDIII
[0532] To determine the ZKA190 epitope at the residue level, solution NMR spectroscopy was used as described in Bardelli, M., Livoti, E., Simonelli, L., Pedotti, M., Moraes, A., Valente, A. P., and Varani, L. (2015). Epitope mapping by solution NMR spectroscopy. J. Mol. Recognit. 28, 393-400; Simonelli, L., Beltramello, M., Yudina, Z., Macagno, A., Calzolai, L., and Varani, L. (2010). Rapid structural characterization of human antibody-antigen complexes through experimentally validated computational docking. J Mol Biol 396, 1491-1507; and Simonelli, L., Pedotti, M., Beltramello, M., Livoti, E., Calzolai, L., Sallusto, F., Lanzavecchia, A., and Varani, L. (2013). Rational Engineering of a Human Anti-Dengue Antibody through Experimentally Validated Computational Docking. PLoS ONE 8, e55561.
[0533] Briefly, spectra were recorded on a Bruker Avance 700 MHz NMR spectrometer at 300 K. For assignments of backbone resonances standard triple resonance experiments (HNCO, HN(CA)CO, HN(CO)CACB, HNCACB were used, while sidechains were annotated using HCCH-TOCSY and HBHA(CO)NH experiments. All NMR experiments were processed using Topspin 2.1 (Bruker Biospin) and analysed with CARA. NOESY cross peaks were automatically assigned using the CYANA “noeassign” macro based on the manually assigned chemical shifts. Upper-distance restraints used for the structure calculations in CYANA using the standard simulated annealing protocol were derived from 70 ms .sup.15N- and .sup.13C-resolved NOESY spectra. Backbone dynamics of ZIKV EDIII were derived from .sup.15N relaxation measurements recorded on 600 and 700 MHz spectrometers. Proton-detected versions of the CPMG (R2), inversion-recovery (R1) and .sup.15N {.sup.1H}-steady-state NOE were utilized. Delay settings for the T2 series were in the range of 0 to 0.25 sec and for the T1 series between 0.02 to 2 sec. The .sup.15N {.sup.1H}-NOE experiment used a relaxation delay of 5 s. The R1 and R2 relaxation rates were derived from least-squares fits of corresponding exponential functions to the measured data using home-written scripts. The relaxation data were analyzed in a model-free approach using the software package DYNAMICS. The program ROTDIF was used to calculate the overall correlation time from the relaxation data (8.5 ns). NMR epitope mapping was performed as previously described (Bardelli et al., 2015; Simonelli et al., 2010; 2013). Briefly, overlay of .sup.15NHSQC spectra of labelled EDIII free or bound to ZKA190 Fab allowed identification of EDIII residues whose NMR signal changed upon complex formation, indicating that they were affected by ZKA190 binding. Changes were identified by manual inspection and by the Chemical Shift Perturbation (CSP), CSP=((Δδ.sub.H).sup.2±(Δδ.sub.N/10).sup.2).sup.1/2. NMR samples were typically 800 μM of .sup.15N, .sup.13C
-labeled EDIII in 20 mM sodium phosphate, 50 mM NaCl, pH 6.0. Perdeuterated (nominally 70%) .sup.2H,.sup.15N EDIII samples were used for NMR epitope mapping with a EDIII:ZKA190 Fab ratio of 1:1.1; EDIII concentration was typically 0.4 mM.
[0534] Since the NMR signal is strongly dependent on the local chemical environment, changes upon complex formation identify antigen residues that are affected by antibody binding, either directly or through allosteric effects. By comparing the NMR spectra of free and bound EDIII (
[0535] Computational docking followed by molecular dynamics simulation, guided and validated by NMR-derived epitope information as well as EDIII mutagenesis, showed that ZKA190 binds through an interface characterized by shape and charge complementarity (
Example 11: Mechanisms of ZKA190 Neutralization
[0536] The ability of ZKA190 to efficiently neutralize the virus may involve inhibition of either cell attachment or membrane fusion. A further mechanism might involve virus inactivation through cross-linking of viral particles.
[0537] ZKA190 Fab can neutralize ZIKV, albeit less efficiently than the corresponding IgG. By binding to the EDI-EDIII linker, ZKA190 (both Fab and IgG) might inhibit the ˜70 degree rotation of DIII required for viral fusion to the host cell membrane (Bressanelli, S., Stiasny, K., Allison, S. L., Stura, E. A., Duquerroy, S., Lescar, J., Heinz, F. X., and Rey, F. A. (2004). Structure of a flavivirus envelope glycoprotein in its low-pH-induced membrane fusion conformation. Embo J 23, 728-738; Modis, Y., Ogata, S., Clements, D., and Harrison, S. C. (2004). Structure of the dengue virus envelope protein after membrane fusion. Nature 427, 313-319). Alternatively, ZKA190 might prevent the attachment of ZIKV to target cells.
[0538] The ability of ZKA190 to inhibit membrane fusion is supported by confocal microscopy analysis. To this end, Vero cells were plated at 7,500 cells/well on 12 mm-diameter coverslips in 24-well plates and incubated overnight. Cells were infected with ZIKV H/PF/2013 (MOI of 100) in the presence or absence of neutralizing concentrations of Alexa-488 conjugated mAbs (0.7 μM) at 37° C. for 3 h, washed with PBS, and fixed with 2% paraformaldehyde in PBS for 30 min at room temperature. Acidified endosome were identified with Lysotracker red (Invitrogen) by adding the dye (50 nM) to the cells for the last 30 min of the incubation prior to fixation. Fixation was followed by extensive washes in PBS and 50 mM glycine and finally the coverslips were prepared for microscopy analysis using Vectashield mounting medium for fluorescence with DAPI (Vector Laboratories). Samples were analyzed by confocal microscopy using a Leica TCS SP5 microscope with a 63×/1.4 N.A. objective. Image analysis and processing was performed with FIJI software.
[0539] Results are shown in
Example 12: In Vivo Characterization of the EDIII-Specific mAb ZKA190
[0540] To evaluate their prophylactic and therapeutic properties, ZKA190 and ZKA190-LALA were tested in A129 mice challenged with a lethal dose of ZIKV strain MP1751 (African lineage). To test their prophylactic potencies, ZKA190 and ZKA190-LALA were administered one day before virus challenge.
[0541] Female A129 mice (IFN-alpha/beta receptor −/−) and wild-type 129Sv/Ev mice aged 5-8 weeks were administered mAbs (ZKA190, ZKA190-LALA and control antibody MPE8 (Corti, D., et al. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature 501, 439-443 (2013)) diluted in PBS at different doses via the intraperitoneal (i.p.) route in a volume of 500 μl. MAbs were administered either 1 day before or 1, 2, 3 or 4 days after virus challenge. Animals were challenged subcutaneously with 102 pfu ZIKV (strain MP1751) and followed for 14 days. Weights and temperatures were monitored daily and clinical observations were recorded at least twice per day. On day 5 post-challenge, 50 μl of blood was collected from each animal into a RNAprotect tube (Qiagen, UK) and frozen at −80° C. At the end of the study (14 days post-challenge) or when animals met human endpoints, necropsies were undertaken, and blood and sections of brain, spleen, liver, kidney and ovary were collected for virological analysis.
[0542] Tissue samples from A129 mice were weighed and homogenized into PBS using ceramic beads and an automated homogenizer (Precellys, UK) using six 5 second cycles of 6500 rpm with a 30 second gap. Two hundred μl of tissue homogenate or blood solution was transferred into 600 μL RLT buffer (Qiagen, UK) for RNA extraction using the RNeasy Mini extraction kit (Qiagen, UK); samples were passed through a QIAshredder (Qiagen, UK) as an initial step. A ZIKV specific realtime RT-PCR assay was utilized for the detection of viral RNA from subject animals. The primer and probe sequences were adopted from Quick et al., 2017 (Quick, J, Grubaugh N D, Pullan S T, Claro I M, Smith A D, Gangavarapu K, Oliveira G, Robles-Sikisaka R, Rogers T F, Beutler N A, et al.: Multiplex PCR method for MinION and Illumina sequencing of Zika and other virus genomes directly from clinical samples. Nat Protoc 2017, 12:1261-1276) with in-house optimization and validation performed to provide optimal mastermix and cycling conditions. Real-time RT-PCR was performed using the SuperScript III Platinum One-step qRT-PCR kit (Life Technologies, UK). The fmal mastermix (15 μl) was comprised of 10 μl of 2× Reaction Mix, 1.2 μl of PCR-grade water, 0.2 μl of 50 mM MgSO4, 1 μl of each primer (ZIKV 1086 and ZIKV 1162c both at 18 μM working concentration), 0.8 μl of probe (ZIKV 1107-FAM at 25 μM working concentration) and 0.8 μl of SSIII enzyme mix. Five μl of template RNA was added to the mastermix, yielding a final reaction volume of 20 μl. The cycling conditions used were 50° C. for 10 minutes, 95° C. for 2 minutes, followed by 45 cycles of 95° C. for 10 seconds and 60° C. for 40 seconds, plus a final cooling step of 40° C. for 30 seconds. Quantification analysis using fluorescence was performed at the end of each 60° C. step. Reactions were run and analyzed on the 7500 Fast platform (Life Technologies, UK) using 7500 software version 2.0.6. Quantification of viral load in samples was performed using a dilution series of quantified RNA oligonucleotide (Integrated DNA Technologies). The oligonucleotide comprised the 77 bases of ZIKV RNA targeted by the assay, based on GenBank accession AY632535.2 and was synthesized to a scale of 250 nmole with HPLC purification.
[0543] Results are shown in
[0544] To evaluate the therapeutic potential of ZKA190, we administered ZKA190 and ZKA190-LALA at different time-points following ZIKV infection. At a dose of 15 mg/kg, survival rates of 80%-100% were achieved, and the morbidity was greatly reduced even when treatment was given four days post-infection (
[0545] Tables of Sequences and SEQ ID Numbers
TABLE-US-00010 ZKA190 SEQ ID NO. Amino acid sequence CDRH.sub.1 1 GFTFSKYG CDRH.sub.2 2 ISYEGSNK CDRH.sub.3 3 AKSGTQYYDTTGYEYRGLEYFGY CDRL.sub.1 4 QSVSSSY CDRL.sub.2 5 DAS CDRL.sub.2 6 LIYDASSRA long CDRL.sub.3 7 QQYGRSRWT VH 8 QVQLVESGGGVVQPGRSLRLSCAASGFTFSKYGMHWVRQA PGKGLEWVAVISYEGSNKYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAKSGTQYYDTTGYEYRGLEYFGYW GQGTLVTVSS VL 9 EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQK RGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYGRSRWTFGQGTKVE1K ZKA190 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 10 ggattcaccttcagtaaatatggc CDRH.sub.2 11 atatcatatgagggaagtaataaa CDRH.sub.3 12 gcgaaatcggggacccaatactatgatactactggttatg agtataggggtttggaatactttggctac CDRL.sub.1 13 cagagtgttagtagcagttac CDRL.sub.2 14 gatgcatcc CDRL.sub.2 15 ctcatctatgatgcatccagcagggcc long CDRL.sub.3 16 cagcagtatggtaggtcaaggtggaca VH 17 caggtgcagctggtggagtctgggggaggcgtggtccagc ctgggaggtccctgagactctcctgtgcagcctctggatt caccttcagtaaatatggcatgcactgggtccgccaggct ccaggcaaggggctggagtgggtggcagttatatcatatg agggaagtaataaatattatgcagactccgtgaagggccg attcaccatctccagagacaattccaagaacacgctgtat ctgcaaatgaacagcctgagagctgaggacacggcagtgt attactgtgcgaaatcggggacccaatactatgatactac tggttatgagtataggggtttggaatactttggctactgg ggccagggaaccctggtcaccgtctcctcag VL 18 gaaattgtgttgacgcagtctccaggcaccctgtctttgt ctccaggggaaagagccaccctctcctgcagggccagtca gagtgttagtagcagttacttagcctggtaccagcagaaa cgtggccaggctcccaggctcctcatctatgatgcatcca gcagggccactggcatcccagacaggttcagtggcagtgg gtctgggacagacttcactctcaccatcagcagactggag cctgaagattttgcagtgtattactgtcagcagtatggta ggtcaaggtggacattcggccaagggaccaaggtggaaat caaac ZKA185 SEQ ID NO. Amino acid sequence CDRH.sub.1 19 GYSFTSYW CDRH.sub.2 20 FDPSDSQT CDRH.sub.3 21 ARRYCSSSSCYVDN CDRL.sub.1 22 ALPNKF CDRL.sub.2 23 EDN CDRL.sub.2 24 VIYEDNKRP long CDRL.sub.3 25 YSTDSSSNPLGV VH 26 EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWITWVRQM PGKGLEWMAKFDPSDSQTNYSPSFQGHVTISVDKSISTAY LQWSSLKASDTAMYYCARRYCSSSSCYVDNWGQGTLVTIF S VL 27 SYELTQPPSVSVSPGQTARITCSGDALPNKFAYWYRQKSG QAPVLVIYEDNKRPSGIPERFSGSSSGTMATLTISGAQVE DEADYHCYSTDSSSNPLGVFGGGTKLTVL ZKA185 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 28 ggatatagttttaccagttactgg CDRH.sub.2 29 tttgatcctagtgactctcaaacc CDRH.sub.3 30 gcgagaagatattgtagtagtagtagttgttatgtggaca at CDRL.sub.1 31 gcattgccaaataaattt CDRL.sub.2 32 gaggacaac CDRL.sub.2 33 gtcatctatgaggacaacaaacgaccc long CDRL.sub.3 34 tactcaacagacagcagttctaatcccctgggagta VH 35 gaagtgcagctggtgcagtccggagcagaggtgaaaaagc ccggggagtctctgaggatctcctgtaagggttctggata tagttttaccagttactggatcacctgggtgcgccagatg cccgggaaaggcctggagtggatggcgaagtttgatccta gtgactctcaaaccaactacagcccgtccttccaaggcca cgtcaccatctcagttgacaagtccatcagcactgcctac ttgcagtggagcagcctgaaggcctcggacaccgccatgt attactgtgcgagaagatattgtagtagtagtagttgtta tgtggacaattggggccagggaaccctggtcaccatcttc tcag VL 36 tcctatgagctgacacagccaccctcggtgtcagtgtccc caggacaaacggccaggatcacctgctctggagatgcatt gccaaataaatttgcttattggtaccggcagaagtcaggc caggcccctgttctggtcatctatgaggacaacaaacgac cctccgggatccctgagagattctctggctccagctcagg gacaatggccaccttgactatcagtggggcccaggtggag gatgaagctgactaccactgttactcaacagacagcagtt ctaatcccctgggagtattcggcggagggaccaagctgac cgtcctag ZKA230 SEQ ID NO. Amino acid sequence CDRH.sub.1 37 GGSISSDY CDRH.sub.2 38 IYYSGST CDRH.sub.3 39 ARRRKYDSLWGSFAFDI CDRL.sub.1 40 SSNIGGNY CDRL.sub.2 41 IND CDRL.sub.2 42 LICINDHRP long CDRL.sub.3 43 ATWDDSLGGLV VH 44 QVQLQESGPGLVKPSETLSLTCAVSGGSISSDYWSWIRQP PGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNHFSL KLNSVTAADTAVYYCARRRKYDSLWGSFAFDIWGQGTMVT VSS VL 45 QSVLTQPPSASGTPGQRVTISCSGSSSNIGGNYVYWYQQL PGTAPKLLICINDHRPSGVPDRFSGSKSGTSASLAISGLQ SEDEADYYCATWDDSLGGLVFGGGTKLTVL ZKA230 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 46 ggtggctccatcagtagtgactac CDRH.sub.2 47 atctattacagtgggagcacc CDRH.sub.3 48 gcgaggaggaggaagtatgattccctttgggggagttttg cttttgatatc CDRLi 49 agctccaacatcggaggtaattat CDRL.sub.2 50 attaatgat CDRL.sub.2 51 ctcatctgtattaatgatcaccggccc long CDRL.sub.3 52 gcaacatgggatgacagcctgggtggccttgta VH 53 caggtgcagctgcaggagtcgggcccaggcctggtgaagc cttcggagaccctgtccctcacctgcgcagtctctggtgg ctccatcagtagtgactactggagctggatccggcagccc ccagggaagggactggagtggattgggtatatctattaca gtgggagcaccaactacaacccctccctcaagagtcgagt caccatatcagtagacacgtccaagaaccacttctccctg aagctgaactctgtgaccgctgcggacacggccgtgtatt actgtgcgaggaggaggaagtatgattccctttgggggag ttttgcttttgatatctggggccaagggacaatggtcacc gtctcttcag VL 54 cagtctgtgctgactcagccaccctcagcgtctgggaccc ccgggcagagggtcaccatctcttgttctggaagcagctc caacatcggaggtaattatgtatactggtaccagcagctc ccaggaacggcccccaaactcctcatctgtattaatgatc accggccctcaggggtccctgaccgattctctggctccaa gtctggcacctcagcctccctggccatcagtgggctccag tccgaggatgaggctgattattactgtgcaacatgggatg acagcctgggtggccttgtattcggcggagggaccaagct gaccgtcctag ZKA78 SEQ ID NO. Amino acid sequence CDRH.sub.1 55 GFTFSNYA CDRH.sub.2 56 IGRNGDSI CDRH.sub.3 57 VKDLAIPESYRIEADY CDRL.sub.1 58 QSVLYRSNNKNY CDRL.sub.2 59 WAS CDRL.sub.2 60 LIYWASTRE long CDRL.sub.3 61 QQYYSSPRT VH 62 EVQLAESGGGLVQPGGSLTLSCSGSGFTFSNYAMVWARQA PGKGLEYVSGIGRNGDSIYYTDSVKGRFTISRDNSKSMVY LQMSSLRTEDTAVYYCVKDLAIPESYRIEADYWGQGTLVI VSA VL 63 DIVMTQSPDSLAVSLGERATINCKSSQSVLYRSNNKNYLS WYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT ISPLQAEDVAVYYCQQYYSSPRTFGQGTKVE1K ZKA78 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 64 ggcttcacttttagtaactatgca CDRH.sub.2 65 atcgggcgcaacggggactctatc CDRH.sub.3 66 gtgaaagatctggccatccccgagtcctacagaattgaag ctgattat CDRL.sub.1 67 cagtccgtgctgtaccgctctaacaacaagaattac CDRL.sub.2 68 tgggcttca CDRL.sub.2 69 ctgatctattgggcttcaacccgggaa long CDRL.sub.3 70 cagcagtactattctagtcctcgaact VH 71 gaggtgcagctggcagaatcaggcgggggactggtccagc ctggcggcagcctgacactgtcttgcagtggatcaggctt cacttttagtaactatgcaatggtgtgggcaaggcaggct cctgggaagggactggagtatgtctctggcatcgggcgca acggggactctatctactatactgatagtgtgaagggccg gttcaccatcagcagagacaatagcaaatccatggtgtac ctgcagatgagctccctgcgaaccgaagacacagcagtgt actattgcgtgaaagatctggccatccccgagtcctacag aattgaagctgattattggggacagggcaccctggtcatc gtgagcgccg VL 72 gacatcgtgatgacacagtctccagatagtctggcagtca gtctgggggagagggccactattaactgcaagagctccca gtccgtgctgtaccgctctaacaacaagaattacctgtct tggtatcagcagaagcccggacagccccctaaactgctga tctattgggcttcaacccgggaaagcggcgtcccagacag attctcaggcagcgggtccggaacagacttcaccctgaca attagccccctgcaggcagaggacgtggctgtctactatt gtcagcagtactattctagtcctcgaactttcggccaggg gaccaaggtggaaatcaaac ZKA64 SEQ ID NO. Amino acid sequence CDRH.sub.1 73 GYTFTGYH CDRH.sub.2 74 INPNSGGT CDRH.sub.3 75 ARMSSSIWGFDH CDRL.sub.1 76 QSVLIN CDRL.sub.2 77 GAS CDRL.sub.2 78 LIYGASSRA long CDRL.sub.3 79 QQYNDWPPIT VH 80 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYHIDWVRQA RGQGLEWMGRINPNSGGTNYAQKFQGRVTMTRDTSISTAY MQLSRLRSDDSAVYYCARMSSSIWGFDHWGQGTLVTVSS VL 81 EIVMTQSPATLSVSPGERATLSCRASQSVLINLAWYQQKP GQAPRLLIYGASSRATGIPARFSGSGSGTEFTLTISSLQS EDFAVYYCQQYNDWPPITFGQGTRLE1K ZKA64 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 82 ggctacaccttcacagggtatcac CDRH.sub.2 83 attaaccctaattctggcgggacc CDRH.sub.3 84 gctcggatgagctcctctatttggggcttcgatcat CDRL.sub.1 85 cagtctgtgctgattaac CDRL.sub.2 86 ggagcatcc CDRL.sub.2 87 ctgatctatggagcatcctccagggct long CDRL.sub.3 88 cagcagtacaatgattggccccctatcaca VH 89 caggtgcagctggtccagagcggagcagaggtgaagaaac ccggcgcctcagtgaaggtcagctgcaaagcttccggcta caccttcacagggtatcacatcgactgggtgaggcaggca agaggacagggactggaatggatgggacggattaacccta attctggcgggaccaactacgcccagaagtttcagggccg agtgactatgaccagagacaccagcatctccacagcttat atgcagctgtcccggctgagatctgacgatagtgccgtct actattgtgctcggatgagctcctctatttggggcttcga tcattgggggcagggaacactggtgactgtcagttcag VL 90 gagatcgtgatgactcagtctccagccaccctgtcagtca gcccaggagaacgggcaaccctgtcttgcagagcctccca gtctgtgctgattaacctggcttggtaccagcagaagcca ggccaggcaccccgactgctgatctatggagcatcctcca gggctaccggcattcctgcacgcttcagtggatcaggaag cggaacagagtttaccctgacaatctctagtctgcagtcc gaagacttcgctgtctactattgtcagcagtacaatgatt ggccccctatcacatttggccaggggactagactggagat caagc ZKA15 SEQ ID NO. Amino acid sequence CDRH.sub.1 91 GGFINSYY CDRH.sub.2 92 IYKSGST CDRH.sub.3 93 ARDPYGDYVKAFDI CDRL.sub.1 94 QSLLHSNGYNY CDRL.sub.2 95 LGS CDRL.sub.2 96 LIYLGSNRA long CDRL.sub.3 97 MQALQTVT VH 98 QVQLQESGPGLVKPSETLSLTCTVSGGFINSYYWSWIRQP AGKGLEWIGRIYKSGSTNYNPSLKSRVTMSLDTSKYQFSL KLRSVTAADTAVYYCARDPYGDYVKAFDIWGQGTMVTVSS VL 99 DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLNW YLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCMQALQTVTFGPGTKVD1K ZKA15 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 100 ggtggcttcatcaatagttactac CDRH.sub.2 101 atctataaaagtgggagcacc CDRH.sub.3 102 gcgagagatccctacggtgactacgttaaggcttttgata tt CDRL.sub.1 103 cagagcctcctgcatagtaatggatacaactat CDRL.sub.2 104 ttgggttct CDRL.sub.2 105 ctgatctatttgggttctaatcgggcc long CDRL.sub.3 106 atgcaagctctacaaactgtcact VH 107 caggtgcagctgcaggagtcggggccaggactggtgaagc cttcggagaccctgtccctcacctgcactgtctccggtgg cttcatcaatagttactactggagctggatccggcagccc gccgggaagggactggagtggattgggcgtatctataaaa gtgggagcaccaactacaacccctccctcaagagtcgagt caccatgtcactagacacgtccaagtaccagttctccctg aagctgaggtctgtgaccgccgctgacacggccgtgtatt actgtgcgagagatccctacggtgactacgttaaggcttt tgatatttggggccaagggacaatggtcaccgtctcttca g VL 108 gatattgtgatgactcagtctccactctccctgcccgtca cccctggagagccggcctccatctcctgcaggtctagtca gagcctcctgcatagtaatggatacaactatttgaattgg tacctgcagaagccagggcagtctccacagctcctgatct atttgggttctaatcgggcctccggggtccctgacaggtt cagtggcagtggatcaggcacagattttacactgaaaatc agcagagtggaggctgaggatgttggggtttattactgca tgcaagctctacaaactgtcactttcggccctgggaccaa agtggatatcaaac ZKA25 SEQ ID NO. Amino acid sequence CDRH.sub.1 109 GFTFRSHW CDRH.sub.2 110 IKEDGYEK CDRH.sub.3 111 ARDLRVYSGRGFDP CDRL.sub.1 112 KLGDKY CDRL.sub.2 113 QDS CDRL.sub.2 114 VIYQDSKRP long CDRL.sub.3 115 QAWDSSTVV VH 116 EVQLVESGGGLVRPGGSLRLSCAASGFTFRSHWMSWVRQA PGKGLEWVANIKEDGYEKYYVDSVKGRFTISRDNAKNSLY LQMKSLRAEDTAVYYCARDLRVYSGRGFDPWGQGTLVTVS S VL 117 SYELTQPPSLSVSPGQTASITCSGDKLGDKYACWYQQKPG QSPVLVIYQDSKRPSGIPARFSGSNSGNTATLTISGTQAM DEADYYCQAWDSSTVVFGGGTKLTVL ZKA25 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 118 ggattcacctttagaagtcattgg CDRH.sub.2 119 ataaaggaagatggatatgagaaa CDRH.sub.3 120 gcgagagatttgagggtatatagtgggagaggtttcgacc cc CDRL.sub.1 121 aaattgggggataaatat CDRL.sub.2 122 caagatagc CDRL.sub.2 123 gtcatctatcaagatagcaagcggccc long CDRL.sub.3 124 caggcgtgggacagcagcactgtggta VH 125 gaggtgcagttggtggagtctgggggaggcttggtccggc ctggggggtccctgagactctcctgtgcagcctctggatt cacctttagaagtcattggatgagttgggtccgccaggct ccagggaaggggctggagtgggtggccaacataaaggaag atggatatgagaaatactatgtggactctgtgaagggccg attcaccatctccagagacaacgccaagaactcactgtat ctgcaaatgaagagcctgagagccgaggacacggccgtgt attactgtgcgagagatttgagggtatatagtgggagagg tttcgacccctggggccagggaaccctggtcaccgtctcc tcag VL 126 tcctatgagctgactcagccaccctcactgtccgtgtccc caggacagacagccagcatcacctgctctggagataaatt gggggataaatatgcttgctggtatcagcagaagccaggc cagtcccctgtgttggtcatctatcaagatagcaagcggc cctcagggatccctgcgcgattctctggctccaactctgg gaacacagccactctgaccatcagcgggacccaggctatg gatgaggctgactattactgtcaggcgtgggacagcagca ctgtggtattcggtggagggaccaagctgaccgtcctag ZKA35 SEQ ID NO. Amino acid sequence CDRH.sub.1 127 GGSISTGGYY CDRH.sub.2 128 IYYSGNT CDRH.sub.3 129 AKGGGRERPFDY CDRL.sub.1 130 SSNIGRNY CDRL.sub.2 131 RNN CDRL.sub.2 132 LIYRNNQRP long CDRL.sub.3 133 VAWDDSRSGFVV VH 134 QVQLQESGPGLVKPSQTLSLTCTVSGGSISTGGYYWSWIR QHPGKGLEWIGYIYYSGNTYYNPSLKSRVTISVDTSKKQF SLKLSSVTAADTAVYYCAKGGGRERPFDYWGQGTLVTVSS VL 135 QSVLTQPPSASGTPGQRVTISCSGSSSNIGRNYVDWYQQL PGTAPKLLIYRNNQRPSGVPERFSGSKSGTSASLAISGLR SEDEADYYCVAWDDSRSGFVVFGGGTKVTVL ZKA35 SEQ ID NO. Nucleic acid sequence CDRH.sub.1 136 ggtggctccatcagcactggtggttactac CDRH.sub.2 137 atctattacagtgggaacacc CDRH.sub.3 138 gcgaaaggaggagggagggagcgaccctttgactac CDRL.sub.1 139 agctccaacatcggaagaaattat CDRL.sub.2 140 aggaataat CDRL.sub.2 141 ctcatctataggaataatcagcggccc long CDRL.sub.3 142 gtagcatgggatgacagccggagtggttttgtggta VH 143 caggtgcagctgcaggagtcgggcccaggactggtgaagc cttcacagaccctgtccctcacctgcactgtctctggtgg ctccatcagcactggtggttactactggagctggatccgc cagcacccagggaagggcctggagtggattggttacatct attacagtgggaacacctactacaacccgtccctcaagag tcgagttaccatatcagttgacacctctaagaagcagttc tccctgaagctgagctctgtgactgccgcggacacggccg tgtattactgtgcgaaaggaggagggagggagcgaccctt tgactactggggccagggaaccctggtcaccgtctcctca g VL 144 cagtctgtgctgactcagccaccctcagcgtctgggaccc ccgggcagagggtcaccatctcttgttctggaagcagctc caacatcggaagaaattatgtagactggtaccagcaactc ccaggaacggcccccaaactcctcatctataggaataatc agcggccctcaggggtccctgagcgattctctggctccaa gtctggcacctcagcctccctggccatcagtgggctccgg tccgaggatgaggctgattattactgtgtagcatgggatg acagccggagtggttttgtggtattcggcggagggaccaa ggtgaccgtcctag Constant regions SEQ ID NO. Sequence IgG.sub.1 145 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS CH.sub.1-CH.sub.2- WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT CH.sub.3 aa YICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK IgG.sub.1 146 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS CH.sub.1-CH.sub.2- WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT CH.sub.3 LALA YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGG aa PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK IgG 147 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ CK aa WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYE KHKVYACEVTHQGLSSPVTKSFNRGEC IgG 148 GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV CL aa TVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLT PEQWKSHRSYSCQVTHEGSTVEKTVAPTECS IgG.sub.1 149 gcgtcgaccaagggcccatcggtcttccccctggcaccct CH.sub.1-CH.sub.2- cctccaagagcacctctgggggcacagcggccctgggctg CH.sub.3 nucl cctggtcaaggactacttccccgaacctgtgacggtctcg tggaactcaggcgccctgaccagcggcgtgcacaccttcc cggctgtcctacagtcctcaggactctactccctcagcag cgtggtgaccgtgccctccagcagcttgggcacccagacc tacatctgcaacgtgaatcacaagcccagcaacaccaagg tggacaagagagttgagcccaaatcttgtgacaaaactca cacatgcccaccgtgcccagcacctgaactcctgggggga ccgtcagtcttcctcttccccccaaaacccaaggacaccc tcatgatctcccggacccctgaggtcacatgcgtggtggt ggacgtgagccacgaAgaCcctgaggtcaagttcaactgg tacgtggacggcgtggaggtgcataatgccaagacaaagc cgcgggaggagcagtacaacagcacgtaccgtgtggtcag cgtcctcaccgtcctgcaccaggactggctgaatggcaag gagtacaagtgcaaggtctccaacaaagccctcccagccc ccatcgagaaaaccatctccaaagccaaagggcagccccg agaaccacaggtgtacaccctgcccccatcccgggaggag atgaccaagaaccaggtcagcctgacctgcctggtcaaag gcttctatcccagcgacatcgccgtggagtgggagagcaa tgggcagccggagaacaactacaagaccacgcctcccgtg ctggactccgacggctccttcttcctctatagcaagctca ccgtggacaagagcaggtggcagcaggggaacgtcttctc atgctccgtgatgcatgaggctctgcacaaccactacacg cagaagagcctctccctgtccccgggtaaa IgG.sub.1 150 gcgtcgaccaagggcccatcggtcttccccctggcaccct CH.sub.1-CH.sub.2- cctccaagagcacctctgggggcacagcggccctgggctg CH.sub.3 LALA cctggtcaaggactacttccccgaacctgtgacggtctcg nucl tggaactcaggcgccctgaccagcggcgtgcacaccttcc cggctgtcctacagtcctcaggactctactccctcagcag cgtggtgaccgtgccctccagcagcttgggcacccagacc tacatctgcaacgtgaatcacaagcccagcaacaccaagg tggacaagagagttgagcccaaatcttgtgacaaaactca cacatgcccaccgtgcccagcacctgaaGCCGCGggggga ccgtcagtcttcctcttccccccaaaacccaaggacaccc tcatgatctcccggacccctgaggtcacatgcgtggtggt ggacgtgagccacgaagaccctgaggtcaagttcaactgg tacgtggacggcgtggaggtgcataatgccaagacaaagc cgcgggaggagcagtacaacagcacgtaccgtgtggtcag cgtcctcaccgtcctgcaccaggactggctgaatggcaag gagtacaagtgcaaggtctccaacaaagccctcccagccc ccatcgagaaaaccatctccaaagccaaagggcagccccg agaaccacaggtgtacaccctgcccccatcccgggaggag atgaccaagaaccaggtcagcctgacctgcctggtcaaag gcttctatcccagcgacatcgccgtggagtgggagagcaa tgggcagccggagaacaactacaagaccacgcctcccgtg ctggactccgacggctccttcttcctctatagcaagctca ccgtggacaagagcaggtggcagcaggggaacgtcttctc atgctccgtgatgcatgaggctctgcacaaccactacacg cagaagagcctctccctgtccccgggtaaa IgG CK 151 cgTacGgtggctgcaccatctgtcttcatcttcccgccat nucl ctgatgagcagttgaaatctggaactgcctctgttgtgtg cctgctgaataacttctatcccagagaggccaaagtacag tggaaggtggataacgccctccaatcgggtaactcccagg agagtgtcacagagcaggacagcaaggacagcacctacag cctcagcagcaccctgacgctgagcaaagcagactacgag aaacacaaagtctacgcctgcgaagtcacccatcagggcc tgagctcgcccgtcacaaagagcttcaacaggggagagtg t IgG CL 152 ggtcagcccaaggctgccccctcggtcactctgttcccgc nucl cctcctctgaggagcttcaagccaacaaggccacactggt gtgtctcataagtgacttctacccgggagccgtgacagtg gcttggaaagcagatagcagccccgtcaaggcgggagtgg agaccaccacaccctccaaacaaagcaacaacaagtacgc ggccagcagctatctgagcctgacgcctgagcagtggaag tcccacagaagctacagctgccaggtcacgcatgaaggga gcaccgtggagaagacagtggcccctacagaatgttca SEQ ID NO. Amino acid sequence ZKA10 CDRH.sub.1 153 GFTFSDSY CDRH.sub.2 154 ISSSSPFT CDRH.sub.3 155 ARGLVRDGYKWLYFFDY VH 156 QVQLVESGGGLVEPRGSLRLSCAASGFTFSDSYMSWIRQA PGKGLEWISYISSSSPFTNYADSVKGRFTISRDNAKNSLY LQMNSLRAEDTAVYYCARGLVRDGYKWLYFFDYWGQGTLV TVSS ZKA18 CDRH.sub.1 157 GFTFSSYG CDRH.sub.2 158 IWYDGSNK CDRH.sub.3 159 ARDDSGYSEPFDY VH 160 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQA PGKGLEWVAVIWYDGSNKYYADSVKGRFTITRDNSKNTLY LQMNSLRPEDTAVYYCARDDSGYSEPFDYWGQGTLVTVSS ZKA28 CDRH.sub.1 161 GFTVSRNY CDRH.sub.2 162 IYSGGST CDRH.sub.3 163 ARWINDAFDI VH 164 EVQLVESGGGLIQPGGSLRLSCAASGFTVSRNYMSWVRQA PGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCARWINDAFDIWGQGTMVTVSS ZKA29 CDRH.sub.1 165 GFTFSRYS CDRH.sub.2 166 ISPRSTTI CDRH.sub.3 167 AREDCTNGVCYRVDY VH 168 EVQLVESGGGLVQPGGSLRLSCVVSGFTFSRYSMNWVRQA PGKGLEWVSYISPRSTTIYYADSVEGRFTVSRDNAKNSLY LQLNSLRAEDTAVYYCAREDCTNGVCYRVDYWGQGTLVTV SS ZKA33 CDRH.sub.1 169 GFTFSRNW CDRH.sub.2 170 IKEDGNEK CDRH.sub.3 171 ARPFHQGGYAYGLAY VH 172 EVQLVESGGGLVQPGGSLRLSCAASGFTFSRNWMTWVRQA PGKGLEWVANIKEDGNEKYYVDSVKGRFTISRDNAKNSLY LQMNSLRAEDTAVYYCARPFHQGGYAYGLAYWGQGTLVTV SS ZKA39 CDRH.sub.1 173 GFTFSTYS CDRH.sub.2 174 ISPSSSTI CDRH.sub.3 175 AREYCSGGSCYLLDY VH 176 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYSMNWVRQA PGKGLEWVSYISPSSSTIYYPDSLKGRFTISRDNAKNSLY LQMDSLRAEDTAQYYCAREYCSGGSCYLLDYWGQGTLVTV SS ZKA43 CDRH.sub.1 177 GGSITSYY CDRH.sub.2 178 SHYSGST CDRH.sub.3 179 ARGIYSGKNWFDP VH 180 QVQLQESGPGLVKPSETLSLTCTVYGGSITSYYWTWIRQP PGKGLEWIGYSHYSGSTNYNPSLKSRVTISIDTSKSQFSL NLNSVTAADTAVYYCARGIYSGKNWFDPWGQGTLVTVSS ZKA44 CDRH.sub.1 181 GFTVSTSY CDRH.sub.2 182 IYSSGST CDRH.sub.3 183 ARVSLGGLDP VH 184 EVQLVESGGGLIQPGGSLRLSCVASGFTVSTSYMNWVRQA PGKGLEWVSVIYSSGSTYYADSVKGRFTISRNTSKNTLYL QMNSLRAEDTAVYYCARVSLGGLDPWGQGTPVTVSS ZKA46 CDRH.sub.1 185 GFSLSNGRMG CDRH.sub.2 186 IFSNDEK CDRH.sub.3 187 ARVEFRAGNYLDS VH 188 QVTLKESGPVLVKPTETLTLTCTVSGFSLSNGRMGVSWIR QPPGKALEWLAHIFSNDEKYYSTSLKNRLTISKDTSKSQV VLTMTNMDPVDTATYYCARVEFRAGNYLDSWGQGTLVTVS S ZKA50 CDRH.sub.1 189 GYTFTNSW CDRH.sub.2 190 IYPGDSDT CDRH.sub.3 191 ARQPFFDY VH 192 EVQLVQSGAQVKKPGESLKISCKASGYTFTNSWIGWVRQM PGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAY LQWSSLKASDTAMYYCARQPFFDYWGQGTLVTVSS ZKA54 CDRH.sub.1 193 GYTFTGYY CDRH.sub.2 194 INANSGGT CDRH.sub.3 195 AHSDIVVVPSDDYYALDV VH 196 QVQLVQSGAEVKKPGASVKVSCKTSGYTFTGYYMHWVRQA PGQGLEWMGWINANSGGTNFAQRFQGRVTMTWDTSISTAY MELSRLRSDDTAVYYCAHSDIVVVPSDDYYALDVWGQGTT VTVSS ZKB18 CDRH.sub.1 197 GYSFTSYW CDRH.sub.2 198 IYPGDSDT CDRH.sub.3 199 ARQTPGDY VH 200 EVQLVQSGAEVKKPGESLKISCKTFGYSFTSYWIGWVRQM PGKGLEWMGMIYPGDSDTRYSPSFQGQVTISADMSISTAY LQWSSLKASDTAMYYCARQTPGDYWGQGTLVTVSS ZKB20 CDRH.sub.1 201 GYFFTRYV CDRH.sub.2 202 INTDNGST CDRH.sub.3 203 ARGTGRDGYNSFFAN VH 204 QVQLVQSGAEVKKPGASVRVSCKASGYFFTRYVILWVRQA PGQRPEWMGWINTDNGSTRYSQKFQGRVTITKDTSATTAY MDLSSLKSDDTAVYYCARGTGRDGYNSFFANWGQGTLVTV SP ZKB21 CDRH.sub.1 205 GYTFTGYS CDRH.sub.2 206 IDTNSGDT CDRH.sub.3 207 ARDRERHPFSY VH 208 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYSIHWVRQA PGQGLAWMGRIDTNSGDTNYAERFQGRVTMTRDTSISTAY MEVRRLRSDDTAVYYCARDRERHPFSYWGQGTLVTVSS ZKB23 CDRH.sub.1 209 GGSISSGDYS CDRH.sub.2 210 ITHSGTT CDRH.sub.3 211 ARHFGWFDP VH 212 QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGDYSWSWIR QPPGKGLEWIGYITHSGTTYFNPSLKSRVTISVDRSRNQF SLKVTSVTAADTAVYYCARHFGWFDPWGQGTLVTVSS ZKC29 CDRH.sub.1 213 GGSISSGEYF CDRH.sub.2 214 IHNRGNT CDRH.sub.3 215 ARGGGDLVVVPDSIWDYYGMDV VH 216 QVQLQESGPGLVRPSQTLSLTCTVSGGSISSGEYFWTWIR QHPKKGLEWIGYIHNRGNTYYNPSLKSRLSISLDTSKNHL SLRLSSVTAADTAVYYCARGGGDINVVPDSIWDYYGMDVW GQGTTVTVSS ZKC31 CDRH.sub.1 217 GGSISSGGYH CDRH.sub.2 218 IYYSGST CDRH.sub.3 219 ARDRSEPGEYHYYYYAMDV VH 220 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYHWSWIR QHPGKGLEWIGYIYYSGSTYYNPSLKRRVTISVDTSKNQF SLKLSSVSAADTAVYYCARDRSEPGEYHYYYYAMDVWGQG TTVTVSS ZKC32 CDRH.sub.1 221 GFTVSSNY CDRH.sub.2 222 IYSSGST CDRH.sub.3 223 ARGKKGNAFDI VH 224 EVQLVESGGDLIQPGGSLRLSCAASGFTVSSNYMSWVRQA PGKGLEWVSVIYSSGSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAGDTAVYYCARGKKGNAFDIWGQGTVVTVSS ZKC33 CDRH.sub.1 225 GDSISSRTFS CDRH.sub.2 226 IYYSGST CDRH.sub.3 227 ARRNAEFFSFWSYYGMDV VH 228 QVQLQESGPGLVKPSQTLSLTCTVSGDSISSRTFSWSWIR QPPGKGLEWVGHIYYSGSTDYNPSLKSRISISIDTSKNQF SLKLSSVTAADTAVYYCARRNAEFFSFWSYYGMDVWGHGT AVIVSS ZKC34 CDRH.sub.1 229 GGSINSGGYY CDRH.sub.2 230 ILHSGNT CDRH.sub.3 231 ARAGDYYSGYVPPEY VH 232 QVQLQESGPGLVKPSQTLSLTCAVSGGSINSGGYYWSWVR QHPGKGLEWIGYILHSGNTNYNPSLKSRVNIFVDTSENQF SLKLRSVTAADTAIYFCARAGDYYSGYVPPEYWGPGTLVT VSS ZKD25 CDRH.sub.1 233 GFTVSSNY CDRH.sub.2 234 IYSGGST CDRH.sub.3 235 ARFGGNPSFDY VH 236 EVQLVESGGGLVQPGGSLRLSCAASGFTVSSNYMSWVRQA PGKGLEWVSVIYSGGSTYYANSVKGRFTISRDKSKNTLYL QMNNLRAEDTAVYFCARFGGNPSFDYWGQGTLVTVSS ZKA3 CDRH.sub.1 237 GFIFSNYA CDRH.sub.2 238 IGGKGDSI CDRH.sub.3 239 VKDLAVLESDRLEVDQ VH 240 EVQLAESGGGLVQPGGSLRLSCSGSGFIFSNYAMVWARQA PGKGLEYVSGIGGKGDSIYHIDSVKGRFTISRDNSKRTVY LQMSRLRTEDTAVYYCVKDLAVLESDRLEVDQWGQGTLVI VSA ZKA4 CDRH.sub.1 241 GFTFSSYV CDRH.sub.2 242 TSYDGSNK CDRH.sub.3 243 ARGPVPYWSGESYSGAYFDF VH 244 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYVMHWVRQA PGKGLEWVTVTSYDGSNKYYADSVKGRFTISRDNAKNTLY LQMNSLRGEDTAIYYCARGPVPYWSGESYSGAYFDFWGQG ILVTVSS ZKA5 CDRH.sub.1 245 GFTFSNYY CDRH.sub.2 246 MSSSETIK CDRH.sub.3 247 ARSGIETVAGSIDYYGMDV VH 248 QVQLVESGGGLVKPGGSLRLSCAGSGFTFSNYYMTWIRQA PGKGLELVSYMSSSETIKYYADSVKGRFTISRDNAKNSLY LQMNSLRADDTARYYCARSGIETVAGSIDYYGMDVWGHGT PVTVSS ZKA6 CDRH.sub.1 249 DFTVSNYA CDRH.sub.2 250 VSYDGSNK CDRH.sub.3 251 ATGVTMFQGAQTNAEYLHY VH 252 QVHLVESGGGVVQPGRSLRLSCEASDFTVSNYAMHWVRQA PGKGLEWVAVVSYDGSNKYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTALYYCATGVTMFQGAQTNAEYLHYWGQGS LVTISS ZKA7 CDRH.sub.1 253 GFTFSRYG CDRH.sub.2 254 VSGDGSST CDRH.sub.3 255 VKDFWSGDQSLESDF VH 256 EVQLVESGGGLVQPGGSLRLSCSASGFTFSRYGMVWARQA PGKGLEYLSGVSGDGSSTYYANSVKGRFTISRDNSKNTLY LHMSRLRDEDTAMYYCVKDFWSGDQSLESDFWGQGALVTV SS ZKA8 CDRH.sub.1 257 GFTFSAHA CDRH.sub.2 258 ISRNEDYT CDRH.sub.3 259 VKDFGTSPQTDF VH 260 DERLVESGGGLVQPGGSLRLVCSASGFTFSAHAMHWVRQP PGKGLEYVSTISRNEDYTYYADSVKGRFTISRDNSKNSLY LQMRRLRPEDTAIYYCVKDFGTSPQTDFWGQGTLVAVSS ZKA76 CDRH.sub.1 261 GFTFSTYF CDRH.sub.2 262 ISSTGSYK CDRH.sub.3 263 ARPFHSEYTYGLDAFDI VH 264 EVQLVESGGGLVKPGGSLRLSCAASGFTFSTYFMHWVRQA PGKGLEWVASISSTGSYKFYADSVKGRFTISRDNTKNSLF LQMNSLRAEDTAVFYCARPFHSEYTYGLDAFDIWGQGTML TVSS ZKA117 CDRH.sub.1 265 GGSIRRTNSY CDRH.sub.2 266 ISYSGST CDRH.sub.3 267 ARLNDGSTVTTSSYFDY VH 268 QLQLQESGPGLVKPSETLSLTCTVSGGSIRRTNSYWGWIR QTTGKGLQWIGSISYSGSTFYNPSLKSRVTISLDTSKDHF SLELSSVTAADTAIYYCARLNDGSTVTTSSYFDYWGQGTL VTVSS ZKB27 CDRH.sub.1 269 GYSFTSSW CDRH.sub.2 270 IDPSDSYT CDRH.sub.3 271 ARHDYSVSENGMDV VH 272 EVQLVQSGAEVKKPGESLRISCKASGYSFTSSWINWVRQM PGKGLEWMGRIDPSDSYTTYNPSFQGHVTISVDKSIGTAY LQWNSLRASDTAMYYCARHDYSVSENGMDVWGQGTTVTVS S ZKB29 CDRH.sub.1 273 GFTFSSYT CDRH.sub.2 274 ISYDGSHK CDRH.sub.3 275 ARRSYSISCFDY VH 276 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQA PGKGLEWVAVISYDGSHKFYADSVKGRFTISRDNSKDTLY LQMNSLRAEDTALYYCARRSYSISCFDYWGQGTLVTISS ZKB34 CDRH.sub.1 277 GFTFSRSG CDRH.sub.2 278 VSYDGSNK CDRH.sub.3 279 AKDLTMVRGVHYYYYVMDV VH 280 QVQLVESGGGVVQPGRSLRLSCAASGFTFSRSGMHWVRQA PGKGLEWVAVVSYDGSNKYYSDSVKGRFTISRDNSKNTLY LQMNSLRVEDTAVYYCAKDLTMVRGVHYYYYVMDVWGQGT TVTVSS ZKB39 CDRH.sub.1 281 GYTFDDYY CDRH.sub.2 282 INPHRGGT CDRH.sub.3 283 VRDQYCDGGNCYGIHQPHYGMDV VH 284 QVQLVQSGAEVKKPGASLKVSCKASGYTFDDYYIHWVRQA PGQGLEWLGRINPHRGGTNYAQKFQGRVIMTLDMSISTTY MELRRITSDDAAVYYCVRDQYCDGGNCYGIHQPHYGMDVW GQGTTVTVSS ZKB46 CDRH.sub.1 285 GYSFTSYW CDRH.sub.2 286 IDPSDSYT CDRH.sub.3 287 ARREYSSSSGQEDWFDP VH 288 EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQM PGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAY LQWSSLKASDTAMYYCARREYSSSSGQEDWFDPWGQGTLV TVSS ZKB53 CDRH.sub.1 289 GFTFSSYA CDRH.sub.2 290 ISYDGSNR CDRH.sub.3 291 ARHVEQLPSSGYFQH VH 292 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQT PGKGLEWVTVISYDGSNRYYADSVKGRFTISRDNSKNTLY LQMNSLRSEDTAVYYCARHVEQLPSSGYFQHWGQGTLVTV SS ZKC26 CDRH.sub.1 293 GFIFSDFY CDRH.sub.2 294 IGHDGSYI CDRH.sub.3 295 ARAHGGFRH VH 296 QVQVVESGGGLVKPGGSLRLSCAASGFIFSDFYMSWMRQA PGKGLEWVAYIGHDGSYILYADSVKGRFTISRDNAKNSLF LRMNSLRVEDTAVYYCARAHGGFRHWGQGTVVAVSP ZKD5 CDRH.sub.1 297 GFTFTSYG CDRH.sub.2 298 ISYDGSNK CDRH.sub.3 299 ARDRDHYDLWNAYTFDY VH 300 QVQLVESGGGVVQPGRSLRLSCAASGFTFTSYGMHWVRQT PGKGLDWVAVISYDGSNKYYADSVKGRFTISRDNSKDTLY LQMNSLRAADTALYYCARDRDHYDLWNAYTFDYWGQGTLV TVSS ZKDI CDRH.sub.1 301 GFTFSNYA CDRH.sub.2 302 ISYDVSDK CDRH.sub.3 303 AGGPLGVVVIKPSNAEHFHH VH 304 QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMHWVRQA PGKGLEWVAVISYDVSDKYYADSVKGRFTISRDNSKNTLF LQMNSLRAEDTAAYYCAGGPLGVVVIKPSNAEHFHHWGQG TLVTVSS ZKD8 CDRH.sub.1 305 GFTFINYA CDRH.sub.2 306 ISYDGSNK CDRH.sub.3 307 ATDADAYGDSGANFHY VH 308 QVQLVESGGGVVQPGKSLRLSCAASGFTFINYAIHWVRQA PGKGLEWVAVISYDGSNKFYTDSVKGRFTISRDNSKNTLY LQMNSLRADDTAVYYCATDADAYGDSGANFHYWGQGTLVT VSS ZKD15 CDRH.sub.1 309 DASISSGGFS CDRH.sub.2 310 IYSSGDT CDRH.sub.3 311 ARAHTPTSKFYYYYAMDV VH 312 QLQLQESGSGLVKPSQTLSLTCTVSDASISSGGFSWSWIR QPLGKGLEWLGYIYSSGDTFYNPSLQGRVTMSVDIFRSQF SLKLTSVTAADTAMYYCARAHTPTSKFYYYYAMDVWGQGT TVTVSS ZKD16 CDRH.sub.1 313 GFTFSDHF CDRH.sub.2 314 SRNKPNSYTT CDRH.sub.3 315 AKVGGCYGGDCHVENDY VH 316 EVQLVESGGDLVQPGGSLRLSCVASGFTFSDHFMDWVRQA PGKGLEWVGRSRNKPNSYTTEYAASVKGRFSISRDDSKKA LYLQMNSLQTEDTAVYYCAKVGGCYGGDCHVENDYWGQGT LVTVSS ZKD17 CDRH.sub.1 317 GFIFSDYA CDRH.sub.2 318 ISYDGSSR CDRH.sub.3 319 ARGYCSSGTCFSTNAEYFHP VH 320 QVQMVESGGGVVQPGTSLRLSCATSGFIFSDYAMHWVRQA PGKGLEWVAVISYDGSSRLYADSVKGRFTVSRDNSKNTLY LQMHSLRAGDTAVYYCARGYCSSGTCFSTNAEYFHPWGQG TLATISS ZKD20 CDRH.sub.1 321 GFTFSDHF CDRH.sub.2 322 SRNKPNSYTT CDRH.sub.3 323 ARVGGCNGGDCHVENDY VH 324 EVQLVESGGGLVQPGGSLRLSCVASGFTFSDHFMDWVRQA PGKGLEWVGRSRNKPNSYTTEYAASVKGRFTISRDDSKNS LYLQMNSLQTEDTAVYYCARVGGCNGGDCHVENDYWGQGT LVTVSS ZKA134 CDRH.sub.1 325 GGTFSAYA CDRH.sub.2 326 IIPFFGTA CDRH.sub.3 327 ARSDIVSTTRGYHHYGMDV VH 328 QVHLVQSGAEVKKPGSSVNVSCKASGGTFSAYAISWVRQA PGQGLEWMGGIIPFFGTAYYAQKFKGRVTVTADKSTSTVY MEMTSLRSEDTAVYYCARSDIVSTTRGYHHYGMDVWGQGT TVTVSS ZKA246 CDRH.sub.1 329 GYTFSDYY CDRH.sub.2 330 INPYSGGT CDRH.sub.3 331 ARGFTMISDREFDP VH 332 QVQLVQSGAEVKRPGASVKVSCKASGYTFSDYYMHWVRQA PGQGLEWMGRINPYSGGTNYAQKFHGRVTVTRDTSISTVY MELRGLRSDDTAVYYCARGFTMISDREFDPWGQGTLVTVS S ZKA256 CDRH.sub.1 333 GFTFSTYW CDRH.sub.2 334 IKQDGSEK CDRH.sub.3 335 ARDPGYDDFWSGSYSGSFDI VH 336 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMTWVRQA PGKGLEWVANIKQDGSEKYYVDSVKGRFTISRDNTKNSLY LQVNSLRAEDTAIYYCARDPGYDDFWSGSYSGSFDIWGQG TMVTVSS ZKB42 CDRH.sub.1 337 GFTFNNYG CDRH.sub.2 338 ISYDGNKK CDRH.sub.3 339 VKYGERINGYSDPFDH VH 340 QVQVVESGGGVVQPGRSLRLFCAASGFTFNNYGMHWVRQA PGKGLEWVALISYDGNKKYYADSVKGRFSISRDNSKNTLY LQMNRLRSGDTAVYHCVKYGERINGYSDPFDHWGQGTLVT VSS ZKB85 CDRH.sub.1 341 GYTFTTYA CDRH.sub.2 342 INTNTGNP CDRH.sub.3 343 ARVIVPYAFDI VH 344 QVQLVQSGSELKKPGASVKVSCKASGYTFTTYAMNWVRQA PGQGPEWVGWINTNTGNPTYAQGFTGRFVLSLDTSVSTAF LQISSLKAEDTAVYYCARVIVPYAFDIWGQGTMVTVSS ZKB47 CDRH.sub.1 345 GYTFTNYY CDRH.sub.2 346 INPSGGPT CDRH.sub.3 347 ARDQYGGYARYGMDV VH 348 QVQLVQSGAEVKKPGASVKVSCQASGYTFTNYYMHWVRQA PGQGLEWMGIINPSGGPTSYAQKFQGRVTMTTDTSTSTVY MELSSLRSEDTAVYYCARDQYGGYARYGMDVWGQGTTVTV SS ZKC6 CDRH.sub.1 349 GYTFTGYY CDRH.sub.2 350 INPNSGGT CDRH.sub.3 351 ARVSDWGFAFDI VH 352 QVQLVQSGTEVKKPGASVKVSCKASGYTFTGYYMHWVRQA PGQGLEWMGRINPNSGGTNYAQKFQGRVTMTRDTSISTAY MELSGLRSDDTAVYYCARVSDWGFAFDIWGQGTMVTVSQ ZKA160 CDRH.sub.1 353 GGSITSYS CDRH.sub.2 354 IFYSGST CDRH.sub.3 355 ARDQTMPVWVGGMDV VH 356 QVQLQESGPGLVKPSETLSLTCTVSGGSITSYSWSWIRQP PGKGLEWIGYIFYSGSTDYNPSLKSRVTISVDTSKDQFSL RLRSVTAADTAVYYCARDQTMPVWVGGMDVWGQGTTVTVS S ZKA172 CDRH.sub.1 357 GYIFTRYW CDRH.sub.2 358 IDPSDSYT CDRH.sub.3 359 ARQETAREDGMAV VH 360 EVQLVQSGAEVKKPGKSLRISCKGSGYIFTRYWISWVRQM PGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAY LQWSSLKASDTAMYYCARQETAREDGMAVWGQGTTVIVSS ZKA174 CDRH.sub.1 361 GGSMSNSYYH CDRH.sub.2 362 IYYSGST CDRH.sub.3 363 ARNPVFNPLTLTHDAFDI VH 364 QLQLQESGPGLVKPSETLSLTCTVSGGSMSNSYYHWGWIR QPPGKGLEWIGSIYYSGSTYYNPSLKSRVTISVDTSKNQF SLKLNSVTAADTAVYYCARNPVFNPLTLTHDAFDIWGQGT MVTVSS ZKA189 CDRH.sub.1 365 GFTFSSYA CDRH.sub.2 366 ISGSGDNT CDRH.sub.3 367 AKWPYYDFWSGSESYFDP VH 368 GVQLLESGGALVQPGKSLRLSCAASGFTFSSYALTWVRQA PGKGLQWVSAISGSGDNTYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAKWPYYDFWSGSESYFDPWGQGTL VTVSS ZKA195 CDRH.sub.1 369 GYNFPSYW CDRH.sub.2 370 IDPSDSYT CDRH.sub.3 371 ARADCRSTSCYLVFE VH 372 EVQLVQSGAEVKKPGESLRISCKDSGYNFPSYWIHWVRQM PGKGLEWMGTIDPSDSYTNYSPSFQGHVTISADKSISTAY LQWSSLKASDTAMYYCARADCRSTSCYLVFEGQGTLVTVS S ZKA215 CDRH.sub.1 373 GYTFTSYW CDRH.sub.2 374 IDPSDSHT CDRH.sub.3 375 ARHALPNYFDS VH 376 EVQLVQSGAEVKKPGESLRISCKGSGYTFTSYWISWVRQM PGKGLEWMGRIDPSDSHTDYSPSFQGHVTISADKSISAAY LQWSSLKASDTAMYYCARHALPNYFDSWGQGTLVTVSS ZKA218 CDRH.sub.1 377 GFPFSSYW CDRH.sub.2 378 INSDGRNT CDRH.sub.3 379 ARGGYDYDSSGCFDY VH 380 EVQLVESGGGLVQPGGSLRLSCAASGFPFSSYWMHWVRQA PGKGLVWVSRINSDGRNTNYADSVKGRFTISRDNAENTVY LQMNSLRAEDTAVYYCARGGYDYDSSGCFDYWGQGTLVTV SS ZKB75 CDRH.sub.1 381 GFTFSNYA CDRH.sub.2 382 ISGTGGST CDRH.sub.3 383 AKDSASRGGYCSGGVCYLNPGHHDY VH 384 EVQVLESGGGLLQPGGSLRLSCAASGFTFSNYAMSWVRQA PGKGLEWVSTISGTGGSTYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAKDSASRGGYCSGGVCYLNPGHHD YWGQGTLVTVSS ZKB83 CDRH.sub.1 385 GYSFTNYW CDRH.sub.2 386 IDPSDSYT CDRH.sub.3 387 ARLRGSLYCSGGRCYSVPGETPNWFDP VH 388 EVQLVQSGAEVKKPGESLRISCKGSGYSFTNYWITWVRQM PGKGLEWMGSIDPSDSYTNYSPSFQGHVTISADWSINTAY LQWSSLKASDTAKYYCARLRGSLYCSGGRCYSVPGETPNW FDPWGQGTLVTVSS ZKC3 CDRH.sub.1 389 GGSITSYY CDRH.sub.2 390 IYYSGST CDRH.sub.3 391 ARVGGAPYYYYGMDV VH 392 QVQLQESGPGLVKPSETLSLTCTVSGGSITSYYWSWIRQP PGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSL KLSSVTAADTAVYYCARVGGAPYYYYGMDVWGQGTTVTVS S ZKC18 CDRH.sub.1 393 GFTFGDYA CDRH.sub.2 394 IRSKAYGGTT CDRH.sub.3 395 SRDHTGTTYAFDI VH 396 EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWFRQA PGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSI AYLQMNSLKTEDTAVYYCSRDHTGTTYAFDIWGQGTMVTV SQ ZKD1 CDRH.sub.1 397 GFTFSSYG CDRH.sub.2 398 IWYDGSNK CDRH.sub.3 399 ARDRRGYGDYVGYYYGMDV VH 400 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQA PGKGLEWVAVIWYDGSNKYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCARDRRGYGDYVGYYYGMDVWGQGT TVTVSS Name SEQ ID NO. Amino acid sequence ZIKV 401 TAAFTFTKXPAEXXHGTVTVEXQYXGXDGPCKXPXQMAVD EDIII XQTLTPVGRLITANPVITEXTENSKMMLELDPPFGDSYIV generic IGXGXKKITHHWHRS ZIKV 402 TAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVD H/PF/ MQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIV 2013 IGVGEKKITHHWHRS EDIII ZIKV-NS.sub.1 403 TGGAGTTCAACTGACGGTCG forward primer ZIKV- 404 TACCCCGAACCCATGATCCT NS1- reverse primer Gapdh- 405 GGCAAGTTCAAAGGCACAGTC forward primer Gapdh- 406 CACCAGCATCACCCCATTT reverse primer ZIKV 407 X.sub.1GX.sub.2X.sub.3YSLCTAAFTFTKX.sub.4PAEX.sub.5X.sub.6HGTVTVEX.sub.7QY EDIII X.sub.8GX.sub.9DGPCKX.sub.10PX.sub.11QMAVDX.sub.12QTLTPVGRLITANP generic VITEX.sub.13TX.sub.14NSKMMLELDPPFGDSYIVIGX.sub.15GX.sub.16 X.sub.17KITHHWHRSG wherein X.sub.1 may be any (naturally occurring) amino acid, preferably K, A, or E; X.sub.2 may be any (naturally occurring) amino acid, preferably V, F, or L; X.sub.3 may be any (naturally occurring) amino acid, preferably S or F; X.sub.4 may be any (naturally occurring) amino acid, preferably I or V; X.sub.5 may be any (naturally occurring) amino acid, preferably T or V; X.sub.6 may be any (naturally occurring) amino acid, preferably L or D; X.sub.7 may be any (naturally occurring) amino acid, preferably V or G; X.sub.8 may be any (naturally occurring) amino acid, preferably A or G; X.sub.9 may be any (naturally occurring) amino acid except R, preferably T or A; X.sub.10 may be any (naturally occurring) amino acid, preferably V or I; X.sub.11 may be any (naturally occurring) amino acid, preferably A or V; X.sub.12 may be any (naturally occurring) amino acid, preferably M or T; X.sub.13 may be any (naturally occurring) amino acid, preferably S or G; X.sub.14 may be any (naturally occurring) amino acid, preferably E or K; X.sub.15 may be any (naturally occurring) amino acid, preferably V or I; X.sub.16 may be any (naturally occurring) amino acid, preferably E, A, K, or D; and X.sub.17 may be any (naturally occurring) amino acid, preferably E, A, or K, more preferably K or A * the sequences highlighted in bold are CDR regions (nucleotide or aa) and the underlined residues are mutated residues as compared to the “germline” sequence.