ENGINEERING THE PRODUCTION OF A CONFORMATIONAL VARIANT OF OCCIDIOFUNGIN THAT HAS ENHANCED INHIBITORY ACTIVITY AGAINST FUNGAL SPECIES

20220007652 · 2022-01-13

Assignee

Inventors

Cpc classification

International classification

Abstract

Occidiofungin is a cyclic nonribosomally synthesized antifungal peptide with submicromolar activity. This invention is directed to compositions enriched for particular occidiofungin diastereomers/conformers, methods of making compositions enriched for particular diastereomers/conformers and microorganisms suitable for producing enriched compositions of particular diastereomers/conformers. Methods of treating fungal infections or plants infected by fungi are also provided.

Claims

1-10. (canceled)

11. A method for promoting OcfN thioesterase activity in a bacterial strain of Burkholderia contaminans MS14 comprising a step of: contacting the bacterial strain of Burkholderia contaminans MS14 with a peptide containing more ASN1 than BHN1 to promote the OcfN thioesterase activity of the bacterial strain of Burkholderia contaminans MS14,

12. The method of claim 11, wherein the bacterial strain of Burkholderia contaminans MS14 is different from a wild-type bacterial strain of Burkholderia contaminans MS14.

13. The method of claim 12, wherein the bacterial strain of Burkholderia contaminans MS14 has an ocfN gene and the activity of ocfN gene in the bacterial strain of Burkholderia contaminans MS14 is promoted such that the ocfN gene in the bacterial strain of Burkholderia contaminans MS14 produces an increased OcfN thioesterase activity in comparison with the ocfN gene in a wild-type bacterial strain of Burkholderia contaminans MS14.

14. The method of claim 13, wherein the ocfN gene is expressed in a multicopy plasmid with a native promoter or any other promoter sequence.

15. The method of claim 13, wherein the ocfN gene is chromosomally integrated within a cell with additional copies of the ocfN gene using transposons.

16. The method of claim 13, wherein the bacterial strain of Burkholderia contaminans MS14 has two or more copies of the ocfN gene of the wild type bacterial strain Burkholderia contaminans MS14.

17. The method of claim 13, wherein the ocfN gene in the bacterial strain of Burkholderia contaminans MS14 has a promoter that increases expression of the ocfN gene compared with a native promoter of the ocfN gene in the wild-type bacterial strain Burkholderia contaminans MS14.

18. The method of claim 13, wherein the bacterial strain of Burkholderia contaminans MS14 produces more Asparagine 1 occidiofungin product than Beta-hydroxy asparagine 1 occidiofungin product by way of increased OcfN thioesterase activity of the bacterial strain of Burkholderia contaminans MS14.

19. The method of claim 13, wherein the bacterial strain of Burkholderia contaminans MS14 produces more Asparagine 1 occidiofungin product than Beta-hydroxy asparagine 1 occidiofungin product by way of reduced OcfD thioesterase activity.

20. The method of claim 13, wherein the bacterial strain of Burkholderia contaminans MS14 comprises an ocfD gene and activity of the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 is decreased such that the ocfD gene in the bacterial strain of Burkholderia contaminans MS14 has a reduced OcfD thioesterase activity.

21. The method of claim 20, wherein the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 has a point mutation of catalytic serine at position 2954 of SEQ ID NO:4 of the OcfD thioesterase of the wild-type bacterial strain Burkholderia contaminans MS14.

22. The method of claim 21, wherein the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 has an insertional mutation or a point mutation in the thioesterase motif of the OcfD thioesterase of the wild-type bacterial strain Burkholderia contaminans MS14 in addition to the point mutation of catalytic serine at position 2954 of SEQ ID NO:4 of the OcfD thioesterase of the wild-type bacterial strain Burkholderia contaminans MS14 to reduce its OcfD thioesterase activity.

23. The method of claim 20, wherein the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 has a deletion of catalytic serine at position 2954 of SEQ ID NO:4 of the OcfD thioesterase of the wild-type bacterial strain Burkholderia contaminans MS14 to reduce its OcfD thioesterase activity.

24. The method of claim 20, wherein the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 is truncated compared with the ocfD gene in the wild-type bacterial strain Burkholderia contaminans MS14 to reduce its OcfD thioesterase activity.

25. The method of claim 20, wherein a thioesterase motif in SEQ ID NO: 4 of an OcfD thioesterase of the wild-type bacterial strain Burkholderia contaminans MS14 is deleted in the bacterial strain of Burkholderia contaminans MS14 to reduce the OcfD thioesterase activity.

26. The method of claim 20, wherein the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 has a deletion of a segment of the OcfD gene encoding the catalytic serine at position 2954 of SEQ ID NO:4 of the OcfD thioesterase of the wild-type bacterial strain Burkholderia contaminans MS14 to reduce the OcfD thioesterase activity.

27. The method of claim 20, wherein the ocfD gene of the bacterial strain of Burkholderia contaminans MS14 has a frameshift compared with the ocfD gene in the wild-type bacterial strain Burkholderia contaminans MS14 to reduce the OcfD thioesterase activity.

28. A composition comprising an occidiofungin produced by the method of claim 11.

29. The composition of claim 28, further comprising a pharmaceutically or agriculturally acceptable excipient or carrier selected from ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.

30. A method for treating fungal infections in a subject comprising a step of administering the composition of claim 28 to the subject.

31. The method of claim 30, wherein the fungal infection is caused by at least one organism selected from the group consisting of Candida albicans LL, Candida albicans TE, Candida glabrata ATCC66032, Candida parapsilosis ATCC90018, and Candida tropicalis ATCC66029.

32. The method of claim 30, wherein the subject is a mammal or a plant.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0015] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication, with color drawing(s), will be provided by the Office upon request and payment of the necessary fee.

[0016] FIG. 1. Covalent structure of occidiofungin. R1 and R2 represent the locations where a hydroxyl or chlorine is added, respectively (R1, —H or —OH; R2, —H or —Cl).

[0017] FIGS. 2A-2C. RP-HPLC Chromatograms. FIG. 2A. Chromatogram of the final purification step of the wild-type occidiofungin fraction at 220 nm using a 4.6×250 mm C18 column. FIG. 2B. Chromatogram of the final purification step of ocfN mutant occidiofungin fraction at 220 nm using a 4.6×250 mm C18 column. FIG. 2C. Overlay of the wild-type (black) and the mutant (grey) fractions of occidiofungin.

[0018] FIGS. 3A-3B. TOCSY (left panel, FIG. 3A) and HSQC (right panel, FIG. 3B) spectra of BHY4 in the wild-type sample. The proportions of Asn1 and BHN1 variants were determined by the measurement of the .sup.13C-HSQC Ha-Ca cross peak intensities of BHY4 in the HSQC spectra. These values are listed next to their corresponding peaks in the right panel. The peaks in red and green represent the BHY4 peaks associated with BHN1 and Asn1 variants, respectively. Based on the calculation of their relative proportions, i.e. (34.81+87.97 for the BHY4 peaks found in the BHN1 conformational variants) and (32.79+37.61 for the BHY4 peaks found in the Asn1 conformational variants), the approximate proportion of the Asn1 variants could be calculated as (32.79+37.61)/(34.81+87.97)+(32.79+37.61).

[0019] FIGS. 4A-4B. ESI mass spectrometry. FIG. 4A. ESI mass spectrometry data of purified wild-type occidiofungin fraction. FIG. 4B. ESI mass spectrometry data of purified ocfN mutant occidiofungin fraction.

[0020] FIGS. 5A-5C. TOCSY fingerprint region (NH correlations). FIG. 5A. NH correlations in the wild-type sample. The two BHN1 and four Asn1 spin systems present in the wild-type sample are shown. FIG. 5B. NH correlations in the ocfN mutant sample. FIG. 5C. Overlay of the NH correlations found in the wild-type and ocfN mutant samples. NH correlations that are not present in the ocfN mutant sample are shown grey.

[0021] FIG. 6. Schematic of occidiofungin ring closure. The completely synthesized eight amino acid linear peptide is bound by a 4-phosphopantetheine cofactor (ppan) linker to the thiolation (T) domain. The peptide varies by the presence or absence of a hydroxyl group on the beta carbon of Asn1. The TE domain of OcfD is capable of forming the cyclic peptide of both variants in the absence of a functional OcfN cyclase thioesterase. However, it is not as efficient at producing the Asn1 cyclic peptide variant as OcfN. In the presence of a functional OcfN cyclase thioesterase, a novel diastereomers of occidiofungin is formed by the selective ring closure of the Asn1 cyclic peptide. R1 and R2 are BHN1 and Asn1, respectively.

[0022] FIGS. 7A-7B. Comparison of the bioactivity from the wild-type and ocfN mutant occidiofungin fractions. FIG. 7A. MICs of wild-type and ocfN mutant fraction determined by CLSI M27-A3 method in RPMI 1640. FIG. 7B. Comparison of the CFUs in the MIC wells of wild-type fraction to the corresponding well having the same concentration of the ocfN mutant occidiofungin fraction. Asterisks represent no detectable colonies in the MIC wells of the wild-type occidiofungin fraction. Black and grey bars are ocfN mutant and wild-type fractions, respectively. Standard deviations for the CFU measurements are presented.

[0023] FIGS. 8A-8C. Potato dextrose agar plates were inoculated with each of the strains and incubated for 3 days at 28° C. The plates were oversprayed with the indicator fungus Geotrichum candidum and incubated overnight. FIG. 8A: The wild-type strain MS14; FIG. 8B: Negative control MS14GG78 (ocfJ::nptII); FIG. 8C: MS14GG88 (ocfN::nptII).

[0024] FIGS. 9A-9B. COSY60 NMR Spectrum of Occidiofungin from ocfN mutant MS14GG88 recorded at 600 MHz in DMSO-d6.

[0025] FIGS. 10A-10B. TOCSY60 NMR Spectrum of Occidiofungin from ocfN mutant MS14GG88 recorded at 600 MHz in DMSO-d6.

[0026] FIGS. 11A-11B. NOESY400 NMR Spectrum of Occidiofungin from ocfN mutant MS14GG88 recorded at 600 MHz in DMSO-d6.

[0027] FIGS. 12A-12B. .sup.13C-HSQC NMR Spectrum of Occidiofungin from ocfN mutant MS14GG88 recorded at 600 MHz in DMSO-d6.

[0028] FIGS. 13A-13B. One-dimensional NMR temperature titration curves for occidiofungin derived from ocfN mutant MS14GG88 (FIG. 13A) and wild-type strain MS14 (FIG. 13B).

[0029] FIGS. 14A-14B. TOCSY fingerprint region (NH correlations) for occidiofungin derived from ocfN mutant MS14GG88 (FIG. 14A) and wild-type strain MS14 (FIG. 14B) at 50° C.

[0030] FIG. 15. Time-kill experiments performed against Candida glabrata ATCC66032. Solid black lines and dashed grey lines correspond to samples treated with occidiofungin derived from wild-type strain MS14 and ocfN mutant MS14GG88, respectively. Circles, squares, and triangles represent samples treated with 0.5, 1.0, and 2.0 μg/mL of occidiofungin, respectively. The diamond represents the sample treated with the blank control.

BRIEF DESCRIPTION OF THE SEQUENCES

[0031] SEQ ID NOs: 1-2: PCR primer sequences

TABLE-US-00001 SEQ ID NO: 3: amino acid sequence for OcfN (thioesterase; thioesterase motif of- G-X-S-X-G- underlined (X is any amino acid)) MRLICFPYAGGSAAVYRTLQASLPGIEVCRHELAGRGSRLSEPAVRDMATLV DTLLCDLDDCFDRPFALLGHSMGAAIAAELALRLPAHARPNLRHLEVSARAAPGKERHDR RMQALDDRAFIDALREMGGTPKAVLDNSELMALLMPALRADFTMIENHRPVPGPRLAVDI TAFAGRADKEIPVDAVAGWGAATTGREDFHVIEGDHFFLRNEMRTMAGIIAARMRRPEHA ASSALQA SEQ ID NO: 4: amino acid sequence for OcfD (thioesterase motif of-G-X-S-X-G- underlined (X is any amino acid)) MQDNNVLVTD RESLSRVAGV YGIAAYAPSQ QPGRPLTRSV RLTPASLDLL RRIGDGELAE FAVAAAGIAF LLWKYFRIPV TVLGTPGLAG HPSARAAIVP LIIEVRPDER IEDYLSRVAG IVEDSYAEPR FPLETLVRNE KDMALAQLTK VALADDRVHH APTGRDDDLQ LHLRLARGEI ELRYSGAIEP FIIDGFAGSL AAVLEAFEHL DGAVGDIEAA PPEQGPLLAA FNETATAGPS HPTVVAMFEA QVARTPTAPA LVTDSSLMTY ADLNARANSL AHHLREHHGV GPESLVGIML DRSEWMIVAI LGILKAGAAF VPLDPAYPAE RINHILGDTG LSLLVTQSSQ LAQWYEFSGV TLLLDQELPG WQPLPDNPPH RAEPAHLAYV LYTSGSTGKP KGCLLEHRNL AHYIAWAAGY YFPESTTGSF GLYSSLCFDF TLTNIFCPLV RGKTLRIYPQ SESIDTILAR MFQPGSGVDT LKLTPTHIHL LEYMNLARSG VRKVIVGGEE LTPQHIATLR KIDPAIEIYN EYGPTEATVG CIVERVEDAP PTVLIGRPIA DTRVYMLDDA LRPVPLGVPG EICLAGAGLA RGYHQRPDVT AAKFVEHPFP GEARIYRTGD IGRWLPDGRI QCYGRVDHQV KIRGHRVELG EIEAAIAAHE DVVGAAVMLR ESAHGVRKLA AYVKGAASLS VPNLRAYLAG KLPDYMVPSD IIPIAEFPLN ANGKLDRPAL LALEPAAAPE EAPLDATPIQ RELVRIWRDV LDNPAVDLAG RFFDYGGDSL QAMQLVSRIW SSFSVEIGID AIFELQTISA VSDLIEASSP HPGSTAGAIP PRSRANDLPL SFPQQRLWFL AQLEGPSATY NISSALRFEG ELDVARLRFA VSEISRRHEI LRTTFPAVDG RGVQRIAPPA PVALDVVDVA SESDTLALLA EEADRPFDLA AGPLYRVVLY RVHERLHVFG IVMHHIVSDA WSSGILIGEL AALYAGESLP ELAVQYADYA VWQHERLASA DTHRELALLS AALADAPDLI ELPTDRPRPA VQQFRGAVLP FQLSAERADG LRAIARASGT STFMVVLAAY ALLLSRYSNQ QDLVIGSPIA NRRSSMTEPL IGFFANMLAL RVDLSGNPTF GDLLARVKRV ALDGYSRQEI PFEQVVDSLE LERNLGRTPV FQVVFAYEKA QPRAVSFPGL VATPVAVETH TAKFDLTLHV QDADDGLAGS LEYNLDLFDA ATIDRMAEHF RTLVDAVIAD PDRPLGALSL SNDAERNLLT VEWNRTDTDF GEDAAQPLHR LFEQQVERTP DAVAIVFDDT ALTYAELNLR ANRLAHHLVA LGVGPDSLVG VAMERSLDMS VALLAILKAG GAYVPVDPDY PAERVRFMID HAQLRWLLTQ QHLHDALPDT DAHVIVVDRD SLDLDAAATS NPAPALNGDN LAYMIYTSGS TGRPKGALNT HRAITNRILW MQHAYALDAD DAVLQKTPFS FDVSVWELFW PLVTGARLVF ARPGGQRETD YLVELIERER ITTIHFVPSM LRAFLDHPDL DAHCASLRRV VCSGEALPHD LQQRCLERLD VKLYNLYGPT EAAVDVTAWE CRRDDPHRIV PIGRPIANTR LYIVDAQMQP TPIGVAGELL IGGTPVGRGY HGEPELSAEK FIADPFSADP LARLYRTGDL ARYRPDGNIE FLGRIDHQIK LRGLRIEPGE IEAALRAHPS VDDCVVIAKT EGARTFLIAY VATAAPDIAD LRGYLGGKLA DYMVPSQFFA LESLPMLPNG KINRKALPLP ADRGDAAQPH APAVTPREIL LASICIDVLQ LPSVGIHDNF FELGGDSILS IQVIARANQA GLRVTAKQLF QYQTIAQLAA APEERAACAP TLSPLGDAPL TPVQHWFFEQ EIDAPSHYNQ TVLIQVPADI DASRLADAFR QVYEHHDALR LRFSHDAGRW TQQVVAGGEM PALFAKQVIA DDAGERLAAM RAAAADAERG IDITHGPLLA ARLFCLADEP LARLFVSIHH LAVDGVSWRV LLEDLHAAYH GQPLPGKTTS FREWALHLQQ LARSPAIGDE ARLWQALLAQ PVEPMPVDYP GTGAANNAVD DASSVSFELG EADTTALLRR LPRAYDTRIN DVLLVALAQA CSMVTGNTRT RIDLESHGRH VSDAPLDLTR TVGWFTSIYP VVLDADAMHA PEQALRAARQ QLRRIPADGL GYSLLRYQSP DAAVRDSLAA LPKADILFNY HGQLDTVLRQ SDGWRPAAED LGSLRAGRSQ RTHAFEIVAA VADGKLQVDW RYGERLHRRQ TVENLAAHFR DRLLDFAASV PDTAADDIED SYPLSSLQQG ILFHSLYDLD PAAYFQQFSF VVSGPLQVPA LRQAWANALA RHAVLRTAFA WADRDHPVQT VRHTVDLPWT FLDWRHRDAS RRAQDFDAFL ADDRRRGFDL QRAPLFRCTL IQETDTRHRF CWSAHHIILD GWSTATLMKE VFDDYLSLAR TGMPAVAASA PGYRAYIDWL ARHPRSADET WWRAELAGFK AATPVAASPA RQATGDAPRQ DKRRTQQFLL DEALAARLQT LTRTHRVTLN VLIRAVWALV LRRHAGTDDV VFGVTVSGRP PMLDGVESIV GLFINTLPLR LRIAPERPFI EWLAEVHAAQ TAMEPHSYSS LVDIQSWSEL PAGDSLFDSL LVFENFPVAA APDLGPDDIE ILDTRAFAES NYPLTLTVHP NERIGFHISH DAHRIAPEVV RQMLDTLRTL LERFAENPGQ LTGQLADPPA ADGRPSAPRS GAGPAIEAAA GAAAAARAVA HAADESTLLE IWRRIFKRDD IAVSDNYFDL GGHSIIAIQL MAHVEKAFDR RLPISCLFEN PTIEKLAAAL AAKEPSAPAG GLVPIRDGGP AAPLFLLPGA GGNVVYFRPL ANHLSGAHAI HGLEALGLDG ACEPLTRVED IAARHIERIW PLVGAGPYYL AGHSFGAHVA LEMSRQLVAK GADVKLLAIF DASAPIDSSA ATYWQDWDDT EWLVAIAHEI GTFLGTDLQV TRADLVHLDP DGQAGLILER IGDRGSWFAD AGSDRLRAYL RVYQANFKSH YAPHATPLPV PIALFRSTER DPGDYAPSSE IAQLRLDATW GWSRFSAHPV AVTDVPGDHL TMLLDPHAGV LAAHVNSFLE KTPS

[0032] SEQ ID NOs: 5-23: polynucleotide and polypeptides associated with GenBank Accession No. EU938698.5.

DETAILED DESCRIPTION OF THE INVENTION

[0033] This invention relates to antifungal compounds and their therapeutic use in the prevention or treatment of fungal infections and diseases. Particularly, various aspects of the invention provide compositions enriched for occidiofungin diastereomers/conformers that have higher activity against fungal infections or diseases. Thus, the invention relates to methods of making such occidiofungin diastereomers/conformers, compositions enriched for such diastereomers/conformers and methods of using compositions comprising occidiofungin diastereomers/conformers disclosed herein as fungicides for animals and plants. The invention further relates to the microorganisms that produce compositions enriched for occidiofungin enriched for occidiofungin diastereomers/conformers corresponding to diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations). Methods of increasing the production of occidiofungin diastereomers/conformers corresponding to diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations) in microorganisms and productions systems are also provided.

[0034] As discussed above, one aspect of the invention provides compositions enriched for occidiofungin diastereomers/conformers, in particular the occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations observed under the following conditions: 2 mM samples of occidiofungin diastereomers in dimethylsulfoxide (DMSO-d6, Cambridge Isotopes) subjected to 2-D TOCSY, spectra collected at 323 K with a mixing time of 60 milliseconds and data processing using NMRPipe with 45 degree sinebell squared shifts in both dimensions). Thus, the invention provides compositions enriched for such antifungal diastereomers/conformers for treating fungal infection. In certain embodiments of this aspect of the invention, pharmaceutical and agricultural compositions that contain a composition enriched for diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations) are provided.

[0035] Another aspect of the invention provides for compositions that are enriched for a particular occidiofungin diastereomer/conformer. In this aspect of the invention, the activity of the ocfD and/or ocfN thioesterases is altered such that the activity of one of the thioesterases is decreased (or eliminated) and the activity of the second thioesterase remains functional or is increased. Thus, microorganisms can be genetically manipulated such that OcfD thioesterase activity is decreased or eliminated and the thioesterase activity of OcfN is increased or maintained at unaltered (e.g., levels of activity as observed in Burkholderia contaminans MS14 or microorganisms engineered with the biosynthetic pathway for the production of occidiofungin). Alternatively, microorganisms can be genetically manipulated such that OcfN activity is decreased or eliminated and the thioesterase activity of OcfD is increased or unaltered.

[0036] Compositions comprising occidiofungin diastereomers/conformers as disclosed herein may be formulated prior to administration in an agriculturally acceptable carrier, for example in an aqueous carrier, medium or suitable diluent, such as saline or other buffer. The formulated compositions may also be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), water or oil/water emulsions, a wettable powder, or in combination with any other carrier material suitable for agricultural application. Suitable agricultural carriers can be solid or liquid and are well known in the art. The term “agriculturally-acceptable carrier” covers all adjuvants, e.g. inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in the formulation of agricultural compositions; these are well known to those skilled in formulation of agricultural compositions.

[0037] A pharmaceutical composition contains a desired amount of an occidiofungin diastereomers/conformers as disclosed herein. Thus, the pharmaceutical composition can comprise occidiofungin diastereomers/conformers having the total correlation spectroscopy (TOCSY) fingerprint identified in FIG. 5C as the grey NH correlations or the pharmaceutical composition can comprise a particular occidiofungin diastereomer/conformer. Either of these pharmaceutical compositions can be in the form of, for example, a tablet, a caplet, a pill, a hard or soft capsule, a lozenge, a cachet, a dispensable powder, granules, a suspension, an elixir, a dispersion, a liquid, or any other form reasonably adapted for administration. If intended for parenteral administration, it can be in the form, for example, of a suspension or transdermal patch. Presently preferred are oral dosage forms that are discrete dose units each containing a predetermined amount of the disclosed occidiofungin diastereomers/conformers.

[0038] Pharmaceutically acceptable carriers that may be used in these compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.

[0039] The compositions of the present invention may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term “parenteral” as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques. Preferably, the compositions are administered orally, intraperitoneally or intravenously.

[0040] Sterile injectable forms of the compositions of this invention may be aqueous or an oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or diglycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions. Other commonly used surfactants, such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.

[0041] The compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers commonly used include lactose and corn starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include lactose and dried cornstarch. When aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.

[0042] Alternatively, the compositions of this invention may be administered in the form of suppositories for rectal administration. These can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug. Such materials include cocoa butter, beeswax and polyethylene glycols. The compositions of this invention may also be administered topically, ophthalmically, by nasal aerosol or inhalation. Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation.

[0043] Compositions disclosed herein can be used to treat fungal infections in immunocompromised patients or patients having fungal infections. Thus, another aspect of the invention provides for administering compositions enriched for occidiofungin diastereomers/conformers (e.g., those corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations) having increased antifungal activity as compared to occidiofungin compositions produced by Burkholderia contaminans MS14 (disclosed in U.S. Patent Application Publication 2011/0136729, the disclosure of which is hereby incorporated by reference in its entirety). These diastereomers/conformers have been characterized by a number of techniques, including COSY, TOCSY, NOESY, ROESY, and HSQC 2D NMR spectroscopy experiments.

[0044] The antifungal activity of the disclosed occidiofungin diastereomers/conformers (diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations)) provides for compositions having greater antifungal activity as compared to as compared to occidiofungin compositions produced by Burkholderia contaminans MS14 when cultured under the same conditions. The phrase “enriched for the disclosed occidiofungin diastereomers/conformers” is intended to convey that the composition contains disclosed occidiofungin diastereomers/conformers (diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations)) in amounts higher than that produced by a reference strain (e.g., Burkholderia contaminans MS14 as disclosed in the examples provided herein). Thus, the phrase indicates that at least 37% of the total amount of occidiofungin diastereomers/conformers present within an enriched composition are the disclosed diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations)). In various embodiments, compositions “enriched for the disclosed occidiofungin diastereomers/conformers” contain at least 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the disclosed diastereomers/conformers in relation to the total amount of occidiofungin diastereomers/conformers in a composition.

[0045] As discussed above, one aspect of the invention provides microorganisms capable of producing compositions enriched for occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations). In this aspect of the invention, microorganisms are transformed with the genes associated with the biosynthesis of occidiofungin. These genes and open reading frames (ORFs) are disclosed in disclosed in U.S. Patent Application Publication 2011/0136729, the disclosure of which is hereby incorporated by reference in its entirety; Gu et al., Appl. Environ. Microbiol., 2011, 77:(17):6189-6198 which is also incorporated by reference in its entirety and GenBank Accession No. EU938698.5, which is also hereby incorporated by reference in its entirety and is also provided on pages 29-72 (SEQ ID NOs: 5-23). These transformed microorganisms are further manipulated genetically such that the microorganisms exhibit an increase in the level of OcfN thioesterase (SEQ ID NO: 3) activity. An increase in the level of OcfN thioesterase activity can be achieved by means of expressing the ocfN gene in a multicopy plasmid with a native promoter or any other promoter sequence. Another way to increase the expression of the ocfN gene within the cell is to chromosomally integrate additional copies of the ocfN gene using transposons. Yet a further means to increase ocfN thioesterase activity is to substitute the native promoter associated with the ocfN gene with a promoter that increases expression of the gene (relative to the native promoter). In certain embodiments of this aspect of the invention, the thioesterase activity of OcfD can be decreased or eliminated by a point mutation of the catalytic serine at position 2954 of SEQ ID NO: 4, insertional mutation or point mutation of amino acids within the thioesterase motif (in addition to the substitution of the serine residue) found in ocfD to reduce or eliminate its activity, deletion of the catalytic serine or other portions of SEQ ID NO: 4 (e.g., portions or the entirety of the thioesterase motif in SEQ ID NO: 4) or truncation SEQ ID NO: 4 such that thioesterase activity is reduced or eliminated (in addition to increasing the level of OcfN thioesterase activity) within the genetically modified microorganisms.

[0046] Another aspect of the invention provides for compositions enriched for a particular occidiofungin diastereomer/conformer. In this aspect of the invention, transformed microorganisms are manipulated genetically such that the microorganisms exhibit an increase in the level of OcfD thioesterase (SEQ ID NO: 4) activity. An increase in the level of OcfD thioesterase activity can be achieved by means of expressing the ocfD gene in a multicopy plasmid with a native promoter or any other promoter sequence. Another way to increase the expression of the ocfD gene within the cell is to chromosomally integrate additional copies of the ocfD gene using transposons. Yet a further means to increase ocfN thioesterase activity is to substitute the native promoter associated with the ocfD gene with a promoter that increases expression of the gene (relative to the native promoter). In certain embodiments of this aspect of the invention, the thioesterase activity of OcfN can be decreased or eliminated by a point mutation of the catalytic serine at position 73 of SEQ ID NO: 3, insertional mutation or point mutations of other amino acids within the thioesterase motif (in addition to the substitution of the serine residue) of the thioesterase to reduce or eliminate its activity, deletion of the catalytic serine or other portions of SEQ ID NO: 3 (e.g., portions or the entirety of the thioesterase motif in SEQ ID NO: 3), truncation SEQ ID NO: 3 such that thioesterase activity is reduced or eliminated or deletion of ocfN in its entirety (in addition to increasing the level of OcfD thioesterase activity) within the genetically modified microorganisms. Where the biosynthetic pathway for occidiofungin biosynthesis is engineered into a microorganisms, once can, of course, omit ocfN to achieve the same effect as the mutation or deletion of ocfN as discussed above.

[0047] Thus, microorganisms such as bacterial cells, fungal cells and yeast can be transformed with genes encoding the occidiofungin biosynthetic pathway and genetically manipulated, as discussed above, such that the cells have increased OcfN activity and/or decreased OcfD activity as compared to reference bacterial, fungal or yeast cells. Alternatively, microorganisms such as bacterial cells, fungal cells and yeast can be transformed with genes encoding the occidiofungin biosynthetic pathway and genetically manipulated, as discussed above, such that the cells have increased OcfD activity and/or decreased OcfN activity as compared to reference bacterial, fungal or yeast cells. Such cells can then be used to produce compositions enriched for occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations) or to produce compositions enriched for a particular occidiofungin diastereomer/conformer. The phrase “reference bacterial, fungal or yeast cells” refers to bacterial, fungal or yeast cells containing the genes associated with the biosynthetic pathway for the production of occidiofungin and where the function/activity of OcfN and/or OcfD has not been altered as disclosed herein. Thus, the phrase “reference bacterial, fungal or yeast cells” refers to cells containing, for example, polynucleotide (SEQ ID NO: 23 encoding the open reading frames (ORFs; SEQ ID NOs: 5-22)) disclosed in GenBank Accession No. EU938698.5. For the comparison of compositions comprising particular occidiofungin conformers (or compositions enriched for occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations)), compositions containing the diastereomers/conformers are obtained from cells genetically manipulated to have increased ocfN activity and/or decreased OcfD activity (or increased OcfD activity and/or decreased ocfN activity) and compared to compositions containing occidiofungin produced by reference bacterial, fungal or yeast cells cultured under similar or the same conditions (e.g., the same temperature and medium).

[0048] Bacterial cells can be selected Gram negative bacteria or Gram positive bacteria. In this aspect of the invention, the Gram-negative bacterial cell can be selected from the group consisting of Escherichia, Zymomonas, Acinetobacter, Gluconobacter, Geobacter, Shewanella, Salmonella, Enterobacter and Klebsiella. Gram-positive bacteria can be selected from the group consisting of Bacillus, Clostridium, Corynebacterial, Lactobacillus, Lactococcus, Oenococcus, Streptococcus and Eubacterial cells. Various thermophilic bacterial cells, such as Thermoanaerobes (e.g., Thermoanaerobacterium saccharolyticum), Bacillus spp., e.g., Bacillus coagulans strains, Bacillus licheniformis strains, Bacillus subtilis strains, Bacillus amyloliquifaciens strains, Bacillus megaterium strains, Bacillus macerans strains, Paenibacillus spp. strains or Geobacillus spp. such as Geobacillus stearothermophilus.

[0049] Yeast cells suitable for use in this aspect of the invention may be a Candida, Hansenula, Kluyveromyces, Pichia, Saccharomyces, Schizosaccharomyces, or Yarrowia cell such as a Kluyveromyces lactis, Saccharomyces carlsbergensis, Saccharomyces cerevisiae, Saccharomyces diastaticus, Saccharomyces douglasii, Saccharomyces kluyveri, Saccharomyces norbensis, Saccharomyces oviformis, or Yarrowia lipolytica cell. In this aspect of the invention, the yeast cell must be resistant to the effects of occidiofungin to be a viable production system for compositions enriched for occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations).

[0050] In other embodiments of this aspect of the invention, fungal cells can be manipulated to produce compositions enriched for occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations). “Fungi” as used herein includes the phyla Ascomycota, Basidiomycota, Chytridiomycota, and Zygomycota, Oomycota and all mitosporic fungi. A fungal cell may be a yeast cell. “Yeast” as used herein includes ascosporogenous yeast (Endomycetales), basidiosporogenous yeast, and yeast belonging to the Fungi Imperfecti (Blastomycetes). The fungal host cell may be a filamentous fungal cell. “Filamentous fungi” include all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., 1995, supra). The filamentous fungi are generally characterized by a mycelial wall composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbon catabolism is obligately aerobic. In contrast, vegetative growth by yeasts such as Saccharomyces cerevisiae is by budding of a unicellular thallus and carbon catabolism may be fermentative. The filamentous fungal host cell may be an Acremonium, Aspergillus, Aureobasidium, Bjerkandera, Ceriporiopsis, Chrysosporium, Coprinus, Coriolus, Cryptococcus, Filibasidium, Fusarium, Humicola, Magnaporthe, Mucor, Myceliophthora, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Phanerochaete, Phlebia, Piromyces, Pleurotus, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, Trametes, or Trichoderma cell. For example, the filamentous fungal host cell may be an Aspergillus awamori, Aspergillus foetidus, Aspergillus fumigatus, Aspergillus japonicus, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Bjerkandera adusta, Ceriporiopsis aneirina, Ceriporiopsis caregiea, Ceriporiopsis gilvescens, Ceriporiopsis pannocinta, Ceriporiopsis rivulosa, Ceriporiopsis subrufa, Ceriporiopsis subvermispora, Chrysosporium inhops, Chrysosporium keratinophilum, Chrysosporium lucknowense, Chrysosporium merdarium, Chrysosporium pannicola, Chrysosporium queenslandicum, Chrysosporium tropicum, Chrysosporium zonatum, Coprinus cinereus, Coriolus hirsutus, Fusarium bactridioides, Fusarium cerealis, Fusarium crookwellense, Fusarium culmorum, Fusarium graminearum, Fusarium graminum, Fusarium heterosporum, Fusarium negundi, Fusarium oxysporum, Fusarium reticulatum, Fusarium roseum, Fusarium sambucinum, Fusarium sarcochroum, Fusarium sporotrichioides, Fusarium sulphureum, Fusarium torulosum, Fusarium trichothecioides, Fusarium venenatum, Humicola insolens, Humicola lanuginosa, Mucor miehei, Myceliophthora thermophila, Neurospora crassa, Penicillium purpurogenum, Phanerochaete chrysosporium, Phlebia radiata, Pleurotus eryngii, Thielavia terrestris, Trametes villosa, Trametes versicolor, Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei, or Trichoderma viride cell.

[0051] Fungal cells may be transformed by a process involving protoplast formation, transformation of the protoplasts, and regeneration of the cell wall in a manner known per se. Suitable procedures for transformation of Aspergillus and Trichoderma host cells are described in EP 238023, Yelton et al., 1984, Proc. Natl. Acad. Sci. USA 81: 1470-1474, and Christensen et al., 1988, Bio/Technology 6: 1419-1422. Suitable methods for transforming Fusarium species are described by Malardier et al., 1989, Gene 78: 147-156, and WO 96/00787. Yeast may be transformed using the procedures described by Becker and Guarente, In Abelson, J. N. and Simon, M. I., editors, Guide to Yeast Genetics and Molecular Biology, Methods in Enzymology, Volume 194, pp 182-187, Academic Press, Inc., New York; Ito et al., 1983, J. Bacteriol. 153: 163; and Hinnen et al., 1978, Proc. Natl. Acad. Sci. USA 75: 1920.

[0052] In another embodiment of the present invention, the native promoter of the ocfN gene within Burkholderia contaminans MS14 can be replaced by promoter elements known to enhance the level of gene expression, thereby increasing OcfN thioesterase activity within Burkholderia contaminans MS14. Burkholderia contaminans MS14 can also be genetically modified by other techniques to produce compositions enriched for occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations). Genetic modifications that ocfN thioesterase activity include the introduction of multicopy plasmids comprising a native promoter or any other promoter sequence operably liked to an ocfN gene into Burkholderia contaminans MS14, integration of additional copies of the ocfN gene operably linked to a promoter into the chromosome of Burkholderia contaminans MS14 using transposon mutagenesis or by replacement of the native ocfN promoter in Burkholderia contaminans MS14 with a promoter that increases the expression of ocfN transcripts relative to the native promoter sequence.

[0053] Another aspect of the invention provides for the introduction of a point mutation into the nucleotide sequence encoding OcfD, the truncation of ocfD (or introduction of a frameshift mutation) such that the thioesterase activity is reduced or eliminated or the deletion of the segment of the ocfD gene encoding the catalytic serine in order to increase the amounts of occidiofungin diastereomers/conformers corresponding to the diastereomers/conformers having the TOCSY fingerprint identified in FIG. 5C (the grey NH correlations) produced by Burkholderia contaminans MS14 or by microorganisms genetically modified to produce occidiofungin (e.g., microorganisms into which the biosynthetic pathway for occidiofungin production have been introduced). In this aspect of the invention, a point mutation is introduced into the catalytic serine in the thioesterase domain of ocfD in order to reduce its activity. This amino acid is found at position 2954 of SEQ ID NO: 4. For example, the serine can be mutated into an alanine, glycine or proline residue (with glycine or alanine being preferred in this context). Certain embodiments of this aspect of the invention also provide for genetic modification of the microorganisms such that ocfN activity is increased as well (e.g., the level of OcfN thioesterase activity can be increased by means of expressing the ocfN gene in a multicopy plasmid with a native promoter or any other promoter sequence, chromosomal integration of additional copies of the ocfN gene using transposons or other means or substitution of the native promoter associated with the ocfN gene with a promoter that increases expression of the gene (relative to the native promoter)).

[0054] Another aspect of the invention provides for the introduction of a point mutation into the nucleotide sequence encoding OcfN, the truncation of ocfN (or introduction of a frameshift mutation) such that the thioesterase activity is reduced or eliminated, the deletion of the segment of the ocfN gene encoding the catalytic serine or chromosomal deletion of ocfN within a microorganism (e.g., Burkholderia contaminans MS14) in order to increase the amounts a particular occidiofungin diastereomer/conformer produced by a microorganism. As would be apparent to one skilled in the art, a similar effect can be obtained by transforming a microorganism with the genes encoding the occidiofungin biosynthetic pathway, with the exception of ocfN gene. In this aspect of the invention, a point mutation is introduced into the catalytic serine in the thioesterase domain of OcfN in order to reduce its activity. This amino acid is found at position 73 of SEQ ID NO: 3. For example, the serine can be mutated into an alanine, glycine or proline residue (with glycine or alanine being preferred in this context). Certain embodiments of this aspect of the invention also provide for genetic modification of the microorganisms such that OcfD activity is increased as well (e.g., the level of OcfD thioesterase activity can be increased by means of expressing the ocfD gene in a multicopy plasmid with a native promoter or any other promoter sequence, chromosomal integration of additional copies of the ocfD gene using transposons or other means or substitution of the native promoter associated with the ocfD gene with a promoter that increases expression of the gene (relative to the native promoter)).

Materials and Methods

[0055] Proportion of Occidiofungin Variants in the Sample. The C-terminal TE domain of OcfD and the OcfN cyclase thioesterase in the occidiofungin biosynthetic gene cluster are both predicted to be involved in the termination of synthesis and formation of the cyclic peptide. Given that the N-terminal end of the linear peptide is an Asn or BHN, we hypothesized that each thioesterase was required for cyclization of the Asn1 and BHN1 variants. The Asn1 and BHN1 variants of occidiofungin are not separable by RP-HPLC (reverse phase high performance liquid phase chromatography), thus, both variants are present in the purified fraction (FIGS. 2A-2C). The final RP-HPLC step in the purification process reveals the presence of three peaks. Occidiofungin samples elute as a doublet peak before the third peak. Both the wild type strain MS14 and the ocfN mutant MS14GG88 have the same chromatographic profile as observed in the last purification step. Occidiofungin peaks were confirmed by MALDI-TOF and bioassays. It is important to note that the presence of the doublet peak is not associated with the presence of Asn1 or BHN1. Each peak of the doublet contains both the Asn1 and BHN1 variants.

[0056] The relative proportion of the Asn1 and BHN1 variants could not be directly compared, because direct measurement of the Asn1 peak intensities could not be done due to the peaks overlapping with Asn7. The relative proportion of the Asn1 and BHN1 variants in the wild-type fraction was determined by measuring the .sup.13C-HSQC Ha-Ca cross peak intensities of each BHY4 peak in the data set,.sup.27, 28 given that each of the BHY4 peaks could be attributed to either the Asn1 or BHN1 variant. Based on the Ha-Ca cross peak intensities for BHY4 in HSQC spectrum, the Asn1 and BHN1 variants was determined by measuring the .sup.13C-HSQC Ha-Ca cross peak intensities of each BHY4 peak in the data set.sup.27, 28, and was determined to be approximately 36% and 64% of the total amount of occidiofungin, respectively (FIGS. 3A-3B). The peaks in red and green represent the BHY4 peaks associated with BHN1 and Asn1 variants, respectively. A similar ratio was also observed in the relative abundance of each peak in the ESI-MS spectrum (FIG. 4A). Furthermore, the .sup.13C-HSQC Ha-Ca cross peak intensities for the BHN1 peaks in the spectra were determined to be 90.50 and 38.65, which support the intensities measured for BHY4 peaks corresponding to the BHNlconformational variants.

[0057] Mutagenesis of the ocfN gene was conducted via a marker exchange procedure as described previously.sup.22, to generate the mutant MS14GG88. The percentage of Asn1 to BHN1 variants in the ocfN mutant MS14GG88 fraction could be determined by measuring the proportion of each BHN1 variant using the HSQC data set and by the integration of the HN of Asn1 and BHN1 in the .sup.1H NMR spectra. Asn1 and BHN1 variants are approximately 20% and 80% of the total amount of occidiofungin, respectively. The ESI-MS spectrum also shows a lower relative abundance for the Asn1 variant (1200.39 Da) compared to the BHN1 variant (1216.41 Da) (FIG. 4B).

[0058] Comparison of Wild-type and ocfN Mutant NMR Spectra. Occidiofungin has a complex spectrum for a peptide of only eight amino acids (FIG. 5A and Table 1). The NMR spectrum represents an average of the conformers on the NMR time scale. Conformers in slow exchange on the NMR time scale may result in multiple spin systems for each amino acid. In some situations, multiple conformers are known to arise for cyclic peptides due to slow interconverting conformational families..sup.29, 30 Despite the conformation restrictions brought about by the ring closure, occidiofungin still has a significant amount of conformational freedom. Both Asn1 and BHN1 variants are visibly present in the wild-type fraction, which are colored red in FIG. 5A. The TOCSY fingerprint region (Ni correlations) is not as complex for the OcfN thioesterase MS14GG88 mutant spectra (FIG. 5B). A significant number of spin systems found in the wild-type spectra are absent in the ocfN thioesterase mutant spectra. Our experiments show that the TE domain on the C-terminal region of OcfD is able to perform the peptide macrocyclization of both the Asn1 and BHN1 variants. Although, there is only one amide spin system for Asn1 produced by OcfD. Whereas, the loss of OcfN results in the disappearance of the other three Asn1 amide spin systems.

[0059] An overlay of the wild-type and ocfN mutant NMR spectra shows the amino acid spin systems in grey that are absent in the mutant spectra (FIG. 5C). These spin systems are for Asn7, Ser8, Asn1, Novel Amino Acid 2 (NAA2), Ser3, BHY4, and Gly6. The loss of these spin systems suggests that the complex spin system observed for the wild-type occidiofungin fraction is not only due to interconverting conformational families, but is the result of distinct diastereomers formed by the regiospecific activity of the OcfN cyclase and OcfD TE domain. Dramatic chemical shifts observed, such as the 2 ppm shift for HN of the NAA2, support the formation of a structurally unique conformer of occidiofungin. A unique conformer is further supported by the subsequent loss of a NAA2 spin system in the ocfN mutant NMR spectra. Furthermore, the presence of both Asn1 and BHN1 spin systems in the mutant spectra along with the absence of the amide spin systems shown in grey indicate that the additional spin systems are not due to the presence of the O-hydroxyl on Asn1. The additional spin systems are due to the formation of unique diastereomer produced by OcfN cyclase thioesterase. To further test for the formation of a configurational isomer versus an interchangeable conformational isomer, one dimensional NMR temperature titrations were performed. Amide and aromatic regions revealed little change in the complexity of peaks present with the occidiofungin derived from ocfN mutant MS14GG88 or wild-type strain MS14 (FIGS. 13A-13B). Given that NAA2 spin systems are a good indicator for the presence of both diastereomers in the wild-type spectrum, we collected TOCSY spectra for occidiofungin derived from ocfN mutant MS14GG88 or wild-type strain at 50° C. (FIGS. 14A-14B). There was no loss or addition of a spin system for NAA2 in the mutant spectrum. Furthermore, both spin systems for NAA2 remained in the wild-type spectrum. This data supports that the stereoisomers are non-interchangeable isomers, supporting their classification as a diastereomers (configurational isomers) rather than a conformational isomer.

[0060] Model for the Coordinated Function of Two Cyclase Thioesterases. There was no loss of an amide spin system for a BHN1 in the ocfN mutant NMR spectra. This suggests that OcfN thioesterase has a substrate requirement for the peptide containing Asn1, since there is no concomitant loss of a BHN1 spin system with the observed loss of the Asn1 spin systems. The C-terminal TE domain of OcfD has a preference for the peptide containing the BHN1, but is capable, albeit at a lower efficiency of cyclizing the Asn1 variant. This provides an interesting scenario for the activity of the two thioesterases (FIG. 6). Both thioesterases contain the GXSXG motif, which is important for the catalytic transfer of the peptide from the T domain to the cyclase. This suggests that substrate recognition occurs prior to the catalytic transfer of the peptide to the cyclase. Presumably, OcfN cyclase has a higher affinity or better access for the Asn1 peptide product given that the proportion of the Asn1 cyclic peptide product produced by OcfD compared to the BHN1 product is reduced in the wild-type fraction. Therefore the biosynthesis of occidiofungin utilizes the structural differences between Asn and BHN to increase the conformational biodiversity of occidiofungin. The increase in conformational diversity is accomplished by the regiospecific activity of each cyclase, presumably by differences in their binding clefts that helps orientate the peptide before cyclization.

[0061] Comparison of the Bioactivity of the Wild-type and ocfN Mutant Product. To determine whether the increase in conformational diversity is important for bioactivity, minimum inhibitory concentrations were determined against medically relevant Candida species (FIG. 7A). There was a 2-fold decrease in the minimum inhibitory concentration (MIC) with the purified ocfN mutant product with respect to the wild-type product against Candida albicans LL, Candida albicans IL, Candida glabrata ATCC66032, Candida parapsilosis ATCC90018, and Candida tropicalis ATCC66029. There was no difference in the MIC for Candida albicans ATCC66027. Colony forming units (CFUs/mL) were determined for the MIC wells of wild-type product for each Candida species and compared to the corresponding well containing the same concentration of the ocfN mutant product (FIG. 7B). Following exposure to the same concentration of wild-type and ocfN mutant products, these results show a 5 to 7-log decrease in cell density of the Candida species treated with wild-type product. The differences in activity are also visualized by the rate of cell death. Time-kill experiments were performed against Candida glabrata ATCC66032. There was a ten-fold difference in yeast present at 4 and 8 hours when cells were treated with 0.5 μg/mL of occidiofungin derived from ocfN mutant MS14GG88 or wild-type strain (FIG. 15). Furthermore, a slower rate of cell death was also observed for yeast treated with occidiofungin derived from ocfN mutant MS14GG88 at 1.0 and 2.0 μg/mL. Given that the cyclic occidiofungin variants produced by OcfN constitute less than half of the total structural variants, a 2-fold loss in activity suggests that the configurational isomer made by OcfN are 4-fold more active than the stereoisomer produced by OcfD against five of the Candida species tested. Another possible explanation for the observed differences in activity could be attributed to possible synergism between the configurational isomers produced by each cyclase thioesterase. Furthermore, the antifungal activity of the ocfN mutant (MS14GG88: 8.79±0.38 mm) was also significantly reduced (P<0.05) compared to wild-type activity (inhibitory zone radius ±SEM: 13.00±0.58 mm) in an overlay assay against Geotrichum candidum (FIGS. 8A-8C).

[0062] General Discussion. The findings from this study include experiments showing the following: the relative proportion of the Asn1 and BHN1 variants in the purified fraction; distinct differences in spin systems for the wild-type and ocfN mutant products; proposed model for the coordinated function of two cyclase thioesterases; and demonstrated differences in biological activity of wild-type and ocfN mutant products against therapeutically relevant Candida species. Expanding the conformational repertoire of cyclic peptide natural products can be beneficial to microorganisms. These data suggest that the bacterium Burkholderia contaminans MS14 is benefited by maintaining two distinct cyclase thioesterases that improves the spectrum of activity of occidiofungin.

[0063] Our data support the observation that cyclase thioesterase substrate recognition occurs prior to the catalytic transfer of the peptide. The presence or absence of a hydroxyl group on the beta carbon of the N-terminal amino acid (Asn1) appears to be important for the substrate recognition by the two cyclase thioesterases. It has also been shown that the N-terminal amino acid is important for substrate recognition for other thioesterases..sup.4, 8 It is possible that the presence of the hydroxyl group promotes a hydrogen bond with the ocfD cyclase thioesterase domain or more likely promotes an interaction within the T domain of the NRPS. Different bound orientations of the peptide to the T domain would establish a basis for the coordinated function of two cyclase thioesterases. It is also possible that the enzymatic conversion of one of the residues between L- and D-isomers is not completed by one of the epimerization domains. A combination of differences in the N-terminal amino acid and a possible difference in amino acid configuration (L or D), may contribute to the selective differences by the cyclase thioesterases that result in the formation of the observed configurational isomers.

[0064] The presence of the hydroxyl group on the beta carbon and the bound orientation of the peptide to the T domain may prevent the interaction of the OcfN cyclase, while enabling the continued substrate recognition by OcfD TE domain. There is evidence for the need of a bound orientation of the peptide to the T domain for the successful function of the cyclase thioesterase. Conformational diversity of the T domain has been shown to be important for the directed movement of the peptide substrate bound to the ppan cofactor and its interaction with externally acting enzymes..sup.3 More specifically, the active site serine of the cyclase thioesterase needs to attack the linear peptide attached by a thioester linkage to the ppan forming an acyl-O-TE intermediate. The position of the peptide bound to the ppan in the T domain will be important for bringing the peptide substrate in proximity of the appropriate cyclase thioesterase.

[0065] Furthermore, some cyclase thioesterases are capable of transacylation of the peptide to the active site serine, when the peptide is bound to a biomimetic prosthetic group..sub.4, 16 However, there are several cyclase thioesterases that will not function when the product is bound to a biomimetic group. These data suggest that the interaction of the peptide with the T domain is important for the enzymatic activity of some thioesterases and this interaction cannot be mimicked using a prosthetic group. It is conceivable that the coordinated function of the two cyclase thioesterases, involved in the synthesis of occidiofungin, utilize differences in the interaction of the ppan bound peptide within the T domain.

[0066] Presumably, ocfN was integrated into the occidiofungin biosynthetic gene cluster to improve its spectrum of activity against fungi. Given the broad spectrum of antifungal activity associated with occidiofungin, the molecular target is likely to be highly conserved. However, there must be some variation among fungal species to account for the differences in biological activity. Increasing the conformational repertoire must be a selective advantage to the bacterium for it to maintain the two functional cyclase thioesterases. The microbial environment is considerably different than how we intend to apply the natural products produced by microorganisms. For instance, the bacterium Streptomyces roseosporus is a soil saprotroph responsible for the production of daptomycin..sup.31, 32 The microbial community that this bacterium encounters is far more diverse than the group of bacteria that cause human infection. Thus, evolutionary pressures that selected for the current conformers of daptomycin may not necessarily be the best conformers for treating a Staphylococcus aureus infection. It is very likely that the therapeutic application of daptomycin or other cyclic peptide drugs could be improved by engineering novel conformational or configurational isomers.

[0067] Creating novel diastereomers of other cyclic peptide drugs using new or engineered cyclase thioesterases may lead to improvements in their therapeutic activity against clinically relevant pathogens. This is true for occidiofungin produced by the bacterium Burkholderia contaminans MS14, which accomplishes this goal by the evolutionary integration of an additional cyclase thioesterase into the occidiofungin biosynthetic gene cluster.

[0068] All patents, patent applications, provisional applications, and publications referred to or cited herein are incorporated by reference in their entirety, including all figures and tables, to the extent they are not inconsistent with the explicit teachings of this specification.

[0069] Following are examples which illustrate procedures for practicing the invention. These examples should not be construed as limiting. All percentages are by weight and all solvent mixture proportions are by volume unless otherwise noted.

Example 1

Experimental Section

[0070] Materials. Occidiofungin produced by both the wild type strain MS14 and the ocfN mutant MS14GG88 were purified as previously described for the wild-type sample..sup.23 Chemicals were purchased from Sigma-Aldrich (St. Louis, Mo.) and were the highest grade, unless otherwise stated. Media were purchased from Fisher Scientific, enzymes were purchased from New England BioLabs, and primers were purchased from Integrated DNA Technologies (IDT) unless otherwise stated. Candida strains used were purchased from the ATCC biological resource center and were a gift from Thomas Edlind (Drexel University College of Medicine).

[0071] Site Directed Mutagenesis. A nonpolar mutation was constructed in the open reading frame of wild-type ocfN by the insertion of a kanamycin resistance gene, nptII..sup.33 To mutate ocfN, a 1-kb fragment containing ocfN was obtained by PCR using primers MocfNF (5′-CGCCACCCGTTACGAGGATTC, SEQ ID NO: 1) and MocfNR (5′-ACGCGTCCCCTCTTCCTACG, SEQ ID NO: 2). The 1-kb PCR product was cloned into the pGEM-T Easy Vector System I (Promega Corporation, Madison, Wis.) resulting in plasmid pGG30. The nptII gene was inserted into the cloned ocfN at SmaI, generating plasmid pGG31. The kb EcoRI fragment of pGG31 harboring the ocfN gene disrupted by insertion of nptII was cloned into pBR325.sup.34 at the EcoRI site to generate pGG32. Mutagenesis of the ocfN gene was conducted via a marker exchange procedure as described previously.sup.35, to generate the mutant MS14GG88. PCR analysis and sequencing were used to verify the double crossover mutants. Production and purification of the antifungal were done as previously described..sup.23

[0072] NMR spectroscopy. A 2 mM sample of ocfN thioesterase mutant fraction of occidiofungin was prepared in dimethyl sulfoxide (DMSO-d6, Cambridge Isotopes) and data were collected as previously described for the wild-type fraction..sup.22 The NMR data were collected on a Bruker Advance DRX spectrometer, equipped with a CryoProbe, operating at a proton frequency of 600 MHz. The .sup.1H resonances were assigned according to standard methods.sup.36 using COSY (correlation spectroscopy), TOCSY (total correlation spectroscopy), NOESY (nuclear overhauser effect spectroscopy) and .sup.13C-HSQC (heteronuclear single quantum coherence) experiments. NMR experiments were collected at 25° C. The carrier frequency was centered on the residual water resonance (3.333 ppm), which was suppressed minimally using standard presaturation methods. A 2.0 s relaxation delay was used between scans. The TOCSY experiment was acquired with a 60 ms mixing time using the Bruker DIP SI-2 spinlock sequence. The NOESY experiment was acquired with 400 ms mixing time. The parameters for collecting the HSQC spectrum were optimized to observe aliphatic and aromatic CH groups. The spectral sweep width for the TOCSY and NOESY was 11.35 ppm in both dimensions. The spectral sweep widths for HSQC were 11.35 ppm in the proton dimensions and 0 and 85 ppm for the carbon dimension. All 2D data were collected with 2048 complex points in the acquisition dimension and 256 complex points for the indirect dimensions, except for the HSQC which was collected with 2048 and 128 complex points in the direct and indirect dimension, respectively. Phase sensitive indirect detection for NOESY, TOCSY, and COSY experiments was achieved using the standard Bruker pulse sequences. .sub.1H chemical shifts were referenced to the residual water peak (3.33 ppm). Data were processed with nmrPipe.sup.37 by first removing the residual water signal by deconvolution, multiplying the data in both dimensions by a squared sinebell function with 45 or 60 degree shifts (for the .sup.1H dimension of HSQC), zerofilling once, Fourier transformation, and baseline correction. Data were analyzed with the interactive computer program NMRView..sup.38 One-dimensional NMR temperature titrations were collected on the wild type and mutant peptides, using a Bruker AVANCE III HD 600 MHz spectrometer equipped with a cryoprobe. Eight scans were collected in each 1-D experiment, using 32K points, at a temperature of 298 K. The experiments were repeated using higher temperatures for both samples in 5 degrees K increments, up to a temperature of 323 K. 2-D TOCSY spectra were collected at a temperature of 323 K, using a mixing time of 60 milliseconds. Eight scans and 256 indirect points were used for both the wild type and mutant peptides. The 2-D spectra were processed using NMRPipe, with 45 degree sinebell squared shifts in both dimensions.

[0073] Mass Spectrometry. The wild-type occidiofungin and the ocfN mutant sample (10 μg) were evaporated to dryness in a Speed Vac Concentrator (ThermoScientific, San Jose, Calif.) and the residue was taken up in 50 μl methanol and analyzed by direct infusion at 3 μl/minutes into an LCQ DecaXP (ThermoScientific, San Jose, Calif.). Data were acquired over a mass range of m/z 200 to 2000.

[0074] In Vitro Susceptibility Testing. Microdilution broth susceptibility testing was performed in triplicate according to the CLSI M27-A3 method in RPMI (Roswell Park Memorial Institute) 1640 [buffered to a pH of 7.0 with MOPS (morpholinepropanesulfonic acid)] growth medium. 100× stock solutions of occidiofungin were prepared in dimethyl sulfoxide (DMSO). MIC endpoints for occidiofungin were determined by visual inspection and were based on the wells that had no visible growth (an optically clear well) after 24 hours of incubation. DMSO containing no antifungal agent was used as a negative control. Colony forming units (CFUs) were determined in triplicate by plating 100 μl from the MIC wells onto a Yeast Peptone Dextrose (YPD) plate as well as plating 100 μl from 10-fold serial dilutions of the cell suspension in Yeast Peptone Dextrose (YPD) Broth. Colony counts were performed and reported as CFUs/ml. Time-kill experiments were performed as previously reported..sup.19 Candida glabrata (ATCC 66032) colonies on 24-h-old YPD plates were suspended in 9 ml of sterile water. The density was adjusted to a 0.5 McFarland standard and was diluted 10-fold with RPMI 1640 medium to a final volume of 10 ml containing a final concentration of 2, 1, 0.5 and 0 μg/ml of occidiofungin from wild type strain MS14 and the ocfN mutant MS14GG88. The cultures were incubated at 35° C. with agitation. Samples were drawn, serially diluted, and plated on YPD medium for colony counts.

[0075] It should be understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and the scope of the appended claims. In addition, any elements or limitations of any invention or embodiment thereof disclosed herein can be combined with any and/or all other elements or limitations (individually or in any combination) or any other invention or embodiment thereof disclosed herein, and all such combinations are contemplated with the scope of the invention without limitation thereto.

TABLE-US-00002 TABLE 1 Chemical Shift Values for Occidiofungin derived from Unit No. δ.sub.C δ.sub.H Asn1 2 52.71, CH 4.59 2-NH 7.75 3  39.91, CH2 2.62, 2.41 4 — 4-NH2 7.39, 6.93 BHN1 2 58.47, CH 4.66, 4.61 2-NH 7.81, 7.9  3 75.01, C.sup.  3.98, 4.02 3-OH 4.66 4 — 4-NH2 7.24 NAA2 2  43.88, CH2 2.34, 2.36 3 47.25, CH 4.23 3-NH 7.31, 7.34 4  41.57, CH2 1.39, 1.76 5 66.36, CH 3.50 6 76.07, CH 3.08 7 79.61, CH 3.72 8  33.19, CH2 1.54 9-17 25.14-28.02, CH2  .sup.  1.27 18   16.94, CH3 0.86 Ser3 2 58.59, CH 4.07, 4.15 2-NH 8.11, 8.14 3  .sup. 70.23, 64.29 3.49, 3.45 3-OH 4.95 BHY4 2 58.71, CH 4.06, 4.15 2-NH 7.83, 7.94 3 73.75, CH 4.98, 5.08 3-OH 5.66, 5.73 4 — 5, 6 — 7.15 8, 9 — 6.67 DABA5 2 53.49, CH 4.43 2-NH2 7.66 3  32.68, CH2 1.88, 2.11 4  39.17, CH2 2.92 4, NH 7.71 Gly6 2  44.76, CH2 3.87, 3.58, 3.84, 3.70 2-NH 7.68, 7.85 Asn7 2 53.25, CH 4.51, 4.58 2-NH 8.35, 8.41 3  40.03, CH2 2.61, 2.38 4 — 4-NH2 7.39, 6.93 Ser8 2 58.11, CH 4.33, 4.32 2-NH 7.76, 7.78 3 64.59 3.61, 3.62 3-OH 4.79 .sup.a Proton chemical shift values are from a TOCSY and NOESY experiments. Chemical shifts in brackets are .sup.13C values from the HSQC experiment.

TABLE-US-00003 GenBank: EU938698.5 LOCUS EU938698 58101 bp DNA linear BCT 13-DEC-2010 DEFINITION Burkholderia contaminans strain MS14 putative FAD linked oxidase domain protein gene, partial cds; and putative LuxR-type regulator (ambR1), putative LuxR-type regulator (ambR2), putative cyclic peptide transporter, hypothetical protein, putative glycosyl transferase, putative nonribosomal peptide synthetases, putative beta-lactamase domain protein, putative beta-ketoacyl synthase nonribosomal peptide synthetase, putative short chain dehydrogenase/reductase SDR, putative beta-ketoacyl synthetase, putative taurine catabolism dioxygenase, putative transaminase, putative epemerase/dehydratase, putative thioesterase, and hypothetical protein genes, complete cds. ACCESSION EU938698 VERSION EU938698.5 GI:314950578 KEYWORDS . SOURCE Burkholderia contaminans ORGANISM Burkholderia contaminans Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderiacepacia complex. REFERENCE 1 (bases 1 to 58101) AUTHORS Gu,G., Smith,L., Wang,N., Wang,H. and Lu,S.E. TITLE Biosynthesis of an antifungal oligopeptide in Burkholderia contaminans strain M14 JOURNAL Biochem. Biophys. Res. Commun. 380 (2), 328-332 (2009) PUBMED 19167363 REFERENCE 2 (bases 1 to 58101) AUTHORS Gu,G., Wang,N., Chaney,N., Smith,L. and Lu,S.E. TITLE AmbR1 is a key transcriptional regulator for production of antifungal activity of Burkholderia contaminans strain MS14 JOURNAL FEMS Microbiol. Lett. 297 (1), 54-60 (2009) PUBMED 19500142 REFERENCE 3 (bases 1 to 58101) AUTHORS Gu,G., Smith,L., Wang,N., Wang,H. and Lu,S. TITLE Direct Submission JOURNAL Submitted (01-AUG-2008) Entomology and Plant Pathology, Mississippi State University, 32 Creelman St., Mississippi State, MS 39762, USA REFERENCE 4 (bases 1 to 58101) AUTHORS Gu,G., Smith,L., Wang,N., Wang,H. and Lu,S. TITLE Direct Submission JOURNAL Submitted (12-NOV-2008) Entomology and Plant Pathology, Mississippi State University, 32 Creelman St., Mississippi State, MS 39762, USA REMARK Sequence update by submitter REFERENCE 5 (bases 1 to 58101) AUTHORS Gu,G., Smith,L., Wang,N., Wang,H. and Lu,S. TITLE Direct Submission JOURNAL Submitted (15-JAN-2009) Entomology and Plant Pathology, Mississippi State University, 32 Creelman St., Mississippi State, MS 39762, USA REMARK Sequence update by submitter REFERENCE 6 (bases 1 to 58101) AUTHORS Gu,G., Smith,L., Wang,N., Wang,H. and Lu,S. TITLE Direct Submission JOURNAL Submitted (24-FEB-2009) Entomology and Plant Pathology, Mississippi State University, 32 Creelman St., Mississippi State, MS 39762, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 58101) AUTHORS Gu,G., Smith,L., Wang,N., Wang,H. and Lu,S. TITLE Direct Submission JOURNAL Submitted (13-DEC-2010) Entomology and Plant Pathology, Mississippi State University, 32 Creelman St., Mississippi State, MS 39762, USA REMARK Sequence update by submitter COMMENT On Dec 13, 2010 this sequence version replaced gi:224016442. FEATURES Location/Qualifiers source 1..58101 /organism = ″Burkholderia contaminans″ /mol_type = ″genomic DNA″/strain = ″MS14″ /db_xref = ″taxon:488447″ CDS complement(<1..1175) /note = ″ORF1″ /codon_start = 1 /transl_table = 11 /product = ″putative FAD linked oxidase domain protein″ /protein_id = ″ACN32485.1″ /db_xref = ″GI:224016443″ /translation = ″MSHDFRDEPAPRRAFLADMAKLAAAGIVTGWTPLYQVAAHARTA GETPPGFPADIQLYKQAFLNWSGEIAVQDVWTAAPRSADDVVATVNWARANGYRIRPR GYTHNWSPLTLDPGAGAANLVLLDTTKSLTAVSVDTSARPARVTAQTGVSLESLLATL EQVGLGVIAAPAPGDITLGGALAIDAHGTAVPAAGETLQPGHTYGSLSNLVVALTAVV FDPARQQYVLRRFERSDPEIGAFLAHIGRALVVEVTLTAGPNQRLRCQSYVDIPASEL FAAPGTTGRTIASFLDGSGRVEAIWFPFTTKPWLKVWTPTPSKPFLSRAVTQPYNYPF SDSISQSISDLVKRIVIGGEGALTPLFGQTQLAITTAGLALTLSGDIWGWSRTVLQE″ (SEQ ID NO: 5) gene 2480..3301 /gene = ″ambR1″ CDS 2480..3301 /gene = ″ambR1″ /note = ″AmbR1″ /codon_start = 1 /transl_table = 11 /product = ″putative LuxR-type regulator″ /protein_id = ″ACN32486.1″ /db_xref = ″GI:224016444″ /translation = ″MFAKLGKVISSAGSERFASDMHALLVESIPLTITRMTEWTLDEP AGEVVRVQSLGADGAPGDDGRGAPAAHGEREPAAHPPLNRILAACDRQLIHINPLMRR GNGGEVAPSRGPGGGFQCHLVSGKANRRYVISLHRTASHRDFSLREMSFLKNFADTLL PLVEWHASTCRHGEREGATAPGATAGMPGVEALRHEFESRLARARVVLSARENEVCLG LLAGKMLREMAGELGVKESTIETYIKRAAVKLGISGRHGLTKWMIDDSVPCASAA″ (SEQ ID NO: 6) gene complement(3372..4262) /gene = ″ambR2″ CDS complement(3372..4262) /gene = ″ambR2″ /note = ″AmbR2″ /codon_start = 1 /transl_table = 11 /product = ″putative LuxR-type regulator″ /protein_id = ″ACI01437.2″ /db_xref = ″GI:212381179″ /translation = ″MEFSRLFAHVGEAISSSGSRRFPRMMYNLIAAAVPVDEIRISEL AIDDVPDGPPEVRSLGAVGAALAKTGAAAVCCGPQMPPRPGTSPLHVDDTLAGHGPIH AQLDRFILMQAAIVSPRYAQFHLVTRKRGHCYVISLYRTCTFDDFSPQERTFLKELSH VLFPIVESHVAALDSAPPAARVTTAAPPATQSGRERVARRFADRLQQAGVKLSTREIE ACTALLAGDTVPAIAMRFALRESTVETYLKRAAVKLGFSGRHGLTRWMLDETAGAATE AAGGDMRSMRRDYASPRLGT″ (SEQ ID NO: 7) CDS complement(4466..6169) /note = ″ORF2″ /codon_start = 1 /transl_table = 11 /product = ″putative cyclic peptide transporter″ /protein_id = ″ACJ24909.2″ /db_xref = ″GI:220898663″ /translation = ″MDSAQSKSPPWHSAATLMWRSHPWLTLGTVVTGLVSGIASIAGV GLISTVLHDQDDRQTLLLLFIAVNVVAVVCRSCAAVMPSYACMKVMTRLRVNLCKRIL ATPLDEIDRRGAPNVLTMLTQDIPQLSQTLLTIPTIIVQSVVLICSIAYLAYLSWIVF ASTIILTLVGLVLYLFFYRKAVNFTERVRDEFVQFNEYTHGLVFGIKELKLNRARRRW FTRAAIELSSKRVAGFNYIERFWFMSGDSIGQITVAVLLGCLLFGVPSLGVVDPSVLT ASILAVLYMMGPLTMLINVLPVVAEGKTALARLAEFGFLIDDTQASHEEPRPAGNVET LSAKSWKVIELKDVTMNYRDNEASVDFVLGPIDMTIHAGELVYVIGGNGSGKSTLGKV LSGLYAPTGGTISLDGKVVDDAARERYRNLFSAVFTDFHLFNRIIGPDRGNESIELAR KYLATLKLADKIEISGRTYSTTRALSTGQRKRLALLCAYIEDRPIYILDEWAADQDPV FKRFSYEVLVPDLKSRGKCVVIITHDDQYFKLADRVIRLDSGRIFSDTAMCAVRAEAAG″ (SEQ ID NO: 8) CDS complement(6186..6668) /note = ″ORF3″ /codon_start = 1 /transl_table = 11 /product = ″hypothetical protein″ /protein_id = ″ACL81525.1″ /db_xref = ″GI:220898664″ /translation = ″MQLTTVDLEAAFVKAALDALHRDCKLGDAISLAYGKCESTAGVI DLIFPLITKKLRIDYILMYSIESNPRTLLQFLRQIESGLARSEDWTAASVEAALRSVA DSPDGVGWERAQRLLKCCILFSDSPLGIVESITFLGKHETSSRLRSAASNVELSHLIN″ (SEQ ID NO: 9) CDS complement(6722..7378) /note = ″ORF4″ /codon_start = 1 /transl_table = 11 /product = ″putative glycosyl transferase″ /protein_id = ″ACL81526.1″ /db_xref = ″GI:220898665″ /translation = ″MKSTPTIDNTFARKVCINLDRRPDRWEAMQRKFAEQNILTVERL PAVDARLVSVPESLSHMRAQDYGCTMSHLAAVKQAKAAGAREVLIFEDDAFFDADFAA RFPEFIAQVPDDWHMLFLGAYHFTPPIPVAPNIVKAVETLTAHAYVVRNSLYDAFIAI NENPPAINDRNNLVLQQTFNCYCFEPNLVGQESGYSDIMDEVMPEKPLTYSMPIPDGW″ (SEQ ID NO: 10) CDS complement(7375..16869) /note = ″ORF5″ /codon_start = 1 /transl_table = 11 /product = ″putative nonribosomal peptide synthetase″ /protein_id = ″ACL81527.1″ /db_xref = ″GI:220898666″ /translation = ″MQDNNVLVTDHRYAATARFWRESLSRVAGVYGIAAYAPSQQPGR PLTRSVRLTPASLDLLRRIGDGELAEFAVAAAGIAFLLWKYFRIPVTVLGTPGLAGHP SARAAIVPLIIEVRPDERIEDYLSRVAGIVEDSYAEPRFPLETLVRNEKDMALAQLTK VALADDRVHHAPTGRDDDLQLHLRLARGEIELRYSGAIEPFIIDGFAGSLAAVLEAFE HLDGAVGDIEAAPPEQGPLLAAFNETATAGPSHPTVVAMFEAQVARTPTAPALVTDSS LMTYADLNARANSLAHHLREHHGVGPESLVGIMLDRSEWMIVAILGILKAGAAFVPLD PAYPAERINHILGDTGLSLLVTQSSQLAQWYEFSGVTLLLDQELPGWQPLPDNPPHRA EPAHLAYVLYTSGSTGKPKGCLLEHRNLAHYIAWAAGYYFPESTTGSFGLYSSLCFDF TLTNIFCPLVRGKTLRIYPQSESIDTILARMFQPGSGVDTLKLTPTHIHLLEYMNLAR SGVRKVIVGGEELTPQHIATLRKIDPAIEIYNEYGPTEATVGCIVERVEDAPPTVLIG RPIADTRVYMLDDALRPVPLGVPGEICLAGAGLARGYHQRPDVTAAKFVEHPFPGEAR IYRTGDIGRWLPDGRIQCYGRVDHQVKIRGHRVELGEIEAAIAAHEDVVGAAVMLRES AHGVRKLAAYVKGAASLSVPNLRAYLAGKLPDYMVPSDIIPIAEFPLNANGKLDRPAL LALEPAAAPEEAPLDATPIQRELVRIWRDVLDNPAVDLAGRFFDYGGDSLQAMQLVSR IWSSFSVEIGIDAIFELQTISAVSDLIEASSPHPGSTAGAIPPRSRANDLPLSFPQQR LWFLAQLEGPSATYNISSALRFEGELDVARLRFAVSEISRRHEILRTTFPAVDGRGVQ RIAPPAPVALDVVDVASESDTLALLAEEADRPFDLAAGPLYRVVLYRVHERLHVFGIV MHHIVSDAWSSGILIGELAALYAGESLPELAVQYADYAVWQHERLASADTHRELALLS AALADAPDLIELPTDRPRPAVQQFRGAVLPFQLSAERADGLRAIARASGTSTFMVVLA AYALLLSRYSNQQDLVIGSPIANRRSSMTEPLIGFFANMLALRVDLSGNPTFGDLLAR VKRVALDGYSRQEIPFEQVVDSLELERNLGRTPVFQVVFAYEKAQPRAVSFPGLVATP VAVETHTAKFDLTLHVQDADDGLAGSLEYNLDLFDAATIDRMAEHFRTLVDAVIADPD RPLGALSLSNDAERNLLTVEWNRTDTDFGEDAAQPLHRLFEQQVERTPDAVAIVFDDT ALTYAELNLRANRLAHHLVALGVGPDSLVGVAMERSLDMSVALLAILKAGGAYVPVDP DYPAERVRFMIDHAQLRWLLTQQHLHDALPDTDAHVIVVDRDSLDLDAAATSNPAPAL NGDNLAYMIYTSGSTGRPKGALNTHRAITNRILWMQHAYALDADDAVLQKTPFSFDVS VWELFWPLVTGARLVFARPGGQRETDYLVELIERERITTIHFVPSMLRAFLDHPDLDA HCASLRRVVCSGEALPHDLQQRCLERLDVKLYNLYGPTEAAVDVTAWECRRDDPHRIV PIGRPIANTRLYIVDAQMQPTPIGVAGELLIGGTPVGRGYHGEPELSAEKFIADPFSA DPLARLYRTGDLARYRPDGNIEFLGRIDHQIKLRGLRIEPGEIEAALRAHPSVDDCVV IAKTEGARTFLIAYVATAAPDIADLRGYLGGKLADYMVPSQFFALESLPMLPNGKINR KALPLPADRGDAAQPHAPAVTPREILLASICIDVLQLPSVGIHDNFFELGGDSILSIQ VIARANQAGLRVTAKQLFQYQTIAQLAAAPEERAACAPTLSPLGDAPLTPVQHWFFEQ EIDAPSHYNQTVLIQVPADIDASRLADAFRQVYEHHDALRLRFSHDAGRWTQQVVAGG EMPALFAKQVIADDAGERLAAMRAAAADAERGIDITHGPLLAARLFCLADEPLARLFV SIHHLAVDGVSWRVLLEDLHAAYHGQPLPGKTTSFREWALHLQQLARSPAIGDEARLW QALLAQPVEPMPVDYPGTGAANNAVDDASSVSFELGEADTTALLRRLPRAYDTRINDV LLVALAQACSMVTGNTRTRIDLESHGRHVSDAPLDLTRTVGWFTSIYPVVLDADAMHA PEQALRAARQQLRRIPADGLGYSLLRYQSPDAAVRDSLAALPKADILFNYHGQLDTVL RQSDGWRPAAEDLGSLRAGRSQRTHAFEIVAAVADGKLQVDWRYGERLHRRQTVENLA AHFRDRLLDFAASVPDTAADDIEDSYPLSSLQQGILFHSLYDLDPAAYFQQFSFVVSG PLQVPALRQAWANALARHAVLRTAFAWADRDHPVQTVRHTVDLPWTFLDWRHRDASRR AQDFDAFLADDRRRGFDLQRAPLFRCTLIQETDTRHRFCWSAHHIILDGWSTATLMKE VFDDYLSLARTGMPAVAASAPGYRAYIDWLARHPRSADETWWRAELAGFKAATPVAAS PARQATGDAPRQDKRRTQQFLLDEALAARLQTLTRTHRVTLNVLIRAVWALVLRRHAG TDDVVFGVTVSGRPPMLDGVESIVGLFINTLPLRLRIAPERPFIEWLAEVHAAQTAME PHSYSSLVDIQSWSELPAGDSLFDSLLVFENFPVAAAPDLGPDDIEILDTRAFAESNY PLTLTVHPNERIGFHISHDAHRIAPEVVRQMLDTLRTLLERFAENPGQLTGQLADPPA ADGRPSAPRSGAGPAIEAAAGAAAAARAVAHAADESTLLEIWRRIFKRDDIAVSDNYF DLGGHSIIAIQLMAHVEKAFDRRLPISCLFENPTIEKLAAALAAKEPSAPAGGLVPIR DGGPAAPLFLLPGAGGNVVYFRPLANHLSGAHAIHGLEALGLDGACEPLTRVEDIAAR HIERIWPLVGAGPYYLAGHSFGAHVALEMSRQLVAKGADVKLLAIFDASAPIDSSAAT YWQDWDDTEWLVAIAHEIGTFLGTDLQVTRADLVHLDPDGQAGLILERIGDRGSWFAD AGSDRLRAYLRVYQANFKSHYAPHATPLPVPIALFRSTERDPGDYAPSSEIAQLRLDA TWGWSRFSAHPVAVTDVPGDHLTMLLDPHAGVLAAHVNSFLEKTPS″ (SEQ ID NO: 11) CDS complement(16957..26022) /note = ″ORF6″ /codon_start = 1 /transl_table = 11 /product = ″putative nonribosomal peptide synthetase″ /protein_id = ″ACL81528.1″ /db_xref = ″GI:220898667″ /translation = ″MQEGMLFHAVHEPGSRSSFNQLSCRITGSLDPALFHAAWQQLID RHPVMRTSFHWEEFDKPMQVVHARATLPWVQDDWLDLPEHEQRSRWRAHLDNDLAEGF ALDRAPLVRCRLVRVAADAYLFSWSHHHILADGWCLSLVIEEIFEVYGALARGVSPAL PPVRPYRDYIQWLQQHEPQAAQQYWTRYLEGFRTPTPLPTAARAGADERFGQGLAQVQ ADLSADLSARLRQFAARHHVTLNTLAQAAWALVLSRYSGETDVVFGAVVSGRGANLPG IETMLGLFINTVPVRVRVDPRQPLVPWLKMIQARVAARAPFEHTPLPDIQRCSDVPPT APLFESNITFMNYPLDASLTHGAHGLAVDEVQLYNRADIPLEFVVTARDDWKMELSFD PRRFDEDTMQRMLGHVAATLDAFAADPNRLLGRVPILPDAERRQLLETFNDTAVPFDA ALTVVHRLEQAAADHPERPAVEYRDGVLSAGELNARANRIAHRLLAAADLGPDALVAI CMHRSAQLMEAILAVWKCGAAYIPVDPNYPVARIRTILEDSGAALVITCDGLLPPELA GIALVVSLDAATDAVDDSNPGRPVSPDSLAYVIYTSGSTGKPKGAMVEHAGMLNHMLA EIDEFSISASSVIAQTAPHCFDISVWQFFTAPLVGGKTVIVDDDCIRDPARFVAYLET TRISILELVPSYLSAVLDRASERPALMRHLRHLLVTGEMVSPALVKQWFDVFPAIPLV NAYGPAEASDDVAQHRMTGAPSTPYVPVGKPIRNVRLYVVDPQMNLCPIGIPGELCVS GVAVGRGYLNNEAATQDAFVEDPFHPQRGVRLYRTRDIGCYLPDGTIVLHGRKDHQLK IRGYRIELGEIDQRRLADHSRKLRQAAALDYRDEAGRAALCAYVAFRDGASLSDAGIA AALSATLPDYMVPGIYVVLDALPLSGNGKIDRNALPPLDRARLAATAHAPTPPRTPTE TLLCRIWGEALGIPSPGIHDNLFALGGDSILSMRIVSLAAKAGLKLTTRLIFQHPTVA ELAAVATRGTVGAAAFVASSGPLPLTPIQKRFFAQGKHDPDQYNQAVLLDVPADLDPV LLRQALRHAVKWHDALRLRFREGESGWTQEVVDDPEIPVVVSDIARDQLAQYVAQSHA SLNLADGPVVRADLFRVDEGRSLRLLLVAHHLVVDGVSWGALLETVYDAYTRLRNGKA PEFAGGSATWTAWTRAISTWAGSGAADADLAHWQALARAALPGLPLDRDAPADANTVS SADTIVVELGEAATTALLGAAPRAYDAQVNDVLLAALARAVSEWSGCADVLLDLEAHG REELIDALDISRTVGWFTSVFPVLLTVDAGSHDPASLVASVRTRLRAVPNAGITYGLL LDRLDGPLPQPRLQFNYLGQTDQLFTAARDWKQAAEPSGDGRNANQLREHLLDINAYV TGNRLHVAWEFSRACHDTATILRVAQAYIAALETLVAGHAVPSASTRPATALPQAPAP ASVSPDEIADVYPLTPTQQGMLFHSLYEPASDAYFSSLNFRIDGALDVERFRRAWETV AHRHDILRTSFHWEDIESPVQVVHRRIDLPWHDEDLRAASAAEAEQRWEAYVAQDRAR GFDFTRAPLMRLALFRVGEHAWRFHWSHHHILLDGWSSARLLSDVAAAYQAPPAEGAP QRDAPPAFAGYVRWLARQDAAAAQRFWKTKLADFPATTPLVLGRPELDGTAAPGAYVE EPLLLSESDTQRLVAFAQSRRLTLNTLAQGAWAQLLSRYSGESDVVFGTIVSGRPASL PASDEMVGLFINTLPVRVRIDARPTSAWLAQLQMDLAQQEDYAHYPLADIQKFAGLPP GVPLFESLLIFQNYPVEEALADALPGLRIGAFEVSDPNNYPLTLVVTPGKRLSLQVLY DDGRFDRDTIVRLLRHVETLLTGLAGAEDRPNRSVPLLAAAERDAILLGWNDTFAPVP SDRTLPELIEAVAAAHPERVAVRCGTEVRTYRDLVEGANRIAAHLLQTAPLQPDDRIA VWMPRSPLMLETILAIWKCGAAYVPVDPAYPAQRVETILTLARPAVIVTTDCVPPPAL ASIPLVDPARLPDRRGAEAPAPVTPRCRPADLAYVIFTSGSTGQPKGAMVEHRGMLNH VLAMARRVGLGAQSAVAQTASHCSDISVWQCFAALASGGTTVIYPDAVILEPARLIDS LHRDRITAMQFVPSYLATFLGELERHAAPAFPHLDTLLTIGETLQPATAQAWFRLNPA VRLINAYGPTEASDSVAHYCLTRAPDGPAIPIGRPIENLRLYVVDADMNPCPAGVKGE ICIGGVGVGRGYLFDEARTRAVFRDDPFSPEPGARLYRTGDIGCFGADGNLHFFGRRD FQVKIRGYRIELGEIEAALTSLAGISHAVVVARETSDAEMTLCGYASGTGWTPQRVRD ALRDTLPAHMVPDTVMLLPALPVMPNGKINRAALPLPDAASVPDGVRAEPRTPVEAAL LRLFAEVLGRRPNGVDDDFFEHGGQSLKAIQMVSRIPRAALNVAVADIFHAPTPRALA QRLAAMPVDGAADDDAIIPALAAQPSYAVSRAQKRIWLASRGADPSTYNMAGALQLDG AVDTARLVRAFDTLVDRHESLRTVFAMIEGELRQRVLSREASGFRVEQRDLADDAGPQ AIDALIRAECEQPFDLASGPLFRVKLVRLSQEKHLLLLNMHHVISDAWSIRVLTDDLH ALYAGRDLPPLSIQYRDYAAWHNASLAGPRAAAHRAYWLEQLAPPLPRLQLASDFPRP ERLGHAGQTLEVELPQPHAAELATLARAHHTSLHAVLLASFCVLMHRYTGREDIVIGS VSAGRDSEQLESQVGVYLNTVVLRVPVRKSATVAEVIDGVAKASAQALEHASYPFDVL LEDLKIRTPANHFPIFDIQVNHVSMPAPQPGLRITDISPADTTAKFDLSFQVVESEGR HLIQFIYNTHLFRPSTIAAMRDRLLAIHDVFRRDPATPVDRIPLSDEAPAAGPRVRVG LRLKRAPAVTADDALEEKT″ (SEQ ID NO: 12) CDS complement(26061..29981) /note = ″ORF7″ /codon_start = 1 /transl_table = 11 /product = ″putative nonribosomal peptide synthetase″ /protein_id = ″ACN32487.1″ /db_xref = ″GI:224016445″ /translation = ″MSELNLNALSTSGQYQEHVAFWNDALGRIDEDFRLQQAWQAYAL PLGPEPALTFALDGDAAQVLERLAAGNELGAFVVLLAALFRVLGRYNGAAGLFVASPQ LIVEPASGCAEPVPLLDAGEPGPTVRAYLNQLRDSVQRSYSYQDFPIAALAHKLHGER RATNVGVRFDGLHEAWAAADYDLSIEIRHRERYEIVLTGRPTVFTLHYLQHVARHLRN VVAGFGALDAPLDTVSLLDDEERARLRSHAAPVAVQGTFLEQFAQRVAAAPDSVAVVT ADASLTYAELDDQASRLASFLLAEYAIERGDVVGVVADRSERWIVGMLGALKAGAVYL PLDPEFPRERLRFMIEDAKVKALLTHSEHLPLLADFWAIPMFALDFQLDTLAPASASA QVEVRPDDAAYIIYTSGSTGVPKGVVLEHAGLLNMAQYHVDAFGFDSADRFVQFYSPG FDGSIMEIFVTLLAGARLVLAKTAVIRDVPRFVDYIAQQGVTTVNATPAYLAALDWHA LGAVKRVISAGDSARVADLRELARTRTCHNSYGPTEATVCIADYVVDPAITYGARLPV GRPIHNTHLYLLDEHGALAPEGCAGEICVSGIALARGYVGRDDLTAAAFVAHPFEAGE RLYRTGDLGVWLPDGNLEVTGRRDTQVKIRGYRIEMGEIEAALRQHAGVADAIVFVRE DTPQHKQLVACVATATASVASLREHLKERLPEFMVPASIVTLERLPLTPNGKPDRKAL AALELAPAPSETAYVAPANDVEARLGRIMCDVLGREPIGVHDNFFELGGDSILIIQVM SLAQQVGLKFTADQFFAHPTIAELAQVATEAPSIRIAQEPVVGPAPLTPIQHWFFAQD VADPHHYNQSTMIEVPASLRPDTIERALAAVATHHDALRLSFACVAGVWQQSHAAPPL AIPLGVTSLADAAPAARQAAMLATATGMQESFTLSAPPLLRAHLFQFGPDAPQRLLAV AHHLVIDGVSWRILFEDLYTACRQLEAGDAVQLPARTTAWRDWSTRLSGLGATALDGL GLDYWLQGNAGEPACFDDMPAGTVAEAGSTIVEFDAQQTLALLQDVPRAFNTQINEVL LTALLLAFGDWTGNASLVVDLEGHGREDIFDGVDTSRTIGWFTTHYPVCLNAGDATVA VDALRHVKEQLRAVPMRGLGYGIARYLGHDAGIAAALERQPPAPVRFNYLGQVDRVLP DDTGWKPVLDFQSPEHSPRARRGHLFEIDGMVFDGRLRLTWHYNREACAPGVIEQLTQ CYRSRLLSIVAAGGDGPRALSPSDFPAARISQEALDALVSRIKS″ (SEQ ID NO: 13) CDS complement(29969..31585) /note = ″ORF8″ /codon_start = 1 /transl_table = 11 /product = ″putative beta-lactamase domain protein″ /protein_id = ″ACN32488.1″ /db_xref = ″GI:224016446″ /translation = ″MTISSSAQVYLRQNIQFEPLINSWYAWYHTLPPLTAALNVAERF LPLLKSYAASPMMHAAACKDPAMRGGPFLDLGGQRVDEIRTLIEQTTQRATRQLELAK AYKAFSTLLLERATGMASDPLYPEIPEVLKGYVEIYYDLNHNPSFRVFESLLYASPFY ARDAQSIALSAIEEHTPRPFILSTPRLRDERTVFSNMAFDDRALDTLFRMRDTPGSYA KIVDLMRVEEKDEPLFRSFFVEEAPAPKPDRSFDGDDIRIRYYGHACVLIQSRGVSIL IDPVISYGYDTALPRYTFADLPDQIDYVLITHSHHDHIVLETLLQLRHKVKTVVVGRN LDGFPQDPSMELALRKLGFDDVLEVRDAQEIKVPGGAITAIPFMGEHNDLAIHSKQSF MIRFGSRSVLCIADSCNLDPRLYEHVFRLAGKPDTLFVGMETEGAPPSWVYGPLFPKA LPRDIDQSRRARGCQFGEAAALVDDFAFNAAYVYAMGQEPWLNHLLDNTFDENSPSHI QSTQFVAHCKAKGIASEILYATREIVLCQN″ (SEQ ID NO: 14) CDS complement(31596..45005) /note = ″ORF9″ /codon_start = 1 /transl_table = 11 /product = ″putative beta-ketoacyl synthase nonribosomal peptide synthetase″ /protein_id = ″ACN32489.1″ /db_xref = ″GI:224016447″ /translation = ″MNAKATHALKAALDELRLRRAEIAALRSDRNEPIAVIGMACRFP GRSDTPDAFWQLLDGAHDAVTEVPGERWDIDRYYDPDPSTPGKMATRHGAFLERVDQF DAAFFGIAPREATYLDPQQRLLLEVAWEALENAHLAPERFRQSATGVYVGITCFDHAI QVSNASMPSSSYAGTGSALNMAAGRLSFVLGLTGPSMAIDTACSSSLVCLHLACESLR SRESNMALAGGVNLMLSPEVMVSFSQARMLSPDGRCKTFDAAADGYVRGEGCGMVVLK RLADALADGDRVLGIVRGTAVDQGGAGGGLTVPSRDSQERVIRRALNQAGLAPGDVSY VEAHGTGTSLGDPIEVEALAGVYGPGRAANEPLVIGSVKTNIGHLESASGIAGLIKVL LSFEHDRIPAHLHFTQPNPHTPWQDIPIRVAADPVAWRRGERRRIAGVSAFGFSGTNA HAIVEEPPVAPAHAAQRALLLLSARSEAALAALVPRYERAIAGATPQELAAICRAAAT GRSHYPFRAAYVSGARVASAAAPRTGKALRMGEGEGVPDTGVAHALHASEPLFRDAFA RCSVPLDALETDAGRFAIQFAWAELWKGWGLRPAVVSGHGIGEYVAACVAGVVSVADA LRLVAARSDAEALRAVLRDMPLARPSVRLISGYLGTDVTDEVTHPQYWLQLAGASDQA DASHPPEGLADGWLPPPCAGDALERALAALYVQGAQFDWRALFPAPAQPATTLPNYPF ERQRFSLEKIPSPIVGMDAGSIDAALRHLKSSGKYPEDMLNAFPDLLRTAFAAAETVA SNAHPLYHVVWEQQAAMPAAPAAADASPWLIFADASGVGERLAALLRARGASCSLVRP GIDYVTGAEAGWQVAPERPDDFVRLLNETAASGQRIVFLWALDEAVGETRMSAALLHL VHALVGSEREWTPSTRPRISVVTRDAVEAGEAPHVSGLAQAALSGLARGAMIEHPEWF GTAIDLDPAAPENETQALLQEMLGESREEQVALRHGARHVARLSPLAPAETAALPVDP DAAYLITGGFGALGLHTARWLAARGAGTLILVGRQGAASDESQRAIAELRERNVTLRC ERLDIADPAAVAAFFAALRRDGVPLKGIVHAAGIVGYKPIMQVERDELDAVLQPKVAG AWLLHQQSEHFPLDFFLLFSSIASAWGSREQAHYSAANRFLDALAHHRRGQGLPALSV NWGPWAEGGMTFPEAEALLRRVGIRSLAADRALDVLNRLPAVPQVAVVDIDLALFQGS YEARGPKPFLDHVRVAKSAPSAPAMPALSDASPRERKRLLADSIDRAVAQVLGYDAGT LDRDLGFFEMGMDSLMALDVRTHLENALGIPLSVALLFDHPTVNALADFLAEQASGTA QAQTVPPQQQPRPIAPAIEARDAGTPEPIAIVGMSCRFPGAAHDLDAYWNLLNDGVDA ISEVPRERWDVDAYYDPDPEAPGRMYSREGGELDDVDQFDPAFFRITPREAAAMDPQQ RLLLEVSHEALEHAGIPVDSLKGSRTGVFVGITTNDYANLQLRNGGGSGIDGYFFTGN PLNTAAGRISYGLGVQGPSMAIDTACSSSLTAIHTASQNLRSGECDLAIAGGVNLILS PDNSIAVSRTRALAPDGRCKTFDAAADGFVRSEGCGALVLKRLSDALAAGDRVLAVLR GSAVNHDGASSGETAPNGRAQEAVIRQALGGLPAASIDYVEAHGTGTPLGDPVELQAL ATVFGAGRDAGRRLRVGSVKTNIGHTESAAGIAGVIKVVLSLNHDRLPAHLHFRQPSP LVQWDAMPVEICAEASAWPRGERPRRAGVSAFGASGTNAHLVLEEAPAPARQATPSRH KVHPLVLSAKTPAALRELAGRYQRRLEAEPGLDIAAVAFSAATGRSHFAHRLAWPVTS LDDAIDKLRAFHAKEPAGAAQPAPRVKMAFLFTGQGSQYAGMGRRLYDAYPVERDAID RCRAVADPLLDKPLLEVLSAQGEDIHQTGYSQPALFSLQYALTTLLASFGVVPDAVMG HSVGEYAAACAAGVFSPEDGLRLIAERGRLMQALPRDGEMAAIFTDLATVERAIDAWP HEVAVAAVNGPASIVISGKRERIAMLVDAFAARDIRSVPLNTSHAFHSPLLEPMLDSF QLAAKTVPVARPAIPFYSNLTGAVMDEAPTDTYWRRHCREPVQFASSVERLAEAGFNV LVEIGPKPVLVNLARACCAPDAGIQFLALQRPQVEQQALIETLSSLYARGVDVDWAPT ETPAPARIALPSYPFQRSRTWFQKADTSMTQTSASPIAAAPTHNRSGEILEWLRGKIG ELIQADPATINIELPFLEMGADSIVLIEAIRHIEAEYGVKLAMRRFFEDLATVQALAE YVADNLPAAAAPSGAEAVAVAVAAAEPSTPAVAVTPSAAGLAPLAAAPAEWVAAEGGS TVERVLREQNQLLSHVMSQQMELLRTSLTGQPGVRPATAAVQAVASTASVAPKAASAA PAAAPAAKPAPAAAAAPAADNPPPKPMMPWGSPVQQRARGLSAAQQEHLEALIVRYTT RTRKSKDSVQASRPVLADSRATVGFRFSTKEMLYPIVGDRAAGSRLWDIDGNEYIDFT MGFGVHLFGHTPDFIQQQVTREWQRPLELGARSSLVGEVAARFARVTGLDRVAFSNTG TEAVMTAMRLARAVTGRDKIVMFTHSYHGHADGTLAAANAEGVTETIAPGVPFGSVEN MILLDYGSDAALEAIRGMASTLAAVMVEPVQSRNPSLQPVAFLKELRRITEEAGVALI FDEMITGFRVHPGGSQAMFGIRADLATYGKIIGGGLPLGVIAGTSRFMDAIDGGMWTY GDHSFPAADRTAFGGTFCQYPLAMAAALAVLEKIEQEGPALQAALNERTAQIAGTLNA FFAEAEAPIKVTWFGSMFRFEFTENLDLFFYHMLEKGIYIWEWRTCFLSTAHTDADID RFIRAVKDSVADLRRGGFIRPHSKHGTVAALSEAQRQLWVLSEIDPEGSLAYNVNTTL ELNGRLDEAAMRAAVQSLVDRHEALRTTVMADGSGQIVHPSLTLEIPLIDTDPNAWRE QESRQPFDLVNGPLFRAALVRLGSERHLLVMTAHHIICDGSTFGVLLEDLARAYAGAA PADAPLQFRAYLKQLDGQRHSPETKANREYWLAQCARQAAPLNLPVDYPRPAVKTFHG ERVSLHLDAATAATLRTAARQNGCTLYMVLLAGFNLFLHRVAGQQEIVTGIPVTGRSV AGSDRLAGYCTHLLPLHSTLPEQATVASFLAGTRQNLLDALEHQDYPFAELVREIGAQ RDLNAAPLVSAVFNLEPVSALPELPGLTVGLVAPLIRHTAFDLNVNVLDAGQALLIDC DYNTDLFDASTVQRFLDIYRTLLTHLADDASAAVARLPLSSDAERNLLTVEWNRTDTD FGEDAAQPLHRLFEQQVERTPDAVAIVFDDTALTYAELNLRANRLAHHLVALGVGPDS LVGVAMERSLDMSVALLAILKAGGAYVPVDPDYPAERVRFMIDHAQLRWLLTQQHLHD ALPDTDAHVIVVDRDSLDLDAAATSNPAPALNGDNLAYMIYTSGSTGRPKGALNTHRA ITNRILWMQHAYALGADDAVLQKTPFSFDVSVWELFWPLVTGARLVFARPGGQRETDY LVELIERERITTIHFVPSMLRAFLDHPDLDAHCASLRRVVCSGEALPHDLQQRCLERL DVELYNLYGPTEAAVDVTAWECRRDDPHRIVPIGRPIANTRLYIVDAQMQPTPIGVAG ELLIGGTPVGRGYHGEPELSAEKFIADPFSADPLARLYRTGDLARYRPDGNIEFLGRI DHQIKLRGLRIEPGEIEAALTSHPLVDAAVVALRGVDDGARLVGWLCSSHPEAELIEA VRGHLRQRLPDYMVPSAFVVVSAFEHLPNGKLDRTRLPEPGDGLDHVAPVNALEAQLA AIWQEVLGQARISTTGNFFDLGGNSLLATKVVARIRRDLHVKLEIRSLFALPTISSLA KRIADTQPIDYAPVTPLPAQASYALSPAQTRLWVQDRLHAAQAEGPLPTSLLFEGVLD VDALVRAFRALSERHEILRTRFVLEGNQPVQHVLPPGEAAFPVEIVDLQDAEDRDAQA AAIQASERLVPMDLATGPLFRVKLLRLSEVRHVCLCTMHHIVSDGWSTEVLLDDLSAL YDAFVQRRDDPLPALPIQYKDYAGWLNRLLAGPDGARMKDYWLTKLGGGLRALELPGD VEQPAAPSWKSWRFDLPAAETAALESLGKRHGATLFIALLSAIKALFYRRSGQEDIVV GTPVAGRELPELESQVGPYLNVLALRDRVAGDDRFDTLLTRVRDTTLEAFSHPLYPLD RLLDELHIKRVAGRNPLFDIGLTLQNQRHGPVDRYAGQVHIAELPDHDPQRADTEAAT DFWFLAEPHAEGLAIRVVYHAGRFSEALVQGLANELTSVIGEVLANPGVRIRNLTLGQ RALHAEARQPTVELSAF″ (SEQ ID NO: 15) CDS complement(45002..48325) /note = ″ORF10″ /codon_start = 1 /transl_table = 11 /product = ″putative short chain dehydrogenase/reductase SDR″ /protein_id = ″ADT64845.1″ /db_xref = ″GI:314954101″ /translation = ″MKFGLMFFASSEEALSGNKYQLVMESARFADANGFSSVWVPERH FTEFGSLYPNPAVLHAALAAATQRVKLVAGSVVAALHNPIRIAEEWSMVDNLSNGRVG VSFASGWNPDDFVFAPDKYATRQDDMLTTMRAVQHLWRGGTLDATNGVGKPVRLRVYP TPVQPELPVWVTAASNPQTFVRAGEAGANLLTHVLDQDRDQLAHKIALYREARAKHGF DPAAGTVSVMLHTFVGDDAAQAREQARVPFCNYIRSNIGLLNGLAQSRGQSVDVRAMG ARELDEFVEFLYERFAQSRGLIGTPETCVELVRDLESIGVDEVACLLDFGPPVERILG NLPQLRRLREMCAPRRSAAPTRFDAAEVQARCTETTSGADFNGEIRQHGVQIDGVFDA IRQIWRTTGEALGKISLPADALASSPYQVHPAFLDACSRVLAAAIDPDALESGDLYLP SSIGAVRVHQPPASTEAWSHATLRTPIGQGALEGDIRVHDLAGRLLIEIDALRLQQVR AARAVERHDFAALLYQRVWRPSNVDAATGGSAHGEWLILADRGGVGAQLSALLEAHGD TCTLRFADATPELPAADRPLKGVIHLWSLDLAPSDIAARRRASASVLHLVRALASRAP SARQARLWLVTSGAMNVLDGESIAVAQAPLWGLGRAIAVEHAALWGGLVDLDPEQPSA ADIMQAVQAGGREDMIAFRRDQRYVARIARDNREYVSHRPIRFHGDATYLVTGGLGGL GLRLASWLADNGAGKIVLLGRGEPSAAAGKILRTLDARFIRADLSRREDVGQALGEIA HSMPPLKGIFHLAGALDDALLTRQDDDFFHRAGSGKADGAWYLHELTAGLPLDHFVLF SSMAALITMPGQGNYAAANSFLDALAQHRRAQGKPGLSVNWGPWAEIGHAATDYGRRA HEQLGALGVGTLPPELAIATLERLMASGVAQSGVARIDWPTLFRVDAPAAGSALFSEL TQPAAQPAQQETALLRQLHACAPRERVERITDTLAAMLAETLRLSGPDAIAPEQSLLD LGLDSLVALELTDRLTKVFGRPFRATLFFSYPNLQTLAQYVLNELSPSLPAPVVDEAS DDLDEDDLSELIAQEIGAQ″ (SEQ ID NO: 16) CDS complement(48322..52749) /note = ″ORF11″ /codon_start = 1 /transl_table = 11 /product = ″putative beta-ketoacyl synthetase″ /protein_id = ″ADT64846.1″ /db_xref = ″GI:314954102″ /translation = ″MLPDTKFRTVTEILLFRGKVEPEKTAFIFLENGEAELTRLTFGD LDKRARGIAARLQAIAQPGDRVLLVYPPGLEFICAWVGCLYAGLIGVPAYPPRRHRPA DRLKAIVADATPVVALTDAATLDGIAHHADGYSDTLELKILATDQRFDAPAEQWRAPD ITPQTLALLQYTSGSTGTPKGVMISHANILSNMAVIAEASDADASTVFVSWLPVFHDM GFFGKVLLPIYLGVLSVLMAPAAFVQKPVRWLQAITKYRGTHCAAPDFAYDLCARKIA DEARAQLDLSSWRVAFNGAEPVRAESVARFSRAFAACGFHAHTMRPVYGMAEATLFIS GQPARSLPRVADYDADALAQGVATRNDSGKRHALVSCGRTWAEHRVRIVNPDTGERCA PGRIGEIWLTGPSVGVGYWNRIDETERTFRAKLDGDDARYLRTGDLGFVDGEDLFVTG RLKDLIIVAGRNHYPQDLEQSAEGSHPALAPNASAAFSIHVDNVERVVVACEVRREAL NTLDAEAVAAEIRHTLAEVHDVDLYAAVLLKPATILRTSSGKIQRSRIRQAFLDEQGL AIAGEWRRAFSAPPAPPQTAEPRDTQALVQWCIERVSRLSGIASGKIDPDAPFSVHGL DSKDAIMLSGELQDWLGRPVSPTVVYDFPSISLLARHLSGTGSAMPDQAPGSAEARAD IAIVGMGCRFPGAGNPDAFWQLLLEGRDAVGAATQRAADLPLAGLLDQVDQFDAAFFG ISAREAESMDPQQRLLLEVAWETLEHAGIAPRSLAGGRTAVIVGISNSDYIRLAQDEV ADVGPYVATGNALSVAANRISYALDLRGPSWAVDTACSSSLVAVHQACRALQRGESDA ALAGGVNLILAPQLSASFTQAGMLSPDGRCKAFDAAANGYVRGEGVGMVLLKRLDDAL ENGDTVFAVIRGSAVNQDGRSNGLTAPNGPAQQAVIHGALRDAGVRAQDIGFVETHGT GTPLGDPIELNSLAAVLNESRRPDDLCWIGSVKTNIGHLESAAGIASLIKTALALHHR AIPPNLHFRSINPQIALDGTPFRIPRQVTPWHSEHGPRLAGVSSFGFGGTNAHLILSE APGLPEIEAEPVAPAARVVTLSARTPDALQALAASYAAYLDAHPEAGVRDVAFTANTG RTHFTQRAAIVAPSRDSLRAQLDSVSSGEPAETPPAVTFHFCADDGASADAVRQLRAA SPAFDALMQRQSDASGAPALAPDEAGFTRFQRALAQLWMSFGIAPDAVSSTGDGQRAA AAWAGVPQAPDSGAAGHPGIVIDIGAHTAAWDAILHTLAALYVRGASIDWDAVEQGAP HRRLALPTYPFERRGFWIRPHARRHPLLGRLMEQHAHAPATWIWQSRLDAPATNFLDG HRVKGSPVLPYSAFVEMALSATSEIGAAGHTTLKDLALHAPLPLHPHESHTVQTVLSR RSWGPFSFAVYHRIDDTRAAATWQMCASAEIHESDRSHA″ (SEQ ID NO: 17) CDS complement(52936..53922) /note = ″ORF12″ /codon_start = 1 /transl_table = 11 /product = ″putative taurine catabolism dioxygenase″ /protein_id = ″ADT64847.1″ /db_xref = ″GI:314954103″ /translation = ″MLGMTERKLLAEGSTPWLLEPVSNGRDLAQAVNDNRAALESRLL EHGVLLFRGFDVSSVGGFEAFARAISAHQSDYVYRSTPRTSIGNGIFTATEYPPSETI ALHCENAYQRSWPLRVAFCCLTPAATGGETPIADMREVSRRIGPRILDHFEARQVRYV RHYRRHVDIPWETVFQTSDRNQVAAFCADNGIALEWLDDDTLRTAQINQGVAYHPVTG ERVFFNQAHLFHISNLEASLASSIVSLFGEDRIPRNACHGDGSPFDLADLEQIRHAFR ECAITFPWQRGDVLLVDNMRFAHGRNPFEGERKVVVSLLDPYTPDIEGIADR″ (SEQ ID NO: 18) CDS complement(53999..55369) /note = ″ORF13″ /codon_start = 1 /transl_table = 11 /product = ″putative transaminase″ /protein_id = ″ADT64848.1″ /db_xref = ″GI:314954104″ /translation = ″MKRFSCASVHQSALQAGSARMEKLEYLKQVESNARTYATSFPRL FTHAKGIRVRDADGQEYIDCLSNAGTLALGHNHPEVNEAVMRFLSSDQMQQALDLATP AKHAFVEQLFSLLPGKIAESGKIQFCSPSGADGVEAAIKLTRHYTGRPTIMAFHGAYH GMTSGALAASGNLTPKSAGGNGRDVHFLPYPYAFRCPFGTDGSATDQLSINYIRTVLS DPESGITKPAAIIVEVVQGEGGCIPAPDTWLIELRELTLRHEIPLIVDEVQTGLGRTG ALFAIEHSGIRPDVLVLSKAFGGGYPLSVVVYDERLDTWPPGAHAGTFRGNQIAMVAG LSTMRIVEREDLSAHADRVGKLLVAGLEELAERFPCLGQIRGRGLMIGAEVVVPGTHG RAGPPHTERARAIKQNCLRNGLIVETGGRNGAVLRFLPPLIVSEADIHDILNRFEHAV ETACRA″ (SEQ ID NO: 19) CDS complement(55516..56466) /note = ″ORF14″ /codon_start = 1 /transl_table = 11 /product = ″putative epemerase/dehydratase″ /protein_id = ″ADT64849.1″ /db_xref = ″GI:314954105″ /translation = ″MQRNRKRILVTGGAGFLGSHLCERLVELGHDVLCVDNYFTGTKQ NVATLLGNPSFEALRHDVTFPLYVEVDEIYNLACPASPIHYQFDPVQTTKTSVMGAIN MLGLAKRTHARVLQTSTSEVYGDPDVHPQPESYRGNVNPLGPRACYDEGKRCAETLFF DYHRQQNVRIKVVRIFNTYGPRMHPNDGRVVSNFIVQALRGEDITLYGDGSQTRAFCY VDDMVDGLIRMMATPAELTGPINLGNPHEIAVSELAQIILRLTGSKSRLVFRPLPKDD PTQRCPDISLARTHLDWEPTIGLEAGLQRTIDYFCSTLAA″ (SEQ ID NO: 20) CDS complement(56622..57341) /note = ″ORF15″ /codon_start = 1 /transl_table = 11 /product = ″putative thioesterase″ /protein_id = ″ADT64850.1″ /db_xref = ″GI:314954106″ /translation = ″MRLICFPYAGGSAAVYRTLQASLPGIEVCRHELAGRGSRLSEPA VRDMATLVDTLLCDLDDCFDRPFALLGHSMGAAIAAELALRLPAHARPNLRHLFVSAR AAPGKERHDRRMQALDDRAFIDALREMGGTPKAVLDNSELMALLMPALRADFTMIENH RPVPGPRLAVDITAFAGRADKEIPVDAVAGWGAATTGRFDFHVIEGDHFFLRNEMRTM AGIIAARMRRPEHAASSALQA″ (SEQ ID NO: 21) CDS 57710..57997 /note = ″ORF16″ /codon_start = 1 /transl_table = 11 /product = ″hypothetical protein″ /protein_id = ″ADT64851.1″ /db_xref = ″GI:314954107″ /translation = ″MQHRQKAVPTQQVANERVIVTEWRFAPGAETGWHVHRHDYVVVP QTDGQLLLETAQGNRESQLHAGRSYAGLKGVEHNVVNATDHEVVFVEVEIL″ (SEQ ID NO: 22) ORIGIN 1 aattcctgca gcacggtgcg cgaccagccc cagatgtccc cgctgagcgt gagtgcgaga 61 ccggccgtcg tgatggccag ctgcgtctgg ccgaacagcg gcgtcaatgc gccttcgccg 121 ccgatcacga tccgcttgac gagatccgag atggactgcg agatcgaatc ggagaacgga 181 tagttgtacg gctgcgtgac ggcgcgcgac aggaacggct tgctgggcgt cggcgtccag 241 accttgagcc acggcttggt cgtgaacggg aaccagatgg cttccacccg gcccgagccg 301 tcgagaaacg atgcgatcgt gcggcccgtc gtgccgggcg cggcgaacag ttcggaggcc 361 ggaatatcga cgtagctctg gcagcgtagc cgctggttcg gccctgccgt Cagcgtgact 421 tcgacgacga gcgctcgccc gatgtgcgcg aggaacgcgc cgatctcggg atcgctgcgc 481 tcgaaccggc gcagcacgta ttgctgccgg gccggatcga acacgaccgc cgtgagcgcg 541 accacgagat tgctcagcga gccgtaggta tggcccggtt gcaaggtttc accggccgcg 601 ggcacggcgg tgccgtgtgc atcgatcgcg agcgcgccgc cgagcgtgat gtcgcccggt 661 gccggcgcgg caatcacgcc gaggccaacc tgctcgagcg tcgcgagcag cgactccagc 721 gagacgcccg tttgggcggt gacgcgcgcc ggacgcgccg acgtgtcgac ggagacggcc 781 gtcagcgact tcgtcgtatc gagcagcacg aggttcgcgg cgccggcgcc cgggtccagc 841 gtcagcggcg accagttgtg cgtgtagccg cgcgggcgta tccgatagcc gtttgcgcgc 901 gcccagttga cggttgcgac gacgtcgtcg gcggagcgcg gcgcggcggt ccatacgtcc 961 tgcacggcga tctcgccgct ccagttcagg aacgcctgct tgtaaagctg gatgtcggcc 1021 gggaagccgg gcggtgtctc gccggccgtt cgcgcgtgcg ccgcaacctg gtagagcggt 1081 gtccagccgg tgacgatgcc ggccgccgcg agcttcgcca tgtcggccag gaaggcgcga 1141 cgcggcgcag gttcgtctct gaagtcgtga ctcatggtgt gctccaattt ttcggaattg 1201 ttttgcagat tggaaagacg acaaatgacg cgttgagact cgtgtggcaa ttcgagcagg 1261 tgcgacgcgc gggaagtgtt gcgcgtgggt gggccaggat tgaaaaaaga cggtgcgttc 1321 ggcaatgcgc ggccgcacat catcacggac gtctaatagg aaatcggaaa accgcctggc 1381 gattgcttta attggccgtc ggccggttct gtcggcaagc agatagggag attcgacgga 1441 atcgcgcgcg gcgaagcgct agccgtggcg atcgataaaa gatgatttca cgtgaatatt 1501 aatcttcatg tttcgatttt taaataaacc cggccgcagt tcaaggttga ttgacgatgc 1561 gtcatgcatt tcggtcgaaa gcgtagcaat ttatctatcg ggtgacaagc ggcggagttg 1621 acgaattccg agtcatttaa tatggaaatt ttatgacggg aaatggcttc gtccgttgtg 1681 ggtattttgc aacgcggctg ccggtgtcgc gccacgtggg cttggagcgc aaattatgct 1741 ttgccgtcgc gtatattgaa tcgattgttg agcgaatcga aataacgtcc ggaagacaat 1801 agctgaagcc gggtcgatga gcgggaggta gggtgaaatc cgataattcc tctctcgaat 1861 aacgctcctg gatgaaaatt cgtggtatgc gtcgcccggg tgattattac aaaagttcgt 1921 ggtaaacgga tgtcgattta tcggtgtatt cataataatg ccaatgagcg gctcgcgaat 1981 tgattgattt ccggttcgtg aaagatgtgt tttaaaaaaa tagatgtcgg gctgactgca 2041 aatgtctgaa tcgtcgctat catacgcggc tgggatatac atggatcaaa ttcaatggaa 2101 agaatcgttt cgctttttga tcgcgatttt tctttgaatt cgccgggaac gcgcccgctt 2161 cgagccggcg ccgggttttc cgattcaggt ttcaggcacg tccggcggcg gcgcgttttc 2221 atccggcaac gcgaatcggc cgaaatggac gtttcagcct tttgcggctt cgcgagtcgc 2281 ccgcatcggg ctgaactggg aacggcacgc cgtcgtctcg catgagccgg acgcatcggc 2341 gcgcgctggc ggcggcgcgt tgcccgcctg aaaaaggcgc gcgacgcagc gcgacccgac 2401 gcgcgccgcg caaaccgtgc cggttcgccg gcgcttgcgt tgtgccaggt cctcaagcac 2461 gcacaacaag gagagtcaga tgttcgcgaa gctcgggaag gtgatttcga gcgcaggcag 3781 acgtgcgaga gttccttgag gaaggtccgc tcctgcggcg agaaatcgtc gaacgtacag 3841 gtgcgataca acgagatcac gtaacagtgg ccccgcttgc gggtcacgag gtggaattgc 3901 gcgtagcgcg gcgacacgat cgccgcctgc atgaggatga agcggtcgag ctgcgcgtgg 3961 atcgggccgt ggccggcgag cgtgtcgtcg acgtgcaggg ggctcgtgcc cgggcgcggc 4021 ggcatctgcg gcccgcaaca gacagcggcc gcgccggtct tcgcgagcgc cgcgccgacc 4081 gcgccgaggc tgcgcacctc gggagggccg tccggcacgt cgtcgatcgc aagctccgaa 4141 atgcggatct cgtcgacggg gaccgccgcg gcgatcaggt tgtacatcat ccggggaaaa 4201 cgtcggctcc cgctgctcga gatcgcttcg ccgacgtgtg cgaacaatct gctgaactcc 4261 atgaagggat tcctgatgag acgttgaagc tgcgcttgtg cgcatgaatg ccgacatgat 4321 ttaaacaccc ggttgcgaac gcgtctgtaa cggattgccg ggacagacgc aacattgccg 4381 gccgtcgaag ccggtacggc gcacggcgac cgttgcgccc gtctgcgacg gatggcgcgc 4441 accttgtccg agtccggatc gctgctcatc cggctgcctc ggcccggacg gcacacatgg 4501 ccgtatcgga gaagatgcgg ccgctatcca ggcgaatgac ccgatccgcc agcttgaagt 4561 actgatcgtc gtgggtgatg atgacaacgc atttcccgcg tgatttcaga tcgggaacca 4621 gcacttcata ggaaaatcgc ttgaacaccg gatcctgatc ggcggcccat tcgtccagga 4681 tataaatcgg acgatcctcg atgtacgcgc aaagcagcgc caagcgcttg cgttgccctg 4741 tcgataacgc gcgggtggtc gagtaggtcc ggccggaaat ctcgatcttg tccgccagtt 4801 tcagggtggc gaggtatttc cgggcaagct cgatgctttc attgccccga tccggtccga 4861 tgatgcgatt gaacaaatgg aaatcggtga agacggcgga aaacaggttt cggtagcgtt 4921 ccctcgcagc gtcgtcaacg acttttccgt cgagggaaat cgtgccgccg gtaggcgcat 4981 agaggccgct gaggaccttg ccaagcgtgc tcttgccgct gccgtttccg ccgatcacgt 5041 agacgagttc tccggcatga atcgtcatgt cgatggggcc gagcacgaag tcgaccgatg 5101 cttcattgtc acggtagttc atcgtcacgt ctttcaactc gatgaccttc catgacttgg 5161 ccgacagggt ttccacgttg cccgcagggc gcggttcctc gtgtgaggcc tgcgtgtcgt 5221 cgatcagaaa gccgaattcc gccagccggg cgagcgcggt cttgccttcg gccaccaccg 5281 gcagaacatt gatcagcatg gtcaagggcc ccatcatgta gagcacggcc agaatgctcg 5341 ccgtgagtac ggagggatcc acgacgccca gagaaggtac gccgaacagc aggcatccga 5401 gcaggaccgc tacggtgatc tggccgatgc tgtcgccgct catgaaccag aagcgttcta 5461 tgtaattgaa tcccgccacg cgcttcgacg acaattcgat cgcggcgcgg gtaaaccagc 5521 gtcgcctggc ccggttgagc ttgagctcct tgatgccgaa cacgaggcca tgtgtgtatt 5581 cgttgaactg gacgaattca tcgcgaaccc gctccgtaaa attgaccgcc ttccgataga 5641 aaaacagata aagcaccagg ccgacgaggg tcaggatgat cgtcgacgcg aacacgatcc 5701 acgagagata ggcgagatag gcgatgctgc agatcaggac gactgattga acgatgatcg 5761 tcgggatggt cagcagggtc tggctcagtt gcggaatgtc ctgtgtcagc atggtcagca 5821 cattgggggc gccgcgtctg tcgatttcat ccagcggggt tgccaggatc cgtttgcaca 5881 ggttgacgcg caacctcgtc atgactttca tgcaggcata ggagggcatc acggcggcgc 5941 agctcctgca gaccaccgcg acgacattca ccgcgatgaa cagcagcaac agcgtctggc 6001 gatcatcctg gtcgtgcagc acggtgctga tcaacccgac gcccgcgatc gacgcgatgc 6061 cgctgacgag gcccgtcacg accgtgccca gcgtcagcca gggatgactg cgccacatca 6121 gggtggcggc ggaatgccat ggcggcgatt tgctttgagc ggaatccatg agtggccaat 6181 aggtctcagt tgatcaggtg gctgagttcg acattgcttg ccgctgatct caacctcgac 6241 gaggtttcgt gcttgcccag gaacgtgatg ctttccacga ttcccagcgg cgaatcggaa 6301 aacaggatgc agcacttcag caggcgctgc gcacgctccc agccgacgcc gtccggtgaa 6361 tcggccacgc ttcgcaacgc ggcctcgacc gaggcggccg tccagtcttc gctccgtgcc 6421 agccccgact cgatctgccg aagaaattgc aggagcgtgc ggggattgct ttcgatgctg 6481 tacatgagga tgtaatcgat ccgcagtttc ttcgtgatca gcggaaaaat caggtcgatc 6541 acgccggcgg tcgattcgca tttcccatat gccagtgaaa tcgcgtcgcc gagcttgcag 6601 tcccggtgaa gcgcatccag cgcggccttg acgaacgccg cttcgaggtc aacggtggtg 6661 agttgcatga tgttcagtgg cctgtcgagt gttggatcgc ggcgagcacg ggcggcaggc 6721 gttaccagcc gtccggaatg ggcatggaat aggtcagcgg cttctccggc atcacttcgt 6781 ccatgatgtc ggagtagccg gactcctgtc cgaccagatt cggctcgaag cagtagcaat 6841 tgaacgtctg ctgcaggacg aggttgttgc ggtcgttgat cgccggcggg ttttcgttga 6901 tcgcgatgaa tgcgtcgtaa agcgagttcc tgacgacgta cgcgtgcgcg gtgagcgtct 6961 ccacggcctt gacgatgttc ggcgcgacgg gaatcggcgg cgtgaagtga tacgcgccca 7021 ggaacagcat gtgccagtcg tccggcactt gcgcgatgaa ctcgggaaag cgcgcggcga 7081 aatcggcgtc gaagaacgcg tcgtcctcga agatcaggac ttctctcgca ccggcggcct 7141 tcgcctgttt caccgcggcg agatggctca tcgtgcagcc gtagtcctgc gcacgcatat 7201 ggctcaacga ttccggcacg ctcaccagcc ttgcatcgac ggcaggcagc cgttccaccg 7261 tgaggatgtt ctgctctgcg aattttcgtt gcatcgcttc ccagcggtcg gggcgccggt 7321 ccaggttgat gcagaccttg cgggcaaaag tattgtcgat cgtcggcgtt gatttcatga 7381 gggcgttttt tccagaaacg aattgacatg ggcggcgagg acaccggcat gcggatcgag 7441 cagcatggtc aggtggtcgc cggggacgtc cgtcaccgcg acggggtgcg ccgagaagcg 7501 agaccatccc caggtcgcgt ccaggcgaag ctgcgcgatc tcggacgacg gcgcgtagtc 7561 gccgggatcg cgctcggtgc tgcggaacaa cgcgatcggc acgggcagcg gggtggcgtg 7621 cggcgcgtag tgcgacttga agttggcctg atagacgcgc aggtaggcgc gcaggcggtc 7681 ggacccggcg tccgcgaacc agctgccgcg gtcgccgatc cgttcgagga tcaggccggc 7741 ctggccgtcg ggatcgagat ggacgaggtc cgctcgcgtc acctgaaggt cggtcccgag 7801 gaaggtgccg atttcgtggg cgatcgcgac cagccattcg gtgtcgtccc agtcctgcca 7861 gtaagtggcg gccgagctgt cgatgggcgc ggacgcgtcg aagatcgcca gcaatttcac 7921 gtcggcgccc ttggcgacca gttgcctgct catttcgagc gccacgtgcg cgccgaacga 7981 gtggcccgcc aggtagtacg gacccgcgcc caccagcggc cagatgcgtt cgatatgacg 8041 ggccgcgatg tcttccacgc gggtgagcgg ctcgcacgcg ccgtcgaggc cgagcgcttc 8101 cagcccgtga atcgcgtgag cgccgctcag gtggttcgcg agcgggcgga agtagaccac 8161 gttcccgccg gcgcccggca gcaggaagag cggcgcggcg gggccgccgt cgcgaatcgg 8221 cacgagcccg ccggcgggcg cggacggttc tttcgcggcc agcgccgccg ccagtttctc 8281 gatcgtcgga ttctcgaaga gacaggaaat cggcagcctg cgatcgaacg ccttctcgac 8341 atgggccatc agctggatcg cgatgatcga gtggccgccc aggtcgaaat agttgtcgct 8401 gaccgcgatg tcgtctcttt tgaagatccg ccgccagatc tccagcaacg tgctttcgtc 8461 cgccgcatgc gcgacggcgc gcgccgccgc ggccgcaccg gcagcggctt cgatggccgg 8521 cccggccccg ctgcgcggcg cgctcggccg gccgtcggcg gccggcggat cggcgagctg 8581 gccggtcaac tggcccgggt tctcggcgaa tcgctcgagc aacgtgcgga gggtatcgag 8641 catctgccgc acgacctccg gcgcgatgcg gtgggcatcg tgcgaaatat ggaagccgat 8701 gcgctcgttc gggtgcacgg tcagggtcag cgggtagttc gattccgcga acgcgcgggt 8761 gtcgaggatc tcgatgtcgt ccggcccgag atcgggggcg gcggcaaccg ggaagttctc 8821 gaagaccagc aggctgtcga acagactgtc gccggcgggc agttcgctcc acgactggat 8881 atcgaccagc gagctgtacg aatgcggctc catcgccgtc tgggctgcgt ggacctctgc 8941 cagccattcg atgaacgggc gctcgggcgc gatccgcagg cgcagcggca gcgtgttgat 9001 gaacagcccc acgatcgact cgacgccgtc gagcatcggc gggcgaccgg acacggtgac 9061 gccgaagacg acgtcgtccg ttccggcgtg gcgccgcagc accaacgccc agaccgcgcg 9121 gatcagcacg ttgagggtga cgcgatgcgt gcgcgtgagc gtttgcagcc gcgcggccag 9181 cgcctcgtcc agcaggaatt gctgggtccg gcgcttgtcc tgccgcgggg catcgccggt 9241 cgcctgccgg gccggactgg ccgcgaccgg cgtggcggcc ttgaagccgg ccagttcggc 9301 gcgccaccac gtttcgtcgg ccgagcgagg atgacgcgcg agccagtcga tgtacgcgcg 9361 gtatcccggc gccgacgccg cgaccgcggg catgccggtg cgggcgagcg acaggtagtc 9421 gtcgaacacc tccttcatca gggtcgcggt gctccagccg tcgaggatga tgtggtgcgc 9481 gctccagcag aagcgatggc gcgtgtccgt ttcctggatc agcgtgcagc ggaacaacgg 9541 cgcgcgctgc agatcgaagc cgcgccgccg gtcgtcggcg aggaacgcat cgaaatcctg 9601 cgcgcggcgg gacgcatcgc ggtgccgcca gtcaaggaac gtccatggca ggtcgaccgt 9661 gtgccgtacg gtctggacgg gatggtcgcg atcggcccac gcgaacgcgg tgcgcagcac 9721 ggcatggcgc gcgagcgcat tggcccacgc ctgccggagc gccggcacct ggagcgggcc 9781 gctgacgaca aagctgaact gctggaagta ggcggcagga tccaggtcgt acagcgaatg 9841 gaacaggatg ccctgttgca gcgacgagag cggatagctg tcctcgatat cgtccgctgc 9901 ggtgtcgggg accgacgccg cgaagtcgag caaccggtcc ctgaagtgcg cggccaggtt 9961 ctcgaccgtc tgccgccggt ggagccgctc gccgtagcgc cagtccacct ggagcttgcc 10021 gtcggcaacg gccgcgacga tctcgaaggc atgcgtgcgc tgcgaccgcc cggcgcgcag 10081 cgaaccgagg tcttcggccg ccgggcgcca gccatcggat tgccgcaata cggtatcgag 10141 ctgcccgtga tagttgaaga ggatatcggc cttcggcaac gcggcgagac tgtcgcgcac 10201 ggcggcgtcg gggctctggt agcggagcag cgaataaccg agaccgtcgg ccggaatccg 10261 gcgcagctgc tgccgtgcgg cacgcagcgc ttgctccggc gcgtgcatcg cgtcggcgtc 10321 gagcacgacg gggtagatgg acgtgaacca gcccaccgtc cgggtgaggt cgagcggcgc 10381 atccgacacg tggcggccgt gactctcgag atcgatccgc gtgcgggtgt tacccgtgac 10441 catgctgcag gcttgcgcga gcgcgacgag caggacgtcg ttgatgcggg tgtcgtaggc 10501 ccgcggcagc cggcgcagca acgcggtggt atcggcttcg cccagctcga atgaaacgga 10561 cgacgcgtcg tcgactgcgt tgttggccgc gcccgtgcct ggatagtcaa ccggcatcgg 10621 ctcgacgggc tgcgcgagga gggcttgcca cagccgtgct tcgtcgccga tggcgggcga 10681 ccgggccagt tgctgcagat gcaacgccca ttcgcggaac gaagtcgtct tcccgggcaa 10741 cggctggccg tggtaagcgg catgcaggtc ctcgagaagc acgcgccatg acacgccgtc 10801 caccgccagg tgatggatcg acacgaacag gcgggcgagc ggctcgtcgg ccaggcagaa 10861 gagccgggcc gccagcaacg ggccatgcgt gatgtcgatg ccgcgctccg cgtcagcggc 10921 ggcggcacgc atcgccgcca ggcgctcgcc tgcgtcgtcg gcgatcacct gtttcgcaaa 10981 gagcgccggc atctcgccgc cggcgacgac ctgctgggtc cagcggcccg catcgtgcga 11041 gaaacgcagt cgcaacgcat cgtgatgttc gtagacctgc cggaacgcgt cggccagcct 11101 cgatgcgtcg atatccgccg gcacctggat caggaccgtc tggttgtagt gcgacggcgc 11161 atcgatctcc tgttcgaaga accagtgctg caccggcgta agcggcgcat cgcccagcgg 11221 gctcaaggtc ggcgcgcagg ctgcccgctc ctcgggcgcg gcggccagct gcgcgatcgt 11281 ctgatactgg aacagctgct tcgccgtcac gcgcagccct gcctgattgg cgcgcgcgat 11341 cacctggatg ctcaggatcg agtcgccgcc gagttcgaag aaattgtcgt ggatgccgac 11401 ggaaggcaac tgcagcacgt ctatgcagat cgacgccagc aggatttccc gcggcgtgac 11461 ggcaggtgca tgcggctggg ccgcgtcgcc ccgatccgcc ggaagcggca gcgccttgcg 11521 gttgatcttg ccgttgggca gcatcggcaa ggattcaagg gcgaagaact gcgacggcac 11581 catgtagtcg gcgagcttgc cgcccagata gccgcgcaga tcggcgatgt ccggcgcggc 11641 ggtcgcgaca taggcgatca ggaacgttcg ggctccttcg gttttcgcga tcacgacgca 11701 gtcgtcgacc gacggatgcg cgcgcagcgc cgcctcgatt tcaccgggtt cgatgcgcag 11761 gccgcgcagc ttgatctggt gatcgatgcg gccgaggaac tcgatgttgc cgtcgggccg 11821 gtagcgcgcg aggtcgccgg tgcggtagag gcgcgcgagc gggtcggccg agaacggatc 11881 ggcgatgaac ttttcggcgc tcagttcggg ttcgccgtgg tagccgcgcc cgaccggtgt 11941 gccgccgatc agcaattcgc cggccacgcc gatcggcgtg ggctgcatct gcgcgtcgac 12001 gatgtagagg cgggtgttgg cgatgggccg gccgatcggc acgatgcggt gcggatcgtc 12061 gcgccggcat tcccacgcgg tcacgtcgac ggcggcctcg gtggggccgt agaggttgta 12121 gagcttgacg tccaggcgct cgaggcaacg ctgctgcagg tcatggggca aggcctcgcc 12181 gctgcacacg acgcggcgca gcgacgcgca gtgcgcgtcg aggtccggat gatcgaggaa 12241 cgcgcgcagc atcgacggca cgaaatggat cgtggtgatg cgttcgcgct cgatgagctc 12301 gaccaggtag tcggtctcgc gctggccgcc ggggcgggcg aacacgaggc gcgcgccggt 12361 gacgagcggc cagaagagtt cccagaccga gacgtcgaag ctgaacgggg tcttctgcag 12421 cacggcatcg tcggcgtcga gcgcataggc gtgctgcatc cagaggatgc ggttggtgat 12481 cgcgcgatgg gtgttgagcg cgcccttggg gcggccggtc gagccggacg tgtagatcat 12541 gtaggcgagg ttgtcgccgt tcagcgcggg tgcggggttg gacgtcgccg cggcgtcgag 12601 gtcgagcgag tcgcgatcga cgacgatcac gtgcgcgtcg gtgtcgggca gcgcgtcgtg 12661 cagatgctgc tgggtgagga gccagcgcaa ctgcgcgtgg tcgatcatga agcgcacgcg 12721 ctcggcgggg tagtcggggt cgacggggac gtaggcgccg ccggccttga ggatcgcgag 12781 cagggcaacg ctcatgtcga gcgaacgctc catggcgacg ccgacgagcg agtcggggcc 12841 gacgccgagc gcgacgaggt ggtgggcgag gcggttggcg cgcaggttga gttcggcgta 12901 ggtgagcgcg gtgtcatcga agacgatcgc gacggcatcg ggcgtgcgct cgacctgctg 12961 ctcgaacagg cggtgcagcg gttgcgcggc gtcctcgccg aaatccgtgt cggtgcggtt 13021 ccactcgacg gtcagcaggt tccgctccgc gtcattcgac aacgacagcg cgccgagcgg 13081 ccggtccgga tcggcgatca cggcatcgac gagcgtgcgg aagtgttccg ccatgcgatc 13141 gatcgtggcg gcgtcgaaca gatccaggtt gtattccagc gagcccgcga ggccgtcgtc 13201 ggcatcctga acatgaagcg tgaggtcgaa cttcgcggtg tgggtctcca ccgccaccgg 13261 cgtggccacg agaccgggga agctcactgc ccggggttgc gctttctcgt atgcgaacac 13321 gacctggaac accggcgtgc ggcccaggtt gcgttcgagc tcgagcgagt ccaccacctg 13381 ctcgaacgga atctcctggc ggctgtagcc gtccagcgcg acgcgcttca cgcgcgccag 13441 caggtcgccg aaggtcggat tgcccgacag gtccacgcgc agcgcgagca tgttcgcgaa 13501 gaagccgatc agcggctcgg tcatgctgga acgccgattg gcgatcgggg agccgatgac 13561 gaggtcctgc tggttgctgt atcgcgacag gagcagcgca tacgcggcga gcacgaccat 13621 gaacgtgctg gtgccggacg cacgggcaat cgcgcgcagg ccgtcggcgc gttcggcgct 13681 cagctggaac ggcaggaccg cgccgcggaa ctgctggacg gcgggccggg ggcggtcggt 13741 gggcagttcg atcaggtccg gcgcgtccgc cagcgcggcg ctcaggagcg ccagctcccg 13801 atgcgtgtcg gcggacgcca ggcgctcgtg ctgccacacg gcgtagtccg cgtactgcac 13861 ggccagttcc ggcagcgact cgccggcata gagcgcggcc agttcgccga tgaggatgcc 13921 tgacgaccat gcatcggaaa cgatgtgatg catcacgatg ccgaagacgt gcaggcgctc 13981 atggacgcga tacagcacga cgcgatagag cggcccggcg gcgagatcga acgggcggtc 14041 ggcttcctcc gcgagcagcg cgagcgtgtc ggattcgctg gcgacgtcga cgacgtcgag 14101 cgcgaccggc gccggcggcg caatgcgttg aaccccgcgg ccgtcgacgg cgggaaacgt 14161 cgtgcgcagg atctcgtgac gccggctgat ctcggacacg gcaaaccgca ggcgcgcgac 14221 gtcgagttcg ccttcgaagc gcagcgcgct cgagatgttg taggtggccg acgggccttc 14281 cagttgcgcg aggaaccaca gccgctgctg cggaaaggac agcggcaggt cgttcgcgcg 14341 cgagcggggc gggatggcgc cggccgtcga gccggggtgg ggcgacgacg cttcgatcag 14401 gtcggacacc gcgctgatgg tctggagttc gaagatcgcg tcgatgccga tctcgacgga 14461 gaagctgctc cagatccgcg agaccagttg catggcttgc agcgaatcgc cgccgtagtc 14521 gaagaagcgg ccggcgagat cgacggccgg attgtcgagc acgtcgcgcc agatgcgcac 14581 cagttcgcgc tgaatcggcg tggcgtcgag aggggcttcc tcgggcgcgg cggcaggctc 14641 cagggccagg agcgccgggc gatccagctt gccgttggcg ttgagcggga attcggcgat 14701 cgggatgatg tcggacggga ccatgtagtc cggcagcttc ccggccaggt aggcccgcag 14761 gttcggcacg ctcaggctcg cggcgccctt gacgtaggcc gccagcttgc gcaccccgtg 14821 ggcggattcg cgcagcatga ccgccgcgcc gacgacgtcc tcgtgcgcgg cgatcgcggc 14881 ctcgatctcg ccgagttcga cacggtgccc gcggatcttg acctggtggt cgacgcgtcc 14941 gtagcactgg atacgtccgt cgggcagcca ccggccgatg tcgccggtgc gatagatgcg 15001 cgcttcgccg ggaaacggat gctcgacgaa tttcgcggcg gtgacgtcgg gccgctggtg 15061 gtagccgcgt gcaaggccgg cgccggcgag gcagatttcc ccgggcacgc cgagcggaac 15121 cggccgcagc gcgtcgtcga gcatgtacac ccgggtgtcg gcgatgggac ggccgatcag 15181 caccgtgggc ggcgcgtcct cgacgcgctc gacgatgcag ccgaccgtcg cctcggtggg 15241 accgtactcg ttgtagattt cgatcgcggg atcgatcttg cgcagcgtgg cgatgtgctg 15301 gggcgtcagt tcctcgccgc ccacgatcac cttgcgcacg ccggagcgtg ccaggttcat 15361 gtattccagc aggtgaatgt gggtgggcgt gagcttgagg gtgtcgacgc cgctgccggg 15421 ctggaacatc cgggccagga tggtgtcgat gctttccgac tgcggataga tgcgcagcgt 15481 cttgccgcgc accagcgggc agaagatgtt ggtgagcgtg aagtcgaagc agagcgagct 15541 gtacaggccg aaactgccgg tcgtgctttc cggaaagtaa tacccggcgg cccacgcgat 15601 gtagtgggcc aggttccggt gttcgagcag gcagcctttg ggtttcccgg tcgagcccga 15661 cgtgtagagc acgtaggcca ggtgcgccgg ttcggcacgg tgcggcgggt tgtccggcag 15721 cggctgccag ccggggagtt cctggtccag cagcagcgtc acgccggaga attcatacca 15781 ctgcgcgagc tgactcgact gggtcaccag cagcgacagg cccgtgtcgc cgaggatgtg 15841 attgatccgc tcggccggat acgcggggtc cagcggaacg aacgccgccc ccgccttcag 15901 gatgccgaga atcgcgacga tcatccattc ggaacggtcg agcatgatgc cgaccagcga 15961 ttccggcccg acgccgtggt gttcgcgcaa gtgatgcgcg aggctgttgg cccgcgcgtt 16021 caggtcggcg taggtcatca gcgaactgtc ggtgaccagg gccggcgccg tcggcgtgcg 16081 tgcgacctgg gcttcgaaca tggcgacgac cgtcgggtgg ctggggccgg ccgtcgcggt 16141 ttcgttgaac gcggccagca gcgggccctg ttccggcggg gccgcttcga tgtcgccgac 16201 ggcgccgtcg aggtgttcga atgcctccag caccgcggcg aggctgccgg cgaaaccgtc 16261 gatgatgaaa ggctcgatgg ccccgctgta acgaagctcg atttcgccgc gcgcgagccg 16321 caggtgcaac tgcagatcgt cgtcccgacc ggtcggtgcg tggtgcacgc ggtcgtccgc 16381 cagcgcgact ttcgtgagct gcgcgagcgc catgtccttt tcgttgcgca cgagcgtttc 16441 cagcgggaat cgaggctcgg cgtagctgtc ttccacgatc ccggccacgc gcgacaggta 16501 gtcctcgatg cgctcgtcgg ggcggacctc gatgatcagc ggaacgatgg cggcccgggc 16561 cgacggatgc ccggccagcc ccggcgtgcc gagcaccgtg accggaatcc ggaagtattt 16621 ccagagcagg aacgcgatgc ccgccgccgc gacggcgaat tcggcaagct cgccgtcgcc 16681 gatgcgccgc aacaggtcga gcgacgcggg cgtgagccgc accgagcggg tcagcgggcg 16741 acccggctgc tggctcgggg cgtacgccgc gattccgtac acgccggcga cccgggaaag 16801 gctttcgcgc cagaaacgcg cggtggctgc atagcgatgg tcggtgacca gcacgttatt 16861 gtcttgcaca ggaaactcct tgagacgttt tgttcacctg aaacaacctg aagcagcacg 16921 cacggcgcgc gccgctcgaa ccccggcggg cgcgcatcac gtcttctcct cgagcgcgtc 16981 gtcggccgtg accgcgggcg cgcgcttcag gcgcaggccg acccggactc gcgggccggc 17041 ggcgggcgcc tcgtcggaga gcgggatgcg atcgaccggc gtggccggat cgcgacggaa 17101 gacgtcgtgg atcgcgagca gtcgatcgcg catcgcggcg atggtcgacg ggcggaacag 17161 gtgggtgttg tagatgaact ggatcaggtg ccggccttcg ctttccacga cctggaagga 17221 caggtcgaac ttggccgtcg tgtccgccgg cgagatgtcc gtgatgcgaa ggcctggctg 17281 cggcgccggc atcgacacgt ggttcacctg aatgtcgaag atcgggaaat ggttcgccgg 17341 cgtgcggatc ttcaggtctt ccagcaacac gtcgaacgga taggacgcat gctccagcgc 17401 ttgcgcggag gctttcgcca ccccgtcgat cacctccgcg accgtcgcgg atttccgcac 17461 cggcacgcgc agcacgacgg tgttgaggta cacgccgacc tgcgattcga gctgctcgct 17521 gtcgcgcccg gccgacacgc tgccgatgac gatgtcctca cgccccgtgt agcggtgcat 17581 cagcacgcag aacgacgcca gtagcaccgc gtggagcgac gtgtggtgag cgcgggccag 17641 cgtcgcgagt tccgccgcgt gcggctgcgg cagttcgact tcgagcgtct gcccggcatg 17701 accgagccgc tcgggacgcg ggaagtcgga tgccagttgc aggcggggca gcggcggcgc 17761 cagttgctcg agccagtacg cgcgatgcgc ggcggcgcgc ggacccgcga ggctcgcgtt 17821 gtgccacgcg gcgtagtcgc gatactggat cgacagcggc ggcaggtcgc gccccgcata 17881 cagcgcatgc aggtcgtcgg tcagcacgcg gatcgaccat gcatccgaga tcacgtggtg 17941 catgttcagc agcaacagat gcttctcctg cgacagccgg accagcttga cgcgaaagag 18001 cgggcccgac gcgagatcga acggctgctc gcattccgcg cgaatcagcg catcgatcgc 18061 ttgcggcccg gcatcgtccg cgagatcgcg ctgctcgacc cggaatccgg acgcttcgcg 18121 gctgaggacg cgttgccgca actcgccttc gatcatcgcg aacacggtgc gcaggctctc 18181 gtggcgatcg accagcgtgt cgaatgcacg gacgaggcgc gccgtatcga cggcgccgtc 18241 cagctgcagc gcgcccgcca tgttgtacgt ggacggatcc gcgccgcggc tggcgagcca 18301 gatccgcttc tgtgcacgag acaccgcgta ggacggttgc gcggccagcg ccgggatgat 18361 cgcgtcgtcg tcggcggcgc cgtcgacggg catggcagcc agcctttgtg cgagcgcgcg 18421 cggcgtcggc gcatggaaga tgtcggcgac cgcgacgttc agtgcagccc gggggatccg 18481 gctgaccatc tggatcgcct tgaggctttg gcctccgtgc tcgaagaaat cgtcgtcgac 18541 gccgttcggc cggcggccga gcacctcggc gaagaggcgc agcagcgccg cttcgaccgg 18601 cgtgcgcggt tcggcccgca cgccgtcggg cacggacgcg gcatccggca gcggcagcgc 18661 ggcgcggttg atcttgccgt tcggcatgac gggcagcgcc ggcagcagca tcacggtgtc 18721 gggcaccatg tgcgccggca gcgtgtcgcg cagtgcgtcg cgcacgcgct ggggcgtcca 18781 gccggttccc gacgcgtagc cgcacagggt catttcggca tccgacgttt cccgggcgac 18841 caccacggcg tgggaaatgc cggcaagact ggtcagcgcg gcttcgattt ccccgagctc 18901 gatgcggtag ccacggatct tgacctggaa gtcgcggcgg ccgaagaagt gcagattgcc 18961 gtccgccccg aagcagccga tgtcgccggt gcgatacagg cgcgcgcctg gttccggact 19021 gaacggatcg tcgcggaaca ccgcccgggt gcgggcttcg tcgaacaggt agccgcgccc 19081 gacgccgacg cccccgatgc agatctcgcc cttgacgccg gccgggcacg gattcatgtc 19141 ggcatccacg acgtagaggc gcaggttctc gatcggccgg ccgatcggaa tcgccggccc 19201 atccggcgcg cgcgtcaggc agtaatgcgc gacggagtcc gacgcttcgg tcggcccata 19261 ggcgttgatg agccggacgg ccggattcag gcggaaccac gcttgcgcgg tggcgggctg 19321 cagcgtttcg ccgatcgtca gcaacgtgtc gaggtgaggg aaggccggtg ccgcgtgccg 19381 ttccagttcg ccgagaaagg tcgcgagata ggacggtacg aattgcattg ccgtgatgcg 19441 gtcgcggtgc aggctgtcga tcaggcgcgc gggctcgagg atcacggcat cgggatagat 19501 caccgtcgtg ccgcccgacg ccagcgccgc gaagcattgc cagaccgaaa tatcggagca 19561 gtgcgaagcg gtctgggcga ccgcgctctg cgcgccgagc ccgacccggc gcgccatcgc 19621 gagcacgtga ttgagcatgc cgcgatgttc gaccatcgcg cccttcggct ggccggtcga 19681 acccgacgtg aagatcacgt aggcgaggtc cgcgggccgg cagcgcggcg tcaccggcgc 19741 cggcgcttcg gcgccgcgac ggtcgggcag gcgggccgga tcgaccagcg ggatcgacgc 19801 cagcgccggc ggcggcacgc agtccgtcgt gacgatgacg gccggccgcg ccagcgtcag 19861 gatggtctcg acccgctggg ccgggtaggc cggatcgacc ggaacgtacg ccgcgccgca 19921 cttccagatg gccaggatcg tttccagcat cagcggcgag cgcggcatcc agacggcgat 19981 ccggtcgtcc ggctgcagcg gcgccgtctg cagaagatgc gcggcgatcc ggttggcgcc 20041 ttcgacgagg tcacggtagg tgcgaacctc cgtgccgcag cgaaccgcca cgcgctcggg 20101 gtgcgctgcg gcgacggcct cgatcagttc gggcagcgtc cggtcggacg gaaccggcgc 20161 gaacgtgtcg ttccagccga gcaggatggc gtcccgctcg gcggcagcga gaagcggcac 20221 gctgcggttc gggcgatctt ccgcgccggc caggccggtg agcagggtct cgacatggcg 20281 cagcaggcgg acgatcgtgt cgcgatcgaa ccggccgtcg tcgtacagca cctgcagcga 20341 caggcgcttg cccggcgtca cgaccagcgt cagcgggtaa ttgttcggat cggacacctc 20401 gaatgcgccg atccgcaggc cgggcagcgc atcggccagc gcttcttcca ccggataatt 20461 ctggaagatg agcaggcttt cgaagagcgg cacgccgggt ggcaggccgg cgaatttctg 20521 gatgtcggcc agcggatagt gcgcatagtc ctcctgctgc gcgagatcca tctgcaattg 20581 cgccagccac gctgacgtcg ggcgtgcgtc gatgcgcacc cgcaccggca gcgtgttgat 20641 gaacagcccg accatttcgt cggatgccgg cagcgacgcc gggcggccgg aaacgatcgt 20701 gccgaacacg acgtccgatt cgccgctgta gcggctcagc aactgcgccc atgcgccctg 20761 cgcgagcgtg ttcagggtga ggcggcggga ttgcgcgaat gcgacgagcc gttgcgtgtc 20821 gctttcggag agcagcagcg gctcttccac gtaggcgccc ggcgcggccg tgccgtcgag 20881 ttcggggcgg cccagcacga gcggcgtcgt cgccgggaaa tccgccagct tcgtcttcca 20941 gaaacgttgc gcggcggcgg cgtcctggcg tgccagccag cgcacgtaac cggcgaaggc 21001 aggcggcgcg tcccgctgcg gcgcgccttc ggccggcggc gcctgatagg cggcggccac 21061 gtcgctcagc aaccgggcgg agctccaccc gtcgagcagg atgtggtgat ggctccaatg 21121 gaagcgccat gcgtgctcgc ccacgcggaa cagcgcgagc cgcatcagcg gcgcgcgggt 21181 aaagtcgaag ccgcgcgccc ggtcttgcgc cacgtaggct tcccagcgct gttcggcctc 21241 cgcggcggac gccgcgcgca gatcctcgtc gtgccacggc aagtcgatcc ggcgatgcac 21301 gacctgcacg gggctttcga tgtcttccca gtgaaacgac gtacgcagga tgtcgtgccg 21361 gtgcgccacg gtctcccacg cgcggcggaa ccgttcgacg tcgagcgccc cgtcgatacg 21421 gaaattcagg ctgctgaagt acgcatccga cgcgggttcg tacaggctgt ggaacagcat 21481 gccctgctgg gtcggcgtca gcgggtagac gtcggcgatc tcgtccggac tcaccgacgc 21541 cggcgccggc gcctgcggca acgcagtcgc gggccgggtc gatgcggacg ggacagcgtg 21601 gccggcgacc agggtttcga gcgccgcgat gtaggcttgc gcgacgcgca ggatggtggc 21661 cgtgtcgtgg caggcccggc tgaattccca cgcaacgtgc aggcgattac cggtcacgta 21721 cgcgttgatg tcgagcaggt gctcgcgcaa ctggttcgcg ttgcggccgt ccccgctcgg 21781 ctccgcggcc tgtttccagt cgcgtgcggc ggtgaacagc tggtcggtct gccccaggta 21841 gttgaactgc agtcgcggct gcggaagcgg gccgtcgagc cggtctagca gcaggccgta 21901 ggtgatgccc gcgttcggca ccgcgcgcag ccgcgtcctg accgatgcga cgaggctggc 21961 cggatcgtgc gaaccggcat cgaccgtcag caagaccggg aaaaccgacg taaaccagcc 22021 caccgtgcgc gagatgtcga gcgcgtcgat cagttcctcg cgcccgtgcg cttcgagatc 22081 cagcagcacg tcggcgcatc cgctccattc gctgacggca cgcgcgagcg cggcgagcag 22141 cacgtcgttg acctgcgcgt cgtaggcgcg gggcgcggcg cccagcaagg ccgtcgtcgc 22201 ggcttcgccc aactcgacga cgatcgtgtc ggcggacgac acggtattgg cgtcggcagg 22261 cgcatcgcga tcgagcggca ggccgggcag ggcggcacgc gcgagggcct gccaatgggc 22321 gaggtcggcg tcggcggcgc cggagccggc ccaggtcgag atcgcccggg tccatgcggt 22381 ccaggtcgcg ctgccgcctg cgaattcggg cgccttgccg ttgcgcagcc gggtataggc 22441 gtcgtacacg gtttcgagca gcgcgcccca cgacacgccg tcgacgacca gatgatgggc 22501 gaccagcagc aggcggagcg aacggccttc gtcgacgcgg aacaggtccg cgcgcacgac 22561 ggggccgtcc gcgagattca ggctcgcatg cgactgcgcg acgtactgcg cgagctgatc 22621 gcgcgcaatg tcggacacga cgacggggat ctccgggtcg tcgacgactt cctgggtcca 22681 gccgctctcg ccctcgcgaa agcgcagccg cagcgcgtca tgccatttga ccgcatgccg 22741 cagcgcctgg cgcagcaaga ccggatcgag gtcggccggc acgtcgagca ggaccgcctg 22801 gttgtactgg tccgggtcgt gcttgccctg cgcgaagaaa cgcttctgga tgggcgtcag 22861 cggcagcggg ccggacgatg cgacgaacgc cgccgcgccg accgtgccgc gcgtcgccac 22921 ggcggcgagt tcggccaccg tcggatgctg gaagatgagc cgggtggtga gcttcaggcc 22981 cgccttcgcg gccagcgaca cgatgcgcat gctcagaatc gaatcgccgc ccagcgcgaa 23041 gaggttgtcg tggatgccgg gcgacggaat gcccagcgct tcgccccaga tgcggcacag 23101 cagcgtctcg gtaggcgtgc ggggcggcgt cggcgcgtgt gccgtggcgg cgagtcgcgc 23161 gcggtccagc ggcggcagcg cgttgcggtc gatcttgccg ttgccgctca ggggcagcgc 23221 gtcgagcacc acgtagatgc cgggcaccat gtagtccggc agcgtggcgg acagcgcggc 23281 ggcgatcccg gcgtcgctca gcgacgcgcc gtcgcggaac gcgacgtacg cgcacagcgc 23341 ggcgcggccg gcctcgtcgc gatagtcgag cgcggcggcc tggcggagtt tccgcgaatg 23401 gtcggccagt cgtcgttggt cgatctcccc gagctcgatg cggtagccgc ggatcttcag 23461 ctggtggtcc ttgcggccgt gcagcacgat cgttccgtcg ggcaggtagc agccgatgtc 23521 gcgggtgcgg tacaggcgga cgccgcgctg aggatggaac ggatcctcga cgaacgcgtc 23581 ctgcgtggcg gcttcattgt tcagatagcc gcgaccgacg gcgacgccgg acacgcacag 23641 ctcgccggga atcccgatcg ggcacaggtt catctgcggg tcgacgacgt agaggcgaac 23701 gttgcggatc ggcttgccga ccggtacgta aggcgtggac ggcgcgcccg tcatgcggtg 23761 ctgtgcgacg tcgtcggacg cttcggccgg gccgtacgcg ttcaccagcg ggatcgccgg 23821 gaacacgtcg aaccactgtt tcaccagcgc cgggctgacc atctcgccgg tgacgagcag 23881 gtgccgcaga tgccgcatca gcgccggccg ttccgacgcg cggtcgagca cggcggacag 23941 ataggacggc accagttcga ggatgctgat ccgggtggtt tccaggtacg cgacgaaacg 24001 cgcgggatcg cgaatgcagt cgtcgtcgac gatcacggtc ttgccgccga cgagcggcgc 24061 cgtgaaaaat tgccagaccg aaatatcgaa gcaatgcggc gcggtttgcg cgatcaccga 24121 cgacgccgag atcgagaact cgtcgatctc ggcgagcatg tggttcagca tgccggcgtg 24181 ctcgaccatc gcgcctttgg gcttgccggt ggagccggac gtgtagatca cgtaggcgag 24241 gctgtcgggc gacacggggc ggccgggatt ggagtcgtcg acggcgtcgg tggcggcgtc 24301 gagcgacacg accagcgcga tcccggccag ctccgggggc aggagcccgt cgcaggtgat 24361 cacgagggcg gcgccggaat cctcgaggat ggtgcggatg cgggccaccg gataattcgg 24421 gtcgaccgga atataggcgg cgccgcactt ccagaccgcg aggatcgcct ccatcagctg 24481 ggcggaccgg tgcatgcaga ttgcgaccag cgcgtccggg cccaggtcgg cggcggcgag 24541 caggcggtgc gcgatgcggt tggcgcgcgc gttcagttcg cccgcgctca ggacgccatc 24601 ccggtactcg accgcgggcc gctcggggtg gtccgcggcg gcctgctcca ggcgatgcac 24661 cacggtgagc gcggcgtcga acggcacggc ggtgtcgttg aaggtctcca gcaactgccg 24721 gcgttccgcg tcgggcaaga tcggcacgcg gccgagcagc cggttcggat cggccgcgaa 24781 cgcgtcgagc gtcgcggcca cgtggcccag catccgctgc atcgtgtctt catcgaagcg 24841 ccgcgggtcg aacgacagtt ccatcttcca gtcgtcgcgc gccgtcacca cgaattcgag 24901 cggaatgtcg gcgcggttgt agagctgcac ctcgtcgacc gccagcccgt gcgcgccatg 24961 cgtgagcgac gcgtcgagcg ggtaattcat gaacgtgatg ttgctctcga acagcggcgc 25021 cgtcggcggc acgtcgctgc agcgctgaat gtcgggcaac ggggtgtgct cgaacggcgc 25081 gcgggcggcc acgcgcgcct ggatcatctt cagccacggc accagcggct gcctcgggtc 25141 gacccgcacc cgcaccggca ccgtattgat gaacaggccg agcatggttt cgatccccgg 25201 caggttggcg ccccgcccgg acacgacggc gccgaacacc acgtcggttt ccccgctgta 25261 acgcgacagc acgagcgccc acgccgcttg cgcgagggta ttgagggtga cgtgatggcg 25321 ggccgcgaat tgccgcaggc gcgcgctcag gtcggccgac aggtcggcct gcacttgcgc 25381 gaggccctgg ccgaagcgtt cgtccgcgcc cgcgcgcgcg gccgtgggca gcggggtcgg 25441 tgtgcggaac ccttcgagat agcgcgtcca gtattgctgc gcggcttgcg gctcgtgctg 25501 ctgcagccac tggatatagt cgcgataggg gcgcaccggc gggagcgccg gcgacacgcc 25561 gcgcgcgagc gcgccataga cctcgaagat ctcctcgatg acgagcgaca ggcaccagcc 25621 atcggccagg atgtgatggt ggctccagct gaacaggtag gcgtcggcg cgacgcgcac 25681 caggcgacag cgcacgagcg gcgcgcgatc gagcgcgaag ccctcggcca ggtcgttgtc 25741 gagatgcgcg cgccaccgtg agcgctgttc gtgttccggc aggtcgagcc agtcgtcctg 25801 cacccacggc agcgtggcgc gcgcgtgcac gacctgcatc ggcttgtcga actcctccca 25861 atggaacgac gtgcgcatca ccggatgccg atcgatgagc tgctgccacg cggcatgaaa 25921 cagcgcggga tcgaggctgc cggtgatccg gcaactgagc tggttgaagc tgcttctcga 25981 gccgggctcg tgcacggcat gaaagagcat cccctcctgc atcggggaga gctcgtagat 26041 atcggcgatg gtgggggatg tcacgatttg atccttgaga caagggcgtc cagcgcttcc 26101 tggctgatgc gcgcggccgg aaagtccgac gggctcagcg cgcgcgggcc gtcgccgccg 26161 gccgcgacga tcgacagcag gcggctgcgg tagcactgcg tcagctgttc gatgacgccg 26221 ggtgcgcagg cctcgcggtt gtagtgccag gtcaggcgca gacggccgtc gaacaccatc 26281 ccgtcgatct cgaacagatg gccgcgacgt gcgcgcgggc tgtgctcggg gctctggaag 26341 tcgagtaccg gcttccagcc cgtgtcgtcg ggcagcacgc gatcgacctg gccgagatag 26401 ttgaagcgca ccggcgccgg cggctgccgt tcgagcgccg ccgcgatgcc ggcgtcgtgg 26461 ccgaggtagc gggcgatgcc gtagccgagc ccgcgcatcg gaaccgcgcg cagctgctcc 26521 ttgacgtggc gcagcgcgtc gaccgccacg gtggcgtcgc cggcgttcag gcacaccgga 26581 tagtgggtgg tgaaccagcc gatcgtgcgc gacgtatcga cgccgtcgaa aatgtcctcg 26641 cggccgtggc cttcgagatc gacgaccagc gacgcgttgc cggtccagtc gccgaacgcg 26701 agcagcaggg ccgtcagcag gacttcgttg atctgcgtgt tgaacgcacg cggcacgtcc 26761 tgcaacagcg cgagtgtctg ctgcgcatcg aactcgacga tcgtcgagcc cgcttcggcg 26821 acggtgccgg ccggcatgtc gtcgaagcac gccggctcgc cggcgttgcc ctggagccag 26881 tagtccagcc ccaggccgtc gagcgcggtc gcgccgagtc cggacaggcg cgtcgaccag 26941 tcgcgccagg ccgtcgtcct ggccgggagc tgtaccgcgt cgcccgcttc gagctggcga 27001 catgcggtgt acaggtcttc gaacaggatg cgccacgaca cgccgtcgat caccaggtga 27061 tgcgcgaccg cgagcaggcg ctgcggcgcg tcgggaccga actggaacag gtgcgcgcgc 27121 agcagcggcg gcgccgacag cgtgaagctt tcctgcatgc cggtggcggt cgcgagcatc 27181 gcggcctgcc gtgcggcagg cgccgcgtcc gccagcgacg tgacgccgag cggaatggcc 27241 agcggcggcg cggcatgcga ttgctgccac acgccggcga cgcacgcgaa actcagccgc 27301 agcgcgtcgt gatgcgtcgc gacggccgcc agcgcgcgct cgatcgtgtc cggccgcagc 27361 gatgcgggca cctcgatcat cgtcgactgg ttgtagtggt gcggatcggc gacgtcttgc 27421 gcgaagaacc agtgctggat cggcgtcagc ggggcggggc cgaccaccgg ctcctgcgcg 27481 atccggatcg acggcgcctc cgtcgcgacc tgggcgagct cggcgatggt cgggtgtgcg 27541 aagaactggt cggcggtgaa cttgagcccg acttgctggg ccagcgacat cacctggatg 27601 atcaggatcg agtcgccgcc cagttcgaag aaattgtcgt gcacgccgat cggctcgcgg 27661 cccagcacgt cgcaccagat cctgcccagg cgcgcctcga cgtcattggc cggtgcgacg 27721 taggcggttt cgctcggcgc gggcgccagt tccagcgcgg cgagcgcctt gcggtcgggc 27781 ttgccgttcg gcgtcagcgg caggcgttcg agcgtcacga tcgacgccgg caccatgaac 27841 tcgggcaggc gttccttcag gtgttcccgc aggctggcga cgctggccgt cgccgtcgcg 27901 acgcaggcca ccagctgctt gtgctgcggc gtgtcctcgc gcacgaacac gatcgcgtcg 27961 gcgacgccgg cgtgctgcct gagcgccgcc tcgatctcgc ccatttcgat ccggtagccg 28021 cgaatcttca cctgcgtgtc gcgccgcccg gtgacttcca ggttgccgtc cggcagccag 28081 acgccgaggt cgccggtgcg atagaggcgc tcgcccgcct cgaacgggtg ggcgacgaac 28141 gcggcggccg tcaggtcgtc gcggccgaca tagccgcgcg ccagcgcgat gccggacacg 28201 cagatctcgc ccgcgcaacc ctcgggggcc agcgccccgt gctcgtcgag caggtacagg 28261 tgcgtgttgt ggatcgggcg gcccaccggc agacgggcgc cgtaggtgat ggccgggtcg 28321 accacgtagt ccgcgatgca cacggttgcc tcggtcgggc cgtacgagtt gtggcacgtg 28381 cgggtccggg ccagctcgcg cagatccgcc acgcgggcgc tgtcgcccgc gctgatgacc 28441 cgtttcacgg cgccgagcgc atgccagtcg agcgcggcaa ggtaggccgg cgtcgcgttg 28501 acggtggtga cgccctgctg tgcgatgtag tcgacgaaac gcggcacgtc ccggatcacg 28561 gcggtctttg ccagcaccag gcgggcgccc gcgagcagcg tgacgaagat ttccatgatc 28621 gagccgtcga agcccgggga gtagaactgg acgaagcggt cggcggaatc gaaaccgaat 28681 gcgtccacgt ggtactgcgc catgttcagg agccctgcgt gttcgagcac gacgcccttg 28741 ggcacgcccg tggagccgga cgtgtagatg atgtatgccg cgtcgtccgg ccgcacctcg 28801 acctgcgccg atgccgacgc gggtgccagc gtgtcgagct ggaagtcgag ggcgaacatc 28861 gggatcgccc agaaatcggc gagcaacggc aggtgttccg agtgcgtcag cagcgccttg 28921 accttcgcgt cctcgatcat gaagcgcagg cgctcccgcg gaaattccgg gtcgagcggc 28981 agatacaccg cgcccgcctt gagggcgccg agcatgccga cgatccagcg ctcggaacgg 29041 tcggccacca cgcccaccac gtcgccgcgt tcgatcgcgt attccgcgag caggaagctc 29101 gccagccggg acgcctggtc gtcgagttcg gcataggtca gcgatgcgtc ggcggtcacc 29161 accgcgacgc tgtccggcgc ggccgcgacc cgttgcgcga actgctccag gaaggtgccc 29221 tgtaccgcga cgggcgccgc atgcgaacgc aggcgcgcgc gctcttcgtc gtcgagcagc 29281 gagacggtgt cgagcggcgc atccagtgcg ccgaagccgg ccacgacgtt gcgcaggtgc 29341 cgtgcgacat gctggagata gtgcagcgtg aacaccgtcg gccggcccgt cagcacgatc 29401 tcgtagcgct cccgatgccg gatctcgatc gacaggtcgt agtcggccgc tgcccaggct 29461 tcgtgaaggc cgtcgaagcg cacgccgacg ttggtcgcgc gccgttcgcc atgcagcttg 29521 tgcgcgaggg cggcgatcgg gaaatcctgg tacgaatagc tgcgctgcac gctgtcgcgc 29581 agctggttca ggtacgcgcg aaccgtgggg ccgggctcgc cggcgtcgag cagcgggaca 29641 ggctcggcgc agccgctcgc gggttcgacg atcagctgcg gcgacgccac gaacaggccg 29701 gccgcgccgt tgtagcgccc cagcacgcgg aacagcgcgg ccagcagcac gacgaacgcg 29761 cccagctcgt tgccggcggc gagccgctcc agcacctgcg ccgcgtcgcc gtcgagcgcg 29821 aacgtcagtg ccggctcggg gccgagcggc agcgcatacg cctgccacgc ctgctgaagg 29881 cggaaatctt catcgatgcg accgagcgcg tcgttccaga acgccacgtg ttcctggtat 29941 tgcccgctgg tcgagagcgc gttgagattc agttctgaca aagcacgatc tccctcgtcg 30001 cgtacaggat ttcggaagcg atgcccttgg ccttgcagtg cgcgacgaac tgggtggact 30061 ggatgtggct gggcgagttt tcgtcgaagg tgttgtcgag gaggtggttc agccagggct 30121 cctgacccat cgcatagaca tacgccgcgt tgaacgcgaa atcgtccacc agcgcggcgg 30181 cctcgccgaa ctggcagccg cgcgcccggc gtgattgatc gatgtcgcgc ggcagcgcct 30241 tgggaaacag cgggccgtag acccatgacg gcggcgcgcc ctcggtttcc atcccgacga 30301 acagggtgtc cggcttgccg gcgaggcgga agacatgctc gtagaggcgc gggtccaggt 30361 tgcacgaatc ggcgatgcac agcaccgagc gcgagccgaa gcggatcatg aagctctgct 30421 tgctgtggat cgccaggtcg ttgtgttcgc ccatgaacgg aatggcggtg atggcgccgc 30481 cgggcacctt gatttcctgc gcatcccgaa cttccagcac gtcgtcgaag ccgagcttgc 30541 gcaacgccag ctccatcgac ggatcttgcg gaaagccgtc gagattcctg ccgaccacca 30601 cggtcttgac cttgtggcga agctgcagca gcgtttcgag gacgatgtga tcgtgatggc 30661 tgtgcgtgat cagcacgtag tcgatctggt ccggcaggtc ggcgaacgta tagcgcggca 30721 gcgcggtgtc gtagccgtag ctgatcaccg gatcgatcag gatgctcacg ccccggctct 30781 ggatcagcac gcacgcgtgg ccgtagtagc ggatgcggat gtcgtcgccg tcgaacgaac 30841 gatccggttt cggcgccggc gcctcctcga cgaagaacga gcggaacagc ggctcgtcct 30901 tctcctccac gcgcatcagg tcgacgatct tcgcgtagct gccgggcgtg tcgcgcatgc 30961 ggaacagcgt gtcgagcgcg cggtcgtcga aggccatgtt gctgaacacc gtgcgctcgt 31021 cgcggagccg gggcgtgctg aggatgaacg gccgcggcgt gtgctcctcg atcgccgaca 31081 gcgcgatgct ctgcgcatcg cgcgcataga acgggctcgc gtacagcagg ctttcgaaca 31141 cccggaagga cgggttgtgg ttcaggtcgt agtagatctc gacatagccc ttcagcacct 31201 ccggaatctc ggggtagagc gggtccgacg ccatccccgt ggcccgttcc agcagcagcg 31261 tggagaacgc cttgtatgcc ttcgccagtt ccagttgccg ggtcgcgcgt tgggtggtct 31321 gctcgatcag cgtgcggatt tcgtcgacgc gctggccgcc caggtcgagg aacggcccgc 31381 cgcgcatcgc gggatccttg caggccgccg catgcatcat cggcgatgcg gcataggact 31441 tcagcagcgg caggaaccgc tccgccacgt tgagggcggc ggtcaacggc ggaagcgtgt 31501 gataccacgc gtaccagctg ttgatcagcg gttcgaactg gatgttttgg cgcaggtaga 31561 cctgcgcgct ggacgaaata gtcaacgaag gctccttaga atgcgctgag ttcgacggtg 31621 ggctggcggg cttcggcgtg cagcgcgcgt tgtcccaggg tcaggttccg gatgcgaacg 31681 cccggattgg cgagcacctc gccgatgacg gacgtcagct cgttggcgag gccttgcacc 31741 agggcttcgc tgaaccgccc cgcgtgatag acgacgcgga tcgcgagacc ctcggcgtgc 31801 ggctcggcca ggaaccagaa atcggttgcg gcttccgtgt ccgcgcgctg cgggtcgtgg 31861 tccggcagct cggcgatatg cacttgtccc gcgtagcgat cgacggggcc gtgtcgctgg 31921 ttctgcagcg tcaggccgat gtcgaagagc ggattgcgtc ccgccacgcg tttgatgtgc 31981 agctcgtcga gcaggcgatc cagcgggtac agcgggtgcg agaacgcttc gagcgtggtg 32041 tcccgcaccc gggtcagcag cgtgtcgaac cggtcgtcgc ccgcgacacg atcgcgcagc 32101 gccagcacgt tcaggtaggg gccgacctgc gactcgagtt cgggcagttc gcggcccgcg 32161 accggcgtgc cgacgacgat gtcctcctgg ccggagcggc ggtagaacag cgccttgatg 32221 gcggacagca gcgcgatgaa caaggtcgcg ccgtggcgct tgccgagcga ttccagcgcg 32281 gccgtctcgg cggcgggcag gtcgaatcgc caggatttcc agctcggcgc ggccggctgc 32341 tcgacgtcgc ccggcagttc cagtgcgcgc aggccgccgc ccagtttggt cagccagtag 32401 tccttcatgc gcgcgccgtc cggcccggcg agcaggcggt tcagccagcc ggcgtaatcc 32461 ttgtactgga tcgggagggc gggcagcgga tcgtcgcgac gctggacgaa tgcgtcatag 32521 agcgcggaca ggtcgtcgag cagtacctcc gtggaccagc cgtcgctcac gatgtgatgc 32581 atcgtgcaga ggcagacgtg acggacttcg gagagcctca gcagcttgac gcggaacagc 32641 gggccggtcg cgagatccat cggcacgagc cgttcgctcg cctggatcgc cgctgcctgg 32701 gcatcgcggt cctcggcatc ctgcagatcc acgatctcga ccgggaacgc ggcttcgccg 32761 ggcggcagca cgtgctggac cggctggttg ccttccagca cgaaacgcgt gcgcaggatc 32821 tcgtgacgct cgctcaacgc gcggaacgcc cgcacgagcg catccacgtc cagcacgccc 32881 tcgaacagca gcgacgtggg cagcggcccc tcggcttgcg ccgcatggag acgatcctgg 32941 acccacagcc gcgtctgtgc gggagagagc gcgtagcttg cctgcgccgg cagcggcgtc 33001 accggcgcgt aatcgatcgg ctgcgtatcg gcgatgcgct tcgcgaggct cgagatggtt 33061 gggagtgcga acaggctgcg gatttccagc ttcacatgca gatcgcgccg gatgcgcgcg 33121 acgaccttcg tcgccagcag cgaattgccg cccagatcga agaaattgcc ggtcgtgctg 33181 atccgcgcct ggccgagcac ttcctgccag atggcagcca actgcgcttc gagtgcgttg 33241 acgggcgcaa cgtggtccag gccgtcgccg ggttcgggca gcctggtgcg atcgagcttg 33301 ccgttgggca gatgctcgaa cgcgctcacg acgacgaacg cggagggcac catgtaatcc 33361 ggcagccgct gccgcaggtg gccgcgcacc gcttcgatca gttctgcttc ggggtgcgac 33421 gagcacagcc atccgaccag tctcgcgccg tcgtccacgc cgcgcagcgc gacgacggcg 33481 gcatcgacca gcgggtgcga cgtcagcgcc gcctcgattt caccgggttc gatgcgcagg 33541 ccgcgcagct tgatctggtg atcgatgcgg ccgaggaact cgatgttgcc gtcgggccgg 33601 tagcgcgcga ggtcgccggt gcggtagagg cgcgcgagcg ggtcggccga gaacggatcg 33661 gcgatgaact tttcggcgct cagttcgggt tcgccgtggt agccgcgccc gaccggtgtg 33721 ccgccgatca gcaattcgcc ggccacgccg atcggcgtgg gctgcatctg cgcgtcgacg 33781 atgtagaggc gggtgttggc gatgggccgg ccgatcggca cgatgcggtg cggatcgtcg 33841 cgccggcatt cccacgcggt cacgtcgacg gcggcctcgg tggggccgta gaggttgtag 33901 agctcgacgt ccaggcgctc gaggcaacgc tgctgcaggt catggggcaa ggcctcgccg 33961 ctgcacacga cgcggcgcag cgacgcgcag tgcgcgtcga ggtccggatg atcgaggaac 34021 gcgcgcagca tcgacggcac gaaatggatc gtggtgatgc gttcgcgctc gatgagctcg 34081 accaggtagt cggtctcgcg ctggccgccg gggcgggcga acacgaggcg cgcgccggtg 34141 acgagcggcc agaagagttc ccagaccgag acgtcgaagc tgaacggggt cttctgcagc 34201 acggcatcgt cggcgccgag ggcgtaggcg tgctgcatcc agaggatgcg gttggtgatc 34261 gcgcgatggg tgttgagcgc gcccttgggg cggccggtcg agccggacgt gtagatcatg 34321 taggcgaggt tgtcgccgtt cagcgcgggt gcggggttgg acgtcgccgc ggcgtcgagg 34381 tcgagcgagt cgcgatcgac gacgatcacg tgcgcgtcgg tgtcgggcag cgcgtcgtgc 34441 agatgctgct gggtgaggag ccagcgcaac tgcgcgtggt cgatcatgaa gcgcacgcgc 34501 tcggcggggt agtcggggtc gacggggacg taggcgccgc cggccttgag gatcgcgagc 34561 agggcaacgc tcatgtcgag cgaacgctcc atggcgacgc cgacgagcga gtcggggccg 34621 acgccgagcg cgacgaggtg gtgggcgagg cggttggcgc gcaggttgag ttcggcgtag 34681 gtgagcgcgg tgtcatcgaa gacgatcgcg acggcatcgg gcgtgcgctc gacctgctgc 34741 tcgaacaggc ggtgcagcgg ttgcgcggcg tcctcgccga aatccgtgtc ggtgcggttc 34801 cactcgacgg tcagcaggtt ccgctccgca tcgctcgaca acggcagacg ggcaacggcg 34861 gccgacgcat cgtccgcgag atgcgtcagt agggtccggt agatgtcgag gaaacgctgc 34921 accgtgctcg cgtcgaacag atcggtgttg tagtcgcaat cgatcaggag tgcttgcccc 34981 gcgtcgagca cgttgacgtt caggtcgaac gcggtatggc ggatcagcgg cgccacgagg 35041 ccgaccgtca ggccgggcag ttcgggcagc gccgacacgg gttcgaggtt gaagaccgcc 35101 gataccagcg gcgcggcgtt gagatcgcgc tgtgcgccga tttcgcggac cagttcggcg 35161 aacggataat cctggtgctc gagcgcgtcg agcaggttct gccgggtgcc ggccaggaaa 35221 ctggccacgg tggcctgctc cggcagcgtg gagtgcagcg gcagcagatg cgtgcagtag 35281 ccggcgaggc gatcgctgcc ggccaccgag cggccggtca ccggaatgcc ggtgacgatc 35341 tcctgctggc cggcgacgcg gtgcaggaac agattgaagc cggcgagcag caccatgtag 35401 agcgtgcagc cgttctgacg ggccgcggtg cgcagcgtcg cggccgtcgc cgcgtccaga 35461 tgcagggaca cgcgctcgcc gtgaaacgtc ttcaccgcgg gccgcgggta gtccaccgga 35521 agattcagcg gtgcggcctg acgcgcgcat tgcgccagcc agtactcgcg attcgccttc 35581 gtttccgggc tgtggcgctg gccgtcgagc tgcttcaggt acgcgcgaaa ctgcagcggc 35641 gcgtcggccg gcgccgcacc ggcatacgcg cgggccagat cctcgagcag cacgccgaac 35701 gtcgagccgt cacagatgat gtgatgggcc gtcatcacca gcaggtgacg ctcgctgccg 35761 aggcgcacga gcgcggcccg aaagagcggc ccgttcacca ggtcgaacgg ctggcggctt 35821 tcctgctccc gccacgcgtt cgggtccgtg tcgatcagcg gaatctcgag tgtcagcgac 35881 gggtgcacga tctggcccga cccgtccgcc atcaccgtgg tgcgcagtgc ctcgtgccga 35941 tcgacgaggc tctggacggc cgcgcgcatc gcggcttcgt cgagccggcc gttcagttcg 36001 agcgtggtgt tgacgttgta ggcgagcgat ccttcgggat cgatttccga caacacccac 36061 agctggcgtt gcgcttcgct cagcgcggcc accgtgccgt gtttcgagtg cggccggatg 36121 aagccgcccc ggcgcaggtc ggcgacgctg tccttcaccg cccggatgaa gcggtcgata 36181 tcggcatcgg tatgcgcggt ggacaggaag caggtgcgcc attcccagat gtagatgccc 36241 ttttcgagca tgtgatagaa gaacaggtcg aggttctcgg tgaattcgaa gcggaacatc 36301 gagccgaacc acgtgacctt gatcggcgcc tcggcctccg cgaagaatgc attcagcgtg 36361 ccggcgatct gcgcggtgcg ttcgttgagc gcggcctgca gcgccggccc ctcctgttcg 36421 atcttctcga gcacggccag cgccgccgcc atcgcgagcg gatactggca gaaggtgccg 36481 ccgaacgcgg tgcggtccgc cgcggggaac gagtggtcgc cgtaggtcca catgccgccg 36541 tcgatggcat ccatgaagcg gctggtgccg gcgatcacgc ccagcggcag gccgccgccg 36601 atgatcttgc cgtacgtcgc gagatcggcc ctgatgccga acatggcttg cgagccgccc 36661 ggatggacgc ggaaaccggt gatcatttcg tcgaagatca gtgcgacgcc ggcctcctcg 36721 gtgatgcgac gcagttcctt gaggaatgcg acgggctgca gggaagggtt gcggctctgc 36781 accggctcca ccatcacggc ggcgagggtc gacgccatcc cgcgaatggc ctcgagcgcg 36841 gcgtcgctgc cgtagtcgag caggatcatg ttctcgacgg agccgaacgg tacgcccggg 36901 gcgatggttt ccgtcacgcc ttccgcgttc gccgcggcga gcgtgccgtc ggcatggccg 36961 tgatacgaat gcgtgaacat cacgatcttg tcgcgcccgg tcacggcgcg cgcgagccgc 37021 atcgcggtca tgacggcctc ggtgccggtg ttcgagaacg ccacgcgatc gaggccggtc 37081 acgcgggcaa agcgcgcggc gacttcgccg acgaggctgg agcgcgcacc cagttcgagc 37141 gggcgctgcc attcccgcgt gacctgctgc tggatgaaat ccggcgtgtg gccgaacagg 37201 tgcacgccga agcccatcgt gaaatcgatg tactcgttgc cgtcgatgtc ccacagccgc 37261 gaaccggccg cgcgatcgcc gacgatcgga tacagcatct ccttggtcga aaagcggaag 37321 ccgaccgtgg cgcggctgtc ggccagcacc gggcgcgacg cctgcaccga gtccttcgat 37381 ttccgggtgc gcgtcgtgta gcgcacgatc agcgcctcga gatgctcctg ctgcgcggcg 37441 gacagcccgc gcgcccgctg ctggaccggg ctgccccacg gcatcatcgg cttgggcggc 37501 gggttgtcgg ccgcgggcgc ggcggcagct gcaggcgcgg gcttcgccgc gggtgcggcg 37561 gccggggccg cgctcgccgc tttgggtgcg acgctcgccg tgctcgcgac ggcttgcacg 37621 gcggccgtcg ccggccggac gccgggctgg ccggtcagcg acgtgcgcag cagttccatc 37681 tgctggctca tcacgtgcga cagcagctga ttctgctccc gcagcacgcg ctcgaccgtc 37741 gagccgcctt cggccgccac ccattccgcg ggggcggccg cgagcggcgc aagccccgcc 37801 gcggacggcg tgaccgcgac cgccggcgtg gacggttccg ccgcggccac ggctacggct 37861 acggcctcgg ccccggacgg tgcggcggct gccggcaggt tgtccgcgac atattcggcg 37921 agcgcctgca ccgtcgcgag gtcttcgaag aagcggcgca tggccagctt cacgccgtac 37981 tccgcctcga tgtgccggat ggcctcgatc agcacgatcg agtcggcgcc catctcgagg 38041 aagggcagtt cgatgttgat ggtggcggga tcggcctgga tcaattcgcc gatcttgccg 38101 cgaagccatt cgagaatctc gccgctgcga ttgtgcgtcg gtgctgcggc gatgggtgat 38161 gcgcttgtct gagtcatgga cgtgtccgct ttctggaacc aggtacggct gcgttggaag 38221 ggataggacg gcaatgcgat gcgcgcgggc gcgggtgttt cggtcggggc ccagtcgaca 38281 tcgacgccgc gggcatacag gctcgacagc gtttcgatca gcgcttgctg ctcgacttgc 38341 ggccgctgca gggcaaggaa ctggatcccg gcgtccggcg cacagcacgc gcgggccagg 38401 ttgacgagca ccggcttcgg gccgatttcg accagcacgt tgaaaccggc ttcggcgagg 38461 cgctcgacgc tgctcgcgaa ctgcactggc tcccggcagt ggcggcgcca gtacgtgtcg 38521 gtgggtgcct cgtccatcac ggcgcccgtg agattcgaat agaacgggat cgccgggcgt 38581 gcgacgggca cggttttcgc cgcgagctgg aagctgtcca gcatcggctc gagcagcggc 38641 gagtgaaacg cgtgcgacgt attgagcggc acggaccgga tgtcccgcgc ggcgaacgca 38701 tcgaccagca tcgcgatgcg ctcgcgcttg ccggaaatca cgatgctcgc cgggccgttg 38761 acggccgcca ccgcgacctc gtgcggccac gcgtcgatcg cgcgctcgac cgtggcgagg 38821 tcggtgaaaa tcgccgccat ctcgccgtcg cggggcaacg cctgcatcag ccggccgcgt 38881 tcggcgatca gccgcaggcc gtcttccggc gagaagacgc cggccgcgca agccgccgcg 38941 tactcgccga cgctgtggcc catcacggcg tcgggcacca cgccgaacga cgccagcaac 39001 gtggtgagcg cgtactgcag cgagaacagg gccggctggc tgtagccggt ctggtggatg 39061 tcctcgccct gggccgacag cacttcgagc aacggcttgt cgagcaacgg atcggccacc 39121 gcgcggcaac ggtcgatggc gtctcggaac accggatacg cgtcgtacag gcggcggccc 39181 atgccggcgt attgcgagcc ctggccggtg aacaggaagg ccatcttcac gcggggggcg 39241 ggctgcgccg cgccggccgg ttccttcgcg tggaaggcgc gcagcttgtc gatggcgtcg 39301 tcgagcgacg tcaccggcca tgccagccga tgcgcgaaat gcgagcggcc ggtcgccgcc 39361 gaaaaggcca cggccgcgat gtcgagaccg ggttcggctt cgagccgccg ctgatagcgc 39421 ccggccagct cgcgcaacgc cgcgggggtc ttggccgaca gcaccagcgg atgcaccttg 39481 tgtctcgacg gcgtcgcctg ccgcgccggc gccggcgctt cttccagcac caggtgggca 39541 ttggtgccgc tcgcgccgaa cgcgctgacg ccggctcgcc gtggccgttc gccacgcggc 39601 cacgcgctcg cctcggcgca gatctcgacg ggcattgcgt cccactgcac cagcgggctc 39661 ggctggcgga aatgcaggtg ggcgggcagg cggtcgtggt tcagcgacag cacgaccttg 39721 atgacgcccg cgatgccggc ggcggactcc gtgtggccga tgttggtttt caccgagccg 39781 acgcgcagcc gccggcccgc gtcgcggcct gcgccgaaca ccgtcgccag cgcctgcaac 39841 tcgacgggat cgcccagcgg ggtgccggtg ccgtgcgctt ccacgtaatc gatggacgcg 39901 gcgggcaacc cgcccagcgc ctggcggatc acggcttcct gcgcacgacc gttcggcgcg 39961 gtaaagccgc tcgacgcgcc gtcgtggttg accgccgaac cccgcagcac ggccagcacg 40021 cgatcgcccg cggcgagcgc atcggacagg cgcttgagca ccagcgcgcc gcagccttcg 40081 ctgcgtacga agccgtccgc cgccgcgtcg aaggtcttgc agcggccgtc cggcgccagc 40141 gcccgcgtgc gcgagacggc gatggagttg tccggcgaca ggatcaggtt gacgccgccc 40201 gcgatggcga gatcgcactc gccgctgcgc aggttctggc tggcggtatg gatcgccgtg 40261 agcgacgacg agcaggcggt gtcgatcgcc atgcttggcc cctgcacgcc gagtccgtag 40321 gagatgcggc cggccgccgt gttcagcggg ttgccggtga agaaatagcc gtcgatgccg 40381 ctgccgccgc cgttgcgaag ctgcaggttc gcgtaatcgt tggtggtgat gccgacgaac 40441 acgccggtgc ggctgccctt gagactgtcg accggaatgc cggcatgctc cagcgcttcg 40501 tgactgacct cgagcaacag gcgctgctgc gggtccatcg cggccgcttc gcgcggcgtg 40561 atgcggaaga acgccggatc gaactggtcg acgtcgtcga gaaaaccgcc gaagcggctg 40621 tacatacgcc ccggcgcttc cggatcggga tcgtagtacg cgtcgacatc ccagcgctcg 40681 cgcggcactt cggagatcgc atccacgccg tcgttcagca ggttccagta ggcgtcgaga 40741 tcgtgcgcgg cgcccggaaa ccggcagctc atgccgacga tcgcgatcgg ctccggcgtg 40801 ccggcgtcgc gggcctcgat ggccggcgcg atcggccgcg gctgctgctg cggcggcacg 40861 gtctgcgcct gcgccgtgcc ggacgcctgc tccgccagga aatccgcgag ggcgttgacc 40921 gtcggatgat cgaacaacag cgcgaccgac agcgggatgc ccagcgcatt ttcgaggtgc 40981 gtgcgcacgt ccagtgccat cagcgaatcc atgcccatct cgaagaagcc gagatcgcga 41041 tccagcgtcc ccgcgtcgta gcccagcacc tgggccaccg cgcgatcgat gctgtccgcc 41101 agcagccgct ttcgctcgcg cggcgatgcg tcgctcagcg ccggcattgc cggcgcgctc 41161 ggcgcgcttt tggccacccg cacgtggtcg aggaacggct tgggtccgcg cgcctcgtag 41221 gagccctgga acagcgccag gtcgatatcg acgaccgcga cctggggcac ggcggggaga 41281 cgattcagca cgtcgagcgc gcgatccgcc gccagcgacc ggatgccgac acgccgcagc 41341 agcgcttccg cctcggggaa cgtcatgccg ccttccgccc agggccccca gttcacgctc 41401 agcgccggca ggccctggcc gcggcgatga tgcgcgagcg cgtcgaggaa acggttcgct 41461 gcactgtagt gcgcctgctc acgcgagccc cacgcggacg cgatcgacga aaacaggagg 41521 aagaaatcga gcgggaagtg ctcgctctgc tgatggagca gccacgcgcc ggcgaccttc 41581 ggttgcagga ccgcgtccag ttcgtcgcgc tcgacctgca tgatcggctt gtagccgacg 41641 atgccggccg cgtgcacgat gcctttcagc ggcacgccgt cgcgccgcag cgcggcgaag 41701 aaagcggcga ccgctgcggg gtcggcgata tcgaggcgct cgcagcgcag cgtgacgttc 41761 cgctcacgca gctcggcgat cgcccgctgg ctctcgtcgc tcgcggcccc ttgccggccg 41821 accaggatca gcgtgcccgc accgcgcgcc gccagccatc gggcggtgtg cagcccgagc 41881 gcgccgaacc cgccggtgat caggtaggcc gcgtccgggt cgaccggcag cgcggccgtt 41941 tcggctggcg cgagcgggct caggcgcgcg acatggcgcg cgccgtgccg caacgccacc 42001 tgctcctcgc ggctctcgcc gagcatctcc tgaagcagtg cctgcgtctc gttctccggc 42061 gcggccggat cgagatcgat cgcggtgccg aaccattccg gatgctcgat cattgccccg 42121 cgtgcgaggc ccgacagcgc agcctgggcg agcccggata cgtgcggcgc ttcgccggct 42181 tccaccgcgt cgcgcgtgac caccgagatc ctgggccggg tcgaaggcgt ccactcgcgc 42241 tcgctgccga ccagcgcgtg cacgagatgc agcagggcgg cggacatgcg cgtttcgccg 42301 acggcttcgt ccagcgccca taaaaagacg atgcgctggc cggaagcggc ggtttcgttc 42361 agcaagcgga cgaaatcgtc cggccgctcg ggcgcgacct gccagcccgc ttccgcgccg 42421 gtgacatagt cgatgccggg gcggaccagc gagcaggatg cgccgcgcgc gcgcagcagc 42481 gctgcaagcc gctcgccgac accgctcgca tccgcgaaga tcagccacgg ggacgcgtcg 42541 gcggcggccg gtgccgccgg catcgcggcc tgctgctccc acaccacgtg atagagcggg 42601 tgtgcgttcg acgcgacggt ctcggcggcg gcgaatgcag tcctgagcag gtccggaaac 42661 gcgttcagca tgtcctccgg gtacttgccg gacgacttga ggtgccgcaa cgctgcgtcg 42721 atgctgccgg catccatgcc gacgatcggc gacggaatct tctccaggct gaagcgctgc 42781 cgctcgaacg ggtagttcgg cagggtcgtg gcgggctggg cgggcgccgg aaacagcgcg 42841 cgccagtcga actgcgcgcc ctgcacgtac agcgccgcga gtgcgcgctc cagtgcatcg 42901 cccgcgcagg gcggcggcag ccagccgtcg gcgagcccct ccggcgggtg cgatgcgtcg 42961 gcctgatccg acgcgccagc cagttgcaac cagtactgcg ggtgcgtcac ctcgtcggtc 43021 acgtcggtgc cgagatagcc cgaaatcagg cggaccgacg gccgtgcgag cggcatgtcc 43081 cgaagcacgg cgcgcaacgc ttcggcatcc gaacgggcgg ccacgaggcg cagcgcgtcg 43141 gccacgctca cgacgcccgc cacgcaggcc gcgacatatt cgccgatgcc atggcccgac 43201 acgacggccg ggcggaggcc ccatcccttc cacagttccg cccacgcgaa ctggatcgcg 43261 aaccggcccg cgtcggtctc gagtgcgtcc agcggcaccg agcaacgcgc gaacgcgtcg 43321 cggaacagcg gttccgacgc gtggagcgcg tgcgcgacgc cggtgtccgg cacaccgaac 43381 ccgaagccca tgcgcaacgc cttgcccgtg cgcggcgcgg ccgccgacgc taccctcgcg 43441 cccgatacat aggcggcgcg aaacggatag tgactccgcc cggtggcggc ggcacggcag 43501 atcgcggcta gctcctgcgg cgtcgcgccg gcgatcgcgc gctcgtagcg tggcacgagc 43561 gccgccagcg ccgcttcgga ccttgccgac agcagcagca acgcgcgctg cgcggcgtgt 43621 gccggcgcga cgggcggttc ctcgacgatg gcgtgggcat tggtgccgct gaatccgaac 43681 gcgctcaccc cggcgatgcg cctgcgttcc ccgcgccgcc acgcgaccgg atcggccgcg 43741 acgcggatcg ggatgtcctg ccacggcgta tgcggattgg gttgcgtgaa atgcaggtgc 43801 gccggaatcc ggtcgtgctc gaacgacagc agcaccttga tcaggccggc gatgccggag 43861 gccgactcca gatgcccgat attggtcttg accgaaccga tcacgagcgg ctcgttcgcc 43921 gcgcgcccgg ggccatagac gccggccagc gcttcgacct cgatcgggtc gccgagggac 43981 gtgccggtgc cgtgggcctc gacgtaggac acgtcgccgg gcgcgaggcc ggcctggttc 44041 agtgcgcggc ggatcacccg ttcctgcgaa tcgcggctcg gcacggtcag cccgccgccc 44101 gcgccgccct ggtcgaccgc cgtgccgcgc acgatgccga gcacccggtc gccgtcggcg 44161 agcgcgtcgg cgaggcgctt gagcaccacc atgccgcacc cttcgccgcg cacatagccg 44221 tccgccgccg cgtcgaaggt cttgcagcgt ccgtccggcg acagcatgcg cgcctgcgag 44281 aagctgacca tgacctcggg cgacagcatc aggttgacgc cgcccgcgag cgccatgttg 44341 ctttcgcgcg agcgcaggct ttcgcaggcg aggtgcaggc acaccagcga agacgagcag 44401 gcggtgtcga tcgccatgct cgggccggtg aggcccagca cgaacgacag ccggcccgcg 44461 gccatgttca gcgcgctgcc cgtgccggca tagctgctcg acggcatcga cgcattggac 44521 acctggatcg cgtggtcgaa gcaggtgatg ccgacgtaca cgcccgtggc ggactgccgg 44581 aagcgttcgg gcgcgagatg ggcgttctcg agcgcctccc acgccacttc gagcaggagc 44641 cgttgttgcg gatcgaggta ggtcgcttcg cgcggcgcga tcccgaagaa cgccgcgtcg 44701 aattgatcca cgcgttcgag aaaggcgccg tggcgggtcg ccatcttgcc gggcgtggac 44761 ggatcggggt cgtagtagcg atcgatgtcc cagcgttcgc cgggcacttc ggtgacggca 44821 tcgtgcgcgc cgtcgagcaa ttgccagaac gcgtccggcg tatcgctgcg tccggggaag 44881 cggcaagcca tgccgatgac ggcgatcggc tcgttgcggt cagaacgcag cgccgcgatt 44941 tccgcgcgcc gcaggcgcag ttcgtcgagc gcggctttca gtgcatgcgt ggccttggcg 45001 ttcattgggc gccgatctcc tgggcgatca gttcggaaag gtcgtcctcg tcgaggtcgt 45061 cggatgcttc gtcgacgacc ggcgcgggga gcgacggcga cagttcgttg agcacgtact 45121 gggcgagcgt ctgcaggttc ggataggaaa agaacaacgt cgcgcgaaac ggtcttccga 45181 ataccttggt gaggcggtcc gtcagttcga gcgcgaccag cgaatccagg ccgagatcga 45241 gcagcgattg ctcgggcgcg atggcatcgg ggccggaaag gcgcaaggtt tcagccagca 45301 tcgccgcgag cgtgtcggtg atgcgctcga cccgttcgcg cggcgcgcac gcatgcagct 45361 ggcgcagcaa cgccgtctcc tgctgcgccg gctgcgcggc cggttgcgtc agctcggaaa 45421 acagcgcgga cccggcggcc ggcgcatcga cccggaacag ggtcggccag tcgatccgcg 45481 cgactccgga ctgggcgacg ccggacgcca tcagccgttc cagcgtcgcg atggccagtt 45541 cgggcggcag cgtgccgacg ccgagcgcgc cgagttgttc gtgcgcgcgc cgtccgtagt 45601 cggtggcggc gtggccgatc tccgcccacg gcccccaatt gacgctgagc cccggtttcc 45661 cctgcgcgcg ccgatgctgg gcgagcgcgt cgaggaagct gttcgccgcc gcgtagttgc 45721 cctggcccgg catggtgatc agcgcggcca tcgacgagaa caggacgaaa tggtccagcg 45781 gcaagccggc cgtcagctcg tgcagatacc acgcgccgtc ggccttgccg ctgccggcgc 45841 gatggaagaa gtcgtcgtcc tggcgtgtca gcagcgcatc gtcgagcgcg ccggcgaggt 45901 gaaagatccc tttgagcggc ggcatcgaat gcgcgatttc accgagcgcc tgcccgacgt 45961 cctcgcgacg cgacaagtcg gcgcgaatga accgtgcgtc gagcgtgcgc aggattttcc 46021 cggctgcggc ggaaggttcg ccgcgcccca gcagcacgat tttcccggcg ccgttgtcgg 46081 caagccagga cgcgagccgc aggccgagcc cgccgagccc gccggtcaca agataggtcg 46141 cgtcaccgtg gaaccggatc ggccggtggc tgacgtattc gcgattgtcg cgggcgatgc 46201 gcgcgacgta gcgctggtcg cggcgaaacg cgatcatgtc ttcacggccg ccagcctgta 46261 ccgcttgcat gatgtccgct gccgacggct gctcgggatc gaggtcgacg agcccgcccc 46321 acagcgccgc atgctccacc gcgatcgcgc ggcccaatcc ccacagcggc gcctgtgcca 46381 ccgcgatcga ttcgccatcc agaacattca tcgcacccga cgtcaccagc cacaggcgag 46441 cctgccgggc cgacggcgcg cgtgacgcaa gcgccctgac caggtgcagc acgctcgcgc 46501 tggcacgccg tctcgccgcg atgtcagagg gtgcgagatc gagactccac aggtggatga 46561 cgcccttcag cgggcggtcg gccgcgggca gttccggcgt cgcgtcggcg aagcgcagcg 46621 tgcacgtatc gccgtgggct tccagcagag ctgacagctg ggcgcccacg ccgccgcggt 46681 ccgcgagaat cagccactcg ccgtgcgccg aaccgccggt tgccgcgtcg acgttcgacg 46741 gtctccagac gcgttgataa agcagcgcgg cgaagtcgtg ccgctcgacg gcgcgcgccg 46801 cgcgaacctg ttgcaaccgc agtgcatcga tctcgatcag cagtcggcca gcaaggtcat 46861 ggacgcggat gtcgccctcc agcgcgccct gtccgatcgg cgtgcgcagc gtggcgtgac 46921 tccatgcctc ggtcgacgcc ggcggctgat ggacccgtac cgcgccgatc gagctgggca 46981 ggtacaggtc gcccgactcc agcgcgtccg gatcgatggc ggcggcgagc acgcggctgc 47041 atgcgtcgag aaaggcgggg tgtacctggt acggcgacga cgccagcgca tctgccggca 47101 ggctgatttt ccccagcgcc tcgccggtcg tgcgccagat ctgccggatc gcgtcgaaca 47161 cgccgtcgat ctgcacgccg tgctgccgaa tttcgccgtt gaagtccgcg cccgacgtcg 47221 tttcggtgca gcgggcctgc acctcggcgg catcgaatcg cgtcggcgcg gcggatcgcc 47281 ggggggcaca catttcccgg agccggcgca gctgcggaag attgccgagg atccgctcga 47341 ccggcggacc gaaatcgagc aggcaggcca cttcatccac gccgatcgac tcgagatccc 47401 gcaccagttc gacgcaggtt tccggcgtgc cgatgagccc gcgcgattgc gcgaagcgtt 47461 catagagaaa ctcgacgaac tcgtccagct cgcgtgcgcc catcgcgcgc acgtcgaccg 47521 actggccgcg actctgcgcc agcccgttca atagcccgat attgctgcgg atgtagttgc 47581 agaacggcac acgcgcctgt tcgcgcgcct gcgccgcatc gtcgccgacg aacgtatgca 47641 gcatcacgga aacggtgccg gccgccggat cgaagccatg cttcgcacgc gcctcgcggt 47701 agagcgcgat cttgtgcgcg agctggtcac gatcctggtc gagcacgtgg gtcagcaggt 47761 tggcgccggc ttcgccggca cgcacgaatg tctgcggatt gctcgcggcg gtcacccaga 47821 cgggcagctc cggctgcacc ggcgtcggat agacacgcaa ccgcaccggc ttgccgacac 47881 cgttcgtcgc atccagcgtg ccgccgcgcc acagatgctg gacggcgcgc atcgtggtca 47941 gcatgtcgtc ctgccgggtc gcatatttgt ccggggcaaa cacgaagtcg tcaggattcc 48001 atccggaggc gaacgacacg cccacgcggc cgttcgacag gttgtccacc atcgaccatt 48061 cttccgcgat ccggatcggg ttgtgcagcg ccgcgaccac gctgcccgcg accagcttca 48121 cgcgctgggt ggccgcggcg agcgcggcgt gcaggacggc gggattcggg taaagcgagc 48181 cgaattcggt gaaatggcgc tccggcaccc agacgctgga gaacccgttc gcatcggcga 48241 aacgcgcgct ctccatcacg agctggtact tgttgccgga cagcgcctct tcactgctgg 48301 cgaagaacat cagtccgaat ttcatgcgtg gctccgatcc gattcgtgaa tttcggcact 48361 cgcgcacatc tgccacgtcg cggcggcgcg ggtgtcgtcg atccggtgat agacggcaaa 48421 cgaaaacggt ccccaggacc ggcggctcag cacggtctgc acggtgtgcg attcgtgcgg 48481 atgcagcggc aacggcgcat gcagtgcgag gtccttcaac gtcgtatggc cggctgcgcc 48541 gatttccgac gttgccgaca gcgccatttc cacgaaggcg gaatagggca ggacgggcga 48601 ccccttgacg cgatgaccgt cgagaaagtt ggttgccggc gcatcgagac gcgattgcca 48661 gatccacgtg gccggcgcat gcgcgtgctg ctccatgagg cgcccgagca acggatgccg 48721 acgcgcatgt ggcctgatcc agaagccgcg ccgctcgaac gggtaggtcg gcagggcgag 48781 ccggcggtgc ggtgcacctt gctccacggc atcccagtcg atggatgcgc cgcgtacgta 48841 gagcgcggcg agcgtgtgca ggatcgcgtc ccacgcggcc gtgtgcgcgc cgatgtcgat 48901 cacgatgccg gggtgtcctg ccgcaccgct gtccggcgcc tgcggcacgc cggcccacgc 48961 ggctgcggcg cgctgcccgt cgccggtgct gctgaccgca tccggtgcga tgccgaagga 49021 catccacagt tgcgcgagcg cgcgctggaa tctcgtgaac ccggcttcgt cgggggcgag 49081 cgcgggcgcg ccggatgcgt cggactgccg ctgcatcagc gcgtcgaaag cggggctggc 49141 cgcgcgcaat tgccgaaccg cgtcggcgct ggcgccgtcg tcggcgcaaa agtggaacgt 49201 caccgcgggc ggtgtttcgg caggctcccc ggacgaaacg gaatcaagtt gcgcacgcaa 49261 cgaatcgcga ctcggtgcga cgatggccgc gcgctgcgtg aagtgggtgc gcccggtatt 49321 ggccgtgaac gcgacatccc gcacaccggc ctcgggatgg gcgtcgagat aggccgcata 49381 ggacgcagcg agcgcttgca acgcgtccgg cgtgcgcgcg gagagcgtca cgacgcgcgc 49441 cgcgggtgca accggttcgg cttcgatctc cgggagcccg ggtgcttctg acaggatcag 49501 gtgcgcgttg gtgccgccga agccgaacga gctcacccct gccaggcgcg gcccgtgttc 49561 cgaatgccag ggcgtgacct gccgaggaat ccggaagggc gtgccgtcga gcgcgatttg 49621 cggattgatc gaccggaaat ggaggttcgg cggaatcgcg cgatggtgta gtgcaagggc 49681 ggtcttgatc aggctggcga tgcccgcggc cgattccagg tggccgatgt tggtcttgac 49741 cgacccgatc cagcagagat cgtccgggcg gcgggattcg ttcaggacgg ccgccagcga 49801 gttcaactcg atcgggtcgc cgagcggcgt gcccgtcccg tgcgtctcga cgaagccgat 49861 gtcctgcgcg cgtacaccgg catcgcgcag cgcgccgtga atcacggcct gctgggccgg 49921 gccattcggc gcggtcaggc cgttgctgcg cccatcctga ttcaccgcgg agccgcggat 49981 cacggcgaac acggtgtcgc cgttctcgag cgcatcgtcg agccgcttga gcagcaccat 50041 gcccacgcct tcgccgcgaa cataaccgtt cgctgccgcg tcgaacgcct tgcatcggcc 50101 gtccggcgac agcatgcccg cttgcgtgaa ggacgcgctc aattgcggcg ccagaatcag 50161 gttgaccccg ccggccagcg ccgcatcgga ctcgccgcgc tgcagcgcgc ggcacgcctg 50221 gtgaaccgcg acgagcgagg acgaacacgc ggtgtcgacc gcccagctcg ggccgcgcaa 50281 atcgagcgcg taggaaatgc ggttggcggc gacgctgagc gcattgcccg tcgcgacata 50341 agggccgacg tccgcgactt cgtcctgcgc cagacggatg tagtccgaat tgctgatgcc 50401 gacgatgacc gcggtgcgtc cgccggcgag gctgcggggt gcgatccccg catgctcgag 50461 cgtctcccag gccacctcca gcagcaggcg ctgttgcgga tccatcgatt cggcttcgcg 50521 ggcgctgatg ccgaagaaag ccgcatcgaa ttgatcgacc tgatccagca gtccggcgag 50581 cggaaggtcg gccgcgcgct gcgtcgccgc accgaccgcg tcccggccct ccagcagaag 50641 ctgccagaat gcgtcgggat tgccggcgcc ggggaagcgg catcccatcc cgacgatcgc 50701 gatatccgcg cgtgcttcgg ccgagcccgg cgcctggtcc ggcatggcac tcccggtgcc 50761 gctcaaatgg cgcgccagca gggaaatact cggaaaatca tagacgacgg tcggggaaac 50821 cggccgcccg agccagtcct gcagctcgcc cgagagcatg atggcgtcct tcgaatcgag 50881 cccgtggacg ctgaacggcg cgtcggggtc gatcttgccg gaagcgattc ccgacagacg 50941 cgagacacgc tcgatgcacc attgcaccag cgcttgcgtg tcgcgtggct cggcagtctg 51001 cgggggggct ggcggcgcgg agaacgcacg ccgccattcg cccgcgatcg cgagcccctg 51061 ttcatcgagg aatgcctgcc tgatccggct ccgctggatt tttccgctgg acgtgcgcag 51121 gatcgtggca ggtttcaaca ggactgccgc atacagatcg acgtcgtgca cttcggcgag 51181 cgtgtgccgg atctcggcgg ccacggcttc cgcgtccagc gtgttgagcg cttcccggcg 51241 cacttcacag gcgacgacga cccgctccac gttatcgacg tggatcgaga aagccgccga 51301 tgcgttcggc gccagcgcgg ggtggctgcc ctccgcggat tgctcgagat cctgcgggta 51361 gtgattgcgg ccggcgacga tgatgaggtc tttcaagcgg ccggtaacga agagatcctc 51421 gccatcgacg aagccgagat cgcccgtgcg caggtaacgc gcgtcatcgc cgtccagctt 51481 cgcgcggaag gtgcgctccg tttcgtcgat acggttccag tagccgacgc cgacactcgg 51541 gccggtcagc cagatttcgc cgatccggcc gggcgcgcag cgctcaccgg tatccggatt 51601 cacgatgcgc acgcggtgct cagcccaggt ccggccgcat gagaccagcg cgtggcgctt 51661 gccggagtcg tttctcgtcg ccacgccttg tgccagcgcg tcggcatcgt agtccgccac 51721 gcgcggcagc gagcgtgccg gctggccgga gatgaacaag gtcgcctcgg ccatcccgta 51781 gacggggcgc atggtgtgcg cgtggaagcc gcacgcggcg aatgcgcgcg aaaaacgcgc 51841 caccgactcc gcgcgcaccg gttccgcgcc gttgaatgca acccgccagc tgctcaggtc 51901 cagctgcgcg cgcgcttcat cggcgatttt gcgagcacac aggtcatacg cgaaatccgg 51961 cgcggcacaa tgcgtgccgc gatacttcgt gatggcctgc agccagcgca cgggtttctg 52021 cacgaatgcc gcgggcgcca tcagcaccga cagcacgccg agatagatcg gcagcaacac 52081 cttcccgaag aaacccatgt cgtgaaacac cgggagccag ctgacgaaca ccgtcgacgc 52141 atcggcatcg ctcgcctcgg cgatgaccgc catattgctc aggatgttcg cgtggctgat 52201 catcacgcct ttgggcgtac cggtggagcc tgacgtgtat tgcagaagcg ccagcgtctg 52261 cggcgtgatg tccggtgcgc gccattgttc ggccggggcg tcgaagcgct ggtccgtcgc 52321 caggatcttc agttccagcg tgtcggaata accgtccgcg tgatgcgcga tgccgtcgag 52381 cgtcgcggcg tccgtcagcg cgacgaccgg cgtggcgtcg gcgacgatgg ccttgagacg 52441 atcggcggga cgatgcctgc gcggtggata cgcgggtacg ccgatcaggc cggcgtacag 52501 gcatcccacc catgcgcaga tgaattccag cccgggcgga taaaccagaa ggacgcgatc 52561 gcccggttga gcgatggctt gcagcctggc ggcgatgccg cgagcccgct tgtccaggtc 52621 gccgaacgtg aggcgggtca gctccgcttc gccgttctcg agaaaaatga atgcggtctt 52681 ctccggttcg accttgccgc gaaacaacaa aatttctgta acagtcctga attttgtatc 52741 gggaagcatg ctcaaccttc gttgtcttct aaacgttgaa tatctcagga ccggttgtgg 52801 cgatcccgcc aagcgtgctt catcggacgg tatcgaaatt agagcattgc tctaatccgg 52861 cgtctgcccc gtaatccaag gacacggcgt ttcgcgcact ggatcaatac ggcttgtcat 52921 tgatgtgcac gctcgctaac gatcggcgat tccttcgatg tcgggcgtgt acgggtccag 52981 cagcgacacg acgaccttgc gctcgccttc gaacgggttg cggccatgcg cgaagcgcat 53041 gttgtcgacc agcaggacgt cgcctcgttg ccacggaaac gtgatcgcgc attcgcggaa 53101 cgcgtggcgg atctgctcga ggtcggcgag atcgaacgga ctcccgtcgc catggcaggc 53161 attgcgcgga atgcgatcct cgccgaacag gctgacgatc gaactggcga gcgatgcttc 53221 caggttcgag atatggaaca gatgggcctg attgaagaac acccgctcgc cggtgaccgg 53281 atggtaggcc acgccctggt tgatctgcgc ggtgcgcaac gtgtcgtcgt cgagccattc 53341 gagcgcgatg ccgttatccg cgcagaaggc tgcaacctgg ttgcggtcgc tggtctggaa 53401 cacggtctcc cacggaatgt cgacgtgccg ccggtagtgc ctgacatagc ggacctgtct 53461 cgcctcgaag tgatccagga tgcgcggtcc gatcctgcgg ctcacctccc gcatgtcggc 53521 aatcggcgtt tcgccgccgg tcgcggccgg cgtcaggcaa cagaaggcca ctcgcagcgg 53581 ccagcttcgt tgatacgcgt tttcgcaatg aagggcgatc gtctcgctcg gcggatactc 53641 ggttgcggtg aagatgccgt tgccgatcga ggtgcgcggc gtggaacggt aaacgtagtc 53701 ggactgatgg gccgaaatcg cgcgagcaaa cgcttcgaag ccgcccacgg atgaaacgtc 53761 gaagccacga aacaggagta cgccgtgttc cagaagccgg gattcgagtg ccgcccggtt 53821 gtcgttcacc gcctgcgcca gatcgcgtcc attcgataca ggctccagca gccacggcgt 53881 gcttccctcg gcaagcaact tgcgttccgt catgcccagc atcgtcaata gtcctttcct 53941 gtacgtggat cacggcgaag ccgaacgggt cggcccgcgt ggtcgcgccg cggtgcggct 54001 atgcgcggca ggccgtttcc acggcatgct cgaagcgatt gagaatgtcg tggatgtccg 54061 cttccgaaac gatcagcggc ggcaggaacc ggagcaccgc gccgttgcgg ccgccggttt 54121 cgacgatgag cccgtttcgc aggcagttct gcttgatggc tcttgcccgt tccgtgtggg 54181 gcgggccggc tcggccgtgg gtgccgggca cgacgacttc ggcgccgatc atcaggccgc 54241 ggccgcgtat ctggcccagg caggggaagc gttcggcaag ctcctcgagg ccggcaacca 54301 ggagtttgcc gaccctgtcc gcgtgcgccg acagatcttc tctctcgacg atgcgcatgg 54361 tcgacaagcc ggccaccatc gcaatctggt tgcctcgaaa ggtgccggca tgcgcgccgg 54421 gcggccaggt gtccaggcgc tcgtcataga ccaccaccga taacggatag ccgccgccga 54481 atgccttcga cagcaccagt acgtccggcc ggatgccgga atgttcgatc gcgaacaggg 54541 cgccggtgcg accgagtccg gtctgcactt catcgacgat caacgggatt tcatgccgca 54601 gcgtcagctc gcgcaactcg atcaaccagg tgtcgggagc ggggatgcag cctccttcgc 54661 cttgcacgac ttcgacgatg atggccgccg gcttcgtgat cccgctctcg ggatcggaca 54721 ggacggtccg gatgtagttg atgctgagtt gatcggtcgc cgagccgtcg gtgccgaacg 54781 ggcagcgaaa ggcgtaggga tagggcagga aatgaacgtc gcgtccgttg ccgccggccg 54841 acttgggcgt gaggtttccc gacgcggcga gtgcgccgga cgtcatgccg tggtaggcgc 54901 cgtggaacgc catgatcgtc ggccggccgg tatagtgccg ggtcagcttg atcgccgctt 54961 cgacgccatc cgcgccactg gggctgcaaa actggatctt gccggattcg gcgatcttcc 55021 cgggcagaag cgagaaaagc tgctcgacga atgcgtgctt ggccggcgtc gccagatcga 55081 gtgcctgttg catctgatcg gacgacagaa accgcatcac ggcttcattg acttccgggt 55141 gattgtgtcc gagcgcgagc gtgcccgcat tcgacaggca gtcgatgtat tcctgcccgt 55201 cggcgtcgcg tacgcgtatg cctttcgcat gggtaaacag ccgcgggaag gaggttgcgt 55261 aggttcgcgc gttcgattcg acctgcttca gatactcgag tttttccatg cgcgcagatc 55321 cggcttgcaa ggcggattga tggacactgg cgcacgagaa tcgcttcatc ctggccaatg 55381 gtgtttaacg gtacgaccgg attggagcat ggtctccgta tcgcgtctgt cacgtaaaaa 55441 tgggacatcg gccatgcgac gtcaccacgt catgccgttg ccttccgatc atcgaagcgg 55501 tttccgggcg cgacgtcagg cagcgagggt cgagcagaaa taatcgatgg tccgttggag 55561 acccgcttcg agcccgatcg tcggctccca gtcgaggtgg gtgcgtgcga ggctgatgtc 55621 ggggcaacgt tgcgtcggat cgtccttcgg cagcggacgg aatacgagcc gcgacttcga 55681 gccggtcagg cgcaagatga tctgcgccag ttcgctgacc gcgatctcgt gcggattgcc 55741 gaggttgatc gggccggtga gctccgcggg cgtggccatc atccggatca aaccgtcgac 55801 catgtcgtcg acatagcaga atgcccgggt ctggctgccg tcgccataca gcgtgatgtc 55861 ctcgccccgc agcgcctgca cgatgaagtt ggacacgacg cggccgtcgt tgggatgcat 55921 gcgcggcccg tacgtgttga agatgcgtac caccttgatt cgtacgttct gctggcggtg 55981 atagtcgaag aacagggtct ccgcgcaacg cttgccttcg tcgtagcagg cgcgcggccc 56041 gagcgggttg acgttgcccc ggtaactctc cggttgcgga tgcacatcgg ggtcgccgta 56101 cacctcgctc gtcgacgttt gcagaacgcg tgcatgcgtg cgcttggcga gcccgagcat 56161 gttgatcgcg cccatcacac tggtcttggt ggtctgcacg ggatcgaatt gatagtggat 56221 gggcgaagcc gggcaggcga ggttgtagat ctcgtccacc tccacgtaca acggaaaagt 56281 gacgtcgtgg cgcagcgcct cgaagctcgg gttgccgagc agcgtagcca cgttctgctt 56341 cgtgccggtg aaatagttgt cgacgcacaa tacgtcgtga ccgagttcga cgagacgctc 56401 gcaaagatgc gaaccgagga aacccgcgcc acccgttacg aggattcgct ttcgattacg 56461 ttgcacaatt gcactccaag tatcgcgcgc tgggaagcga cgcggcctcc ccgcacgctt 56521 gaccggcccg cggcaccggc aggggagcgg atcaggcgcg cgggcgtttg cattcgacga 56581 tcacggcgcc ggccggcacg ccgatcgcga ggatcggccc gtcatgcctg cagtgcgctc 56641 gacgcggcgt gctccgggcg ccgcatgcgc gccgcgatga tgccggccat cgttcgcatt 56701 tcgtttctca aaaagaaatg atccccttcg atgacgtgaa aatcgaagcg cccggtcgtc 56761 gcggcgcccc agcctgcaac ggcatcgacg gggatctctt tatccgcccg gcccgcgaac 56821 gcggtgatgt ccaccgccag cctgggcccg ggcacgggcc ggtggttttc gatcatcgtg 56881 aaatccgcac gcagcgccgg catcagcagc gccatcagtt cgctgttgtc cagcaccgcc 56941 ttcggtgtgc cgcccatttc gcgcagcgca tcgatgaagg cgcggtcgtc cagcgcctgc 57001 atgcgccgat cgtggcgctc cttgcccggt gcggcacgcg cgctcacgaa cagatgccgc 57061 aggttcggtc gtgcgtgggc gggaagccgc agggccagtt cggccgcaat ggccgcgccc 57121 atgctgtgtc cgagcagtgc gaagggacga tcgaagcagt cgtccaggtc gcacagcaac 57181 gtgtcgacca gcgtcgccat gtctcggacg gcaggctcgg acaggcggct gcctcggcct 57241 gcaagttcat gacggcacac ttcgatgccc ggtaacgacg cttgcagcgt gcgatagacg 57301 gcggccgagc cgcccgcata gggaaaacag atcagacgca tgcgggcggg tactcgagcg 57361 gctcatctgc tgccggcgcg caggcgatgg cgctgtggaa attcatgtgt tcggcgtttt 57421 tcaccattca ggttccagat ccggttgggc gtgagttaaa cacgaggctg cgtggatgta 57481 tgtcgtagga agaggggacg cgttgtcggc catgtcgaag cggttcgtct ctgaatggat 57541 cccggcgcgg acacggtatc ggcgaaaaca gatgcgcggg aaatcgcgac gcatctgagt 57601 gtgtcgaacg atgcgcttcg tctttagaat gggcagcgag catggcgagc catcagaatt 57661 gcggcatccg atggtgccgc cgcgctaccc gataagttgg agacatacta tgcaacaccg 57721 tcagaaagcc gtcccgaccc agcaagtcgc gaacgagcgc gtgatcgtca ccgaatggcg 57781 attcgcgccc ggcgccgaga ccggctggca tgttcaccgg catgactatg tcgtggtgcc 57841 gcaaacggac ggtcagcttc tcctcgaaac cgcacaaggc aaccgcgagt cgcaattgca 57901 cgccgggcgc agctatgcgg ggctgaaggg cgtcgagcat aacgtcgtca acgcgacgga 57961 ccacgaagtg gtgttcgtcg aagtcgagat tctctaaggg gcgtcaggcc ccgcgagcaa 58021 ggccacgaca gggagcagca ggatgaaaat gaccgacatc ccgtttggca cgaccgactg 58081 gcgcaccgtt gaaccgaccg a (SEQ ID NO: 23)

REFERENCES

[0076] (1) Fischbach, M. A.; Walsh, C. T. Chem. Rev. 2006, 106, 3468-3496. [0077] (2) Koglin, A.; Löhr, F.; Bernhard, F.; Rogov, V. V.; Frueh, D. P.; Strieter, E. R.; Mofid, M. R.; Güntert, P.; Wagner, G.; Walsh, C. T.; Marahiel, M. A.; Dötsch, V. Nature 2008, 454, 907-911. [0078] (3) Koglin, A.; Mofid, M. R.; Lohr, F.; Schafer, B.; Rogov, V. V.; Blum, M.-M.; Mittag, T.; Marahiel, M. A.; Bernhard, F.; Dotsch, V. Science 2006, 312, 273-276. [0079] (4) Kohli, R. M.; Takagi, J.; Walsh, C. T. PNAS 2002, 99, 1247-1252. [0080] (5) Lautru, S.; Challis, G. L. Microbiology 2004, 150, 1629-1636. [0081] (6) Samel, S. A.; Wagner, B.; Marahiel, M. A.; Essen, L.-O. J. Mol. Biol. 2006, 359, 876-889. [0082] (7) Walsh, C. T. Science 2004, 303, 1805-1810. [0083] (8) White, C. J.; Yudin, A. K. Nat. Chem. 2011, 3, 509-524. [0084] (9) Yeh, E.; Kohli, R. M.; Bruner, S. D.; Walsh, C. T. Chembiochem 2004, 5, 1290-1293. [0085] (10) Boddy, C. N. Chem. Biol. 2004, 11, 1599-1600. [0086] (11) Boguslaysky, V.; Hruby, V. J.; O'Brien, D. F.; Misicka, A.; Lipkowski, A. W. J. Pept. Res. 2003, 61, 287-297. [0087] (12) Fernandez-Lopez, S.; Kim, H. S.; Choi, E. C.; Delgado, M.; Granja, J. R.; Khasanov, A.; Kraehenbuehl, K.; Long, G.; Weinberger, D. A.; Wilcoxen, K. M.; Ghadiri, M. R. Nature 2001, 412, 452-455. [0088] (13) Fridkin, G.; Gilon, C. J. Pept. Res. 2002, 60, 104-111. [0089] (14) Jelokhani-Niaraki, M.; Hodges, R. S.; Meissner, J. E.; Hassenstein, U. E.; Wheaton, L. Biophys. J. 2008, 95, 3306-3321. [0090] (15) Jelokhani-Niaraki, M.; Prenner, E. J.; Kondejewski, L. H.; Kay, C. M.; McElhaney, R. N.; Hodges, R. S. J. Pept. Res. 2001, 58, 293-306. [0091] (16) Kohli, R. M.; Walsh, C. T.; Burkart, M. D. Nature 2002, 418, 658-661. [0092] (17) Rayan, A.; Senderowitz, H.; Goldblum, A. J. Mol. Graph. Model. 2004, 22, 319-333. [0093] (18) Schwarzer, D.; Mootz, H. D.; Marahiel, M. A., Chem. Biol. 2001, 8, 997-1010. [0094] (19) Ellis, D.; Gosai, J.; Emrick, C.; Heintz, R.; Romans, L.; Gordon, D.; Lu, S.-E.; Austin, F.; Smith, L. Antimicrob. Agents Ch. 2012, 56, 765-769. [0095] (20) Sieber, S. A.; Marahiel, M. A. J. Bacteriol. 2003, 185, 7036-7043. [0096] (21) Tseng, C. C.; Bruner, S. D.; Kohli, R. M.; Marahiel, M. A.; Walsh, C. T.; Sieber, S. A. Biochemistry 2002, 41, 13350-13359. [0097] (22) Gu, G.; Smith, L.; Liu, A.; Lu, S.-E. Appl. Environ. Microbiol. 2011, 77, 6189-6198. [0098] (23) Gu, G.; Smith, L.; Wang, N.; Wang, H.; Lu, S.-E. Biochem. Bioph. Res. Co. 2009, 380, 328-332. [0099] (24) Gu, G.; Wang, N.; Chaney, N.; Smith, L.; Lu, S.-E. FEMS Microbiol. Lett. 2009, 297, 54-60. [0100] (25) Lu, S.-E.; Novak, J.; Austin, F. W.; Gu, G.; Ellis, D.; Kirk, M.; Wilson-Stanford, S.; Tonelli, M.; Smith, L. Biochemistry 2009, 48, 8312-8321. [0101] (26) Tan, W.; Cooley, J.; Austin, F.; Lu, S.-E.; Smith, L.; Pruett, S. Int. J Toxicol. 2012, 31, 326-336. [0102] (27) Heikkinen, S.; Toikka, M. M.; Karhunen, P. T.; Kilpelainen, I. A. JACS 2003, 125, 4362-4367. [0103] (28) Rai, R. K.; Tripathi, P.; Sinha, N. Anal. Chem. 2009, 81, 10232-10238. [0104] (29) Baysal, C.; Meirovitch, H. Biopolymers 1999, 50, 329-344. [0105] (30) Bonmatin, J.-M.; Laprévote, O.; Peypoux, F. Com. Chem. High T Scr. 2003, 6, 541-556. [0106] (31) Liao, G.; Shi, T.; Xie, J. J. Cell. Biochem. 2012, 113, 735-741. [0107] (32) Vilhena, C.; Bettencourt, A. Mini Rev. Med. Chem. 2012, 12, 202-209. [0108] (33) Alexeyev, M. F. Biotechniques 1995, 18, 52. [0109] (34) Prentki, P.; Karch, F.; Iida, S.; Meyer, J. Gene 1981, 14, 289-299. [0110] (35) Lu, S.-E.; Scholz-Schroeder, B. K.; Gross, D. C. MPMI 2002, 15, 43-53. [0111] (36) Wüthrich, K., NMR of Proteins and Nucleic Acids; Wiley, New York, 1986. [0112] (37) Delaglio, F.; Grzesiek, S.; Vuister, G. W.; Zhu, G.; Pfeifer, J.; Bax, A. J. Biomol. NMR 1995, 6, 277-293. [0113] (38) Johnson, B. A.; Blevins, R. A. J. Biomol. NMR 1994, 4, 603-614.