Disulfide-type HMGB1-specific antibody, method for measuring disulfide-type HMGB1 and kit for said measurement, and measurement method capable of quantitating all of HMGB1 molecules including reduced HMGB1, disulfide-type HMGB1 and thrombin-cleavable HMGB1 and kit for said measurement

11174310 · 2021-11-16

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides antibodies that show specific reactivity to disulfide-type HMGB1. Furthermore, the present invention provides methods for specifically measuring disulfide-type HMGB1 using the antibodies, and kits or reagents for the measurement. The present invention also provides methods for measuring total HMGB1 using such an antibody and an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1, and kits or reagents for the measurement.

Claims

1. An antibody which comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 49.

2. A monoclonal antibody HMa186 produced by a hybridoma identified by accession number MTh BP-02019.

3. A low-molecular-weight antibody of the antibody of claim 1 or 2.

4. A fragment of the antibody of claim 1 or 2, which has specific binding activity to disulfide-type high mobility group box 1 (HMGB1).

5. A chimeric antibody or humanized antibody of the antibody of claim 1 or 2.

6. A human antibody of the antibody of claim 1 or 2.

7. A method for producing a chimeric antibody or humanized antibody of the antibody of claim 1 or 2, which comprises linking a DNA encoding a variable region of the antibody of claim 1 or 2 with a DNA encoding a constant region of the antibody of claim 1 or 2 to form a linked constant and variable region; inserting the linked constant and variable region into an expression vector; introducing the vector into a host; and producing the variable region and the constant region of the antibody.

8. A kit or reagent for measuring or detecting total high mobility group box 1 (HMGB1) in a sample, which comprises the antibodies of (a) and (b) below: (a) the antibody of claim 1 or 2; and (b) a monoclonal antibody HMa166 produced by a hybridoma identified by accession number MTh BP-02020.

9. The kit or reagent of claim 8, wherein total high mobility group box 1 (HMGB1) includes disulfide-type HMGB1, reduced-type HMGB1, and thrombin-cleaved HMGB1.

10. A monoclonal antibody HMa166 produced by a hybridoma identified by accession number NITE BP-02020.

11. A monoclonal antibody CP11-1 produced by a hybridoma identified by accession number NITE BP-02021.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows the amino acid sequence (SEQ ID NO: 9) of human HMGB1.

(2) FIG. 2 presents graphs indicating the reactivity between each antibody and the HMGB1 peptides.

(3) FIG. 3 presents graphs indicating the reactivity between each antibody and the HMGB1-NT peptide.

(4) FIG. 4 presents photographs indicating the reactivity of each antibody by dot blotting.

(5) FIG. 5 shows a schematic diagram of the reactivity of each antibody to the human HMGB1 peptides.

(6) FIG. 6 shows a schematic diagram of the redox states of HMGB1.

(7) FIG. 7 presents photographs showing SDS-PAGE of recombinant human HMGB1.

(8) FIG. 8 presents a graph showing the reactivity between each antibody and disulfide-type/reduced/alkylated rhHMGB1.

(9) FIG. 9 presents a photograph showing SDS-PAGE of thrombin-digested HMGB1 and the analysis of the N-terminal amino acid sequence (SEQ ID NO: 8).

(10) FIG. 10 presents a graph showing the reactivities of the HMa166 and HMa186 antibodies to thrombin-digested rhHMGB1 (des-HMGB1).

(11) FIG. 11 presents a graph showing results of disulfide-type-specific HMGB1 ELISA measured by immobilization of HMa186.

(12) FIG. 12 presents a graph showing results of total HMGB1 ELISA measured by immobilization of both of the HMa186 and HMa166 antibodies.

(13) FIG. 13 shows results of optimization studies on total HMGB1 ELISA measurements.

(14) FIG. 14 shows an alignment of the HMa186 V.sub.H region analyzed by IGBLAST.

(15) FIG. 15 shows an alignment of the HMa186 V.sub.k region analyzed by IGBLAST.

(16) FIG. 16 shows an alignment of the HMa166 V.sub.H region analyzed by IGBLAST.

MODE FOR CARRYING OUT THE INVENTION

(17) Herein below, the present invention will be described in detail. The following modes for carrying out the invention are only examples and the present invention is not necessarily limited to the following contents.

(18) The present invention relates to an antibody which specifically binds to disulfide-type HMGB1. In the present invention, disulfide-type HMGB1 refers to HMGB1 in which a disulfide bond is formed between cysteines at positions 23 and 45 of HMGB1. Therefore, while the disulfide-type HMGB1-specific antibody of the present invention is not limited to the following, it is preferably an antibody that recognizes an antigenic determinant comprising a disulfide bond formed by cysteines at position 23 (C.sub.23) and position 45 (C.sub.45) of disulfide-type HMGB1. Alternatively, while the disulfide-type HMGB1-specific antibody of the present invention is not limited to the following, it is preferably an antibody that recognizes the amino acid sequence consisting of cysteine at position 23 (C.sub.23) to cysteine at position 45 (C.sub.45) of disulfide-type HMGB1 as an epitope.

(19) Furthermore, the present invention relates to the antibody which specifically binds to disulfide-type HMGB1, in which the antibody has neutralizing activity against disulfide-type HMGB1 having activity to bind to MD-2 and/or disulfide-type HMGB1 having cytokine-inducing ability. It is known that disulfide-type HMGB1 binds to MD-2 with high affinity in vitro, and promotes the secretion of inflammatory cytokine tumor necrosis factor (TNF) by mouse macrophages. Furthermore, disulfide-type HMGB1 is known to stimulate inflammation (cytokine secretion, and such). Antibodies of the present invention can neutralize such activities possessed by disulfide-type HMGB1. Whether an antibody that binds to disulfide-type HMGB1 neutralizes the activity of disulfide-type HMGB1 can be determined by using a biomolecular interaction analyzer such as Biacore (GE Healthcare) to observe the phenomena of neutralization of this activity by the antibody against disulfide-type HMGB1 bound to MD-2 immobilized onto a sensor chip. Alternatively, the determination can be carried out by adding disulfide-type HMGB1 to immunocompetent cells such as macrophages and established cell lines such as RAW264.7 cells, and measuring the phenomena of neutralization of secretion of cytokines such as TNF, IL-6, IL-10, ILβ, and MIP-2 by the antibody.

(20) Furthermore, the present invention relates to a fragment of the HMGB1 antibody which can specifically recognize disulfide-type HMGB1. Antibody fragments can be generated, for example, by digesting an antibody with an enzyme. Examples of enzymes for generating antibody fragments include papain, pepsin, and plasmin. Alternatively. DNAs encoding such antibody fragments can be constructed, and after inserting them into expression vectors, the antibody fragments can be expressed in appropriate host cells.

(21) The antibody which specifically binds to disulfide-type HMGB1 of the present invention is not particularly limited as long as it can specifically recognize HMGB1 in which a disulfide bond is formed between cysteines at positions 23 and 45 of HMGB1. For example, thrombin-cleaved HMGB1 (des-HMGB1) having the amino acid sequence formed by cleaving off the N-terminal amino acids M1 to R10 of HMGB1 from full-length HMGB1, which is described below, also includes a disulfide bond formed by cysteines at position 23 (C.sub.23) and position 45 (C.sub.45) in full-length HMGB1, as with disulfide-type HMGB1. The antibody which specifically binds to disulfide-type HMGB1 of the present invention may also have binding activity to HMGB1 having the amino acid sequence formed by cleaving off the N-terminal amino acids M1 to R10 of HMGB1 from full-length HMGB1, in which a disulfide bond is formed between cysteines at positions 23 and 45 in full-length HMGB1 (or cysteines at positions 13 and 35 in the amino acid sequence formed by cleaving off the N-terminal amino acids M1 to R10 of HMGB1 from full-length HMGB1). The antibody which specifically binds to disulfide-type HMGB1 of the present invention may also be referred to as an antibody specific to an antigenic determinant comprising a disulfide bond formed by cysteines at position 23 (C.sub.23) and position 45 (C.sub.45) of HMGB1. Furthermore, the antibody which specifically binds to disulfide-type HMGB1 of the present invention may also be referred to as an antibody specific to an antigenic determinant comprising a disulfide bond formed by cysteines at position 13 (C.sub.13) and position 35 (C.sub.35) of thrombin-cleaved HMGB1. That is, the antibody which specifically binds to disulfide-type HMGB1 of the present invention recognizes the disulfide bond of HMGB1.

(22) Furthermore, the present invention relates to low-molecular-weight antibodies (minibodies) of a HMGB1 antibody which can specifically recognize disulfide-type HMGB1. Low-molecular-weight antibodies (minibodies) of the present invention are not particularly limited as long as they include a portion of the whole antibody (antibody fragment) and have an ability to bind to the antigen. Low-molecular-weight antibodies of the present invention preferably include VH (heavy chain variable region) or VL (light chain variable region), and particularly preferably include both VH and VL. Examples of low-molecular-weight antibodies of the present invention include Fab, F(ab′)2, Fab′, scFv (single-chain Fv), diabody, sc(Fv)2 (single-chain (Fv)2, and such), and their multimers (for example, dimer, trimer, tetramer, and polymer), but are not limited thereto.

(23) An scFv can be obtained by linking the VH and VL of an antibody. In an scFv, VH and VL are linked via a linker or preferably a peptide linker. The peptide linker which links the V regions are not particularly limited. For example, any single-chain peptide consisting of approximately 3 to 25 residues can be used as the linker. A diabody is a dimer composed of two scFvs. An sc(Fv)2 is a low-molecular-weight antibody in which two VHs and two VLs are linked by linkers or such to produce a single chain. An sc(Fv)2 can be prepared, for example, by linking two scFvs with a linker.

(24) Furthermore, the present invention relates to chimeric antibodies, humanized antibodies, and human antibodies of an HMGB1 antibody which can specifically recognize disulfide-type HMGB1.

(25) Chimeric antibodies are antibodies consisting of the variable regions of the heavy and light chains of a non-human mammal antibody such as a mouse antibody, and the constant regions of the heavy and light chains of a human antibody. Chimeric antibodies can be obtained, for example, by obtaining DNAs encoding the variable regions of the heavy and light chains of a HMGB1 antibody which can specifically recognize disulfide-type HMGB1, linking these DNAs with DNAs encoding the constant regions of the heavy and light chains of a human antibody, inserting them into an expression vector, and introducing the vector into a host, and producing the variable regions and constant regions of the antibody heavy and light chains. As the constant regions, constant regions derived from humans, mice, rats, rabbits, dogs, cats, cattle, horses, pigs, goats, rhesus monkeys, cynomolgus monkeys, chimpanzees, chickens, zebrafish, or such can be used. Modifications such as amino acid substitutions, deletions, and additions may be performed on the chimeric antibodies of the present invention to improve the stability of antibody production.

(26) A humanized antibody is an antibody constructed by transferring the complementarity determining regions (CDRs) of an antibody derived from a non-human mammal such as mouse, to the complementarity determining regions of a human antibody. Humanized antibodies can be obtained, for example, by producing a DNA sequence designed to link DNAs encoding the CDRs of the heavy and light chains of a HMGB1 antibody which can specifically recognize disulfide-type HMGB1, and the human antibody framework regions (FR); inserting this into an expression vector; introducing the vector into a host; and expressing the protein encoded by the DNA. Modifications such as amino acid substitutions, deletions, and additions may be performed on the humanized antibodies of the present invention to, e.g., improve the stability of antibody production.

(27) When an amino acid residue is altered, the amino acid is desirably mutated to a different amino acid that conserves the properties of the amino acid side chain. Examples of amino acid side chain properties are as follows: hydrophobic amino acids (A, I, L, M, F, P, W, Y, and V), hydrophilic amino acids (R, D, N, C, E, Q, G, H, K, S, and T), amino acids containing aliphatic side chains (G, A, V, L, I, and P), amino acids containing hydroxyl group-containing side chains (S, T, and Y), amino acids containing sulfur atom-containing side chains (C and M), amino acids containing carboxylic acid- and amide-containing side chains (D, N, E, and Q), amino acids containing basic side chains (R, K, and H), and amino acids containing aromatic side chains (H, F, Y, and W). It is already known that a protein containing a modified amino acid sequence in which one or more (for example, 2, 3, 4, 5, 10, 20, 30, 40, 50, or 100) amino acid residues in an amino acid sequence are deleted, added, and/or substituted with other amino acids can retain the original biological activity (Mark, D. F. et al., Proc. Natl. Acad. Sci. USA (1984) 81: 5662-6; Zoller. M. J. and Smith, M., Nucleic Acids Res. (1982) 10: 6487-500; Wang, A. et al., Science (1984) 224: 1431-3; Dalbadie-McFarland, G. et al., Proc. Natl. Acad. Sci. USA (1982) 79: 6409-13). Such mutants have an amino acid identity of at least 70%, more preferably at least 75%, even more preferably at least 80%, still more preferably at least 85%, yet more preferably at least 90%, and most preferably at least 95%, with the amino acid sequence before the amino acid modification. Herein, sequence identity is defined as the proportion of residues identical to those in the original amino acid sequence of the heavy chain variable region or light chain variable region which is determined after the sequences are aligned and gaps are appropriately introduced to maximize the sequence identity as necessary.

(28) The nucleotide sequence or amino acid sequence identity can be determined using the BLAST algorithm by Karlin and Altschul (Proc. Natl. Acad. Sci. USA 87:2264-2268, 1990; and Proc Natl Acad Sci USA 90: 5873, 1993). Programs called BLASTN and BLASTX were developed based on this BLAST algorithm (Altschul S F, et al: J Mol Biol 215: 403, 1990). When analyzing nucleotide sequences using BLASTN, the parameters are set, for example, as score=100 and wordlength=12. On the other hand, parameters used when analyzing amino acid sequences by BLASTX include, for example, score=50 and wordlength=3. Default parameters for each program are used when using the BLAST and Gapped BLAST programs. Specific techniques for such analysis methods are known.

(29) Human antibodies are antibodies prepared from mice which produce human antibodies. Human antibodies can be obtained, for example, by in vitro sensitization of human lymphocytes with desired antigens or cells expressing the desired antigens, and then fusing the sensitized lymphocytes with human myeloma cells such as U266. The human antibodies can also be obtained by immunizing transgenic animals carrying a complete repertoire of human antibody genes with desired antigens.

(30) Furthermore, the present invention relates to an antibody which comprises CDR1, CDR2, and CDR3 having the same amino acid sequences as heavy chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa186, and CDR1, CDR2, and CDR3 having the same amino acid sequences as light chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa186. Antibodies of the present invention may also have FR regions and constant regions.

(31) The amino acid sequences of heavy chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 25, 27, and 29, respectively.

(32) The nucleotide sequences of heavy chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 24, 26, and 28, respectively.

(33) The amino acid sequences of heavy chain FR1, FR2, and FR3 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 35, 37, and 39, respectively.

(34) The nucleotide sequences of heavy chain FR1, FR2, and FR3 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 34, 36, and 38, respectively.

(35) The amino acid sequences of light chain CDR1 and CDR2 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 31 and 33, respectively.

(36) The nucleotide sequences of light chain CDR1 and CDR2 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 30 and 32, respectively.

(37) The amino acid sequences of light chain FR1, FR2, and FR3 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 41, 43, and 45, respectively.

(38) The nucleotide sequences of light chain FR1, FR2, and FR3 of monoclonal antibody HMa186 are shown in SEQ ID NOs: 40, 42, and 44, respectively.

(39) Such antibodies can be obtained, for example, by the following method. mRNAs encoding the heavy-chain and light-chain CDR1, CDR2, and CDR3 are isolated from hybridomas producing monoclonal antibody HMa186 by a method known to those skilled in the art. Then, the heavy-chain and light-chain CDR1, CDR2, and CDR3 are synthesized from the obtained mRNAs using reverse transcriptase. This is linked with DNAs encoding the desired antibody constant regions and DNAs encoding the FR regions, and this is incorporated into an expression vector. By expressing this expression vector in various expression cells, the antibodies can be collected by methods known to those skilled in the art.

(40) Furthermore, the present invention relates to an antibody which comprises as the heavy chain variable region, a heavy chain variable region having the same amino acid sequence as the heavy chain variable region of monoclonal antibody HMa186; and as the light chain variable region, a light chain variable region having the same amino acid sequence as the light chain variable region of monoclonal antibody HMa186. The antibodies of the present invention may also have constant regions. These antibodies may be obtained by methods such as those described above, which are well-known to those skilled in the art.

(41) The amino acid sequences of the heavy chain variable region and the light chain variable region of monoclonal antibody HMa186 are shown in SEQ ID NOs: 47 and 49, respectively.

(42) The nucleotide sequences of the heavy chain variable region and the light chain variable region of monoclonal antibody HMa186 are shown in SEQ ID NOs: 46 and 48, respectively.

(43) In monoclonal antibody HMa186 of the present invention, one or more (for example, 20 or fewer, 10, 9, 8, 7, 6, 5, 4, 3, 2 or fewer) amino acids may be substituted, deleted, added, and/or inserted.

(44) In the present invention, an example of a HMGB1 antibody that can specifically recognize disulfide-type HMGB1 is monoclonal antibody HMa186. Monoclonal antibody HMa186 is produced by a hybridoma deposited with the Patent Microorganisms Depositary (NPMD) of the National Institute of Technology and Evaluation. The matters specifying the deposit are described below.

(45) (1) Depositary institution: The National Institute of Technology and Evaluation

(46) (2) Contact information: 2-5-8, Kazusakamatari, Kisarazu-city, Chiba, 292-0818, Japan

(47) (3) Accession No.: NITE BP-02019

(48) (4) Indication for identification: HMa186

(49) (5) Date of national deposit: Mar. 5, 2015

(50) (6) Date of request for transfer to international depositary: Nov. 4, 2016

(51) Furthermore, the present invention relates to specifically measuring or detecting disulfide-type HMGB1 in a sample, which comprises the step of contacting the sample with the antibody which specifically binds to disulfide-type HMGB1 of the present invention.

(52) Furthermore, the present invention relates to a method for measuring or detecting total HMGB1 in a sample, which comprises contacting the sample with the antibodies of (a) and (b) below:

(53) (a) an antibody which specifically binds to disulfide-type HMGB1 and

(54) (b) an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to thrombin-cleaved HMGB1 (des-HMGB1).

(55) Furthermore, the present invention relates to an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to thrombin-cleaved HMGB1 (des-HMGB1).

(56) The antibody which specifically binds to disulfide-type HMGB1 of the present invention can recognize thrombin-cleaved HMGB1 (des-HMGB1) which has an amino acid sequence produced by cleaving off the N-terminal amino acids M1 to R10 of full-length HMGB1. This is because even after disulfide-type HMGB1 is cleaved by thrombin to form thrombin-cleaved HMGB1, the disulfide bond is maintained between the cysteines of positions 13 and 35 of thrombin-cleaved HMGB1 which correspond to cysteines at positions 23 and 45 of full-length HMGB1.

(57) “Total HMGB1” of the present invention includes those formed by subjecting the amino acid sequence of HMGB1 to alteration (addition, deletion, insertion, substitution, and such), chemical modification, or enzymatic treatment. More specifically, examples include, but are not limited to, disulfide-type HMGB1, reduced-type HMGB1, and thrombin-cleaved HMGB1, and those formed by subjecting them to amino acid alteration, chemical modification, enzymatic treatment, and such.

(58) Furthermore, in the present invention, reduced-type HMGB1 refers to HMGB1 in a condition where all three cysteines (C.sub.23, C.sub.45, and C.sub.106) are reduced. It is known that it involves in regulating genetic information in the cell nucleus, and has chemotaxis (chemotaxis-inducing) activity outside the cell.

(59) Thrombin-cleaved HMGB1 (des-HMGB1) refers to a cleavage product of HMGB1 having a newly generated N-terminal “GKMSS . . . ” (SEQ IS NO: 76) which is formed by cleavage between arginine at position 10 (R.sub.10) and glycine at position 11 (G.sub.11) of HMGB1 by thrombin or a thrombin/thrombomodulin complex, and separation of a peptide fragment composed of N-terminal ten amino acid residues of HMGB1. This cleavage product of HMGB1 is known to have lower biological activity than HMGB1. Thrombin-cleaved HMGB1 has a disulfide bond between the cysteines at positions 13 and 35 which correspond to cysteines at positions 23 and 45 of full-length HMGB1. In the present invention, disulfide-type HMGB1 and thrombin-cleaved HMGB1 which maintains the disulfide bond can be collectively referred to as non-reduced-type HMGB1 or disulfide bond-containing HMGB1. Furthermore, in the present invention, “antibody which specifically binds to disulfide-type HMGB1” can be referred to as “antibody which specifically binds to non-reduced-type HMGB1” or “antibody which specifically binds to HMGB1 having a disulfide bond”.

(60) In the present invention, the antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1 is, for example, an antibody which recognizes an antigenic determinant comprising the amino acid residues between glycine at position 2 (G.sub.2) and alanine at position 17 (A.sub.17) of disulfide-type HMGB1, but it is not limited thereto. Alternatively, the antibody of the present invention may be, for example, an antibody that recognizes an amino acid sequence consisting of the amino acid residues between glycine at position 2 (G.sub.2) and alanine at position 17 (A.sub.17) of disulfide-type HMGB1 as the epitope, but it is not limited thereto.

(61) Furthermore, in the present invention, an example of the antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1 is an antibody which comprises CDR1, CDR2, and CDR3 having the same amino acid sequences as heavy chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa166, and CDR1, CDR2, and CDR3 having the same amino acid sequences as light chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa166, but is not limited thereto. Such antibodies may also have FR regions and constant regions.

(62) The amino acid sequences of heavy chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa166 are shown in SEQ ID NOs: 51, 53, and 55, respectively.

(63) The nucleotide sequences of heavy chain CDR1, CDR2, and CDR3 of monoclonal antibody HMa166 are shown in SEQ ID NOs: 50, 52, and 54, respectively.

(64) The amino acid sequences of heavy chain FR1, FR2, and FR3 of monoclonal antibody HMa166 are shown in SEQ ID NOs: 57, 59, and 61, respectively.

(65) The nucleotide sequences of heavy chain FR1, FR2, and FR3 of monoclonal antibody HMa166 are shown in SEQ ID NOs: 56, 58, and 60, respectively.

(66) Furthermore, in the present invention, the antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1 relates to an antibody which has as the heavy chain variable region, a variable region having the same amino acid sequence as the heavy chain variable region of monoclonal antibody HMa166; and as the light chain variable region, a light chain variable region having the same amino acid sequence as the light chain variable region of monoclonal antibody HMa166. Such antibodies may also have constant regions.

(67) The amino acid sequence of the heavy chain variable region of monoclonal antibody HMa166 is shown in SEQ ID NO: 63.

(68) The nucleotide sequence of the heavy chain variable region of monoclonal antibody HMa166 is shown in SEQ ID NO: 62.

(69) These antibodies can be obtained by methods well-known to those skilled in the art, such as those described above.

(70) In monoclonal antibody HMa166 of the present invention, one or more (for example, 20 or fewer, 10, 9, 8, 7, 6, 5, 4, 3, 2 or fewer) amino acids are substituted, deleted, added, and/or inserted.

(71) In the present invention, an example of an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1 is monoclonal antibody HMa166. Monoclonal antibody HMa166 is produced by a hybridoma deposited with the Patent Microorganisms Depositary of the National Institute of Technology and Evaluation. The matters specifying the deposit are described below.

(72) (1) Depositary institution: The National Institute of Technology and Evaluation

(73) (2) Contact information: 2-5-8, Kazusakamatari, Kisarazu-city, Chiba, 292-0818, Japan

(74) (3) Accession No.: NITE BP-02020

(75) (4) Indication for identification: HMa166

(76) (5) Date of national deposit: Mar. 5, 2015

(77) (6) Date of request for transfer to international depositary: Nov. 4, 2016

(78) Furthermore, the present invention relates to a kit or reagent for use in a method mentioned above. The kit or reagent of the present invention relates to a kit or reagent for specifically measuring or detecting disulfide-type HMGB1 contained in a sample, where the kit or reagent contains at least the antibodies that specifically bind to disulfide-type HMGB1 of (a) and (b) below. Furthermore, the kit or reagent of the present invention relates to a kit or reagent for measuring or detecting total HMGB1 in a sample, which comprises at least the antibodies of (a) and (b) below:

(79) (a) an antibody which specifically binds to disulfide-type HMGB1; and

(80) (b) an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to thrombin-cleaved HMGB1 (des-HMGB1).

(81) In the present invention, the types, origins, and such of the HMGB1 antibodies (for example, antibodies that specifically bind to disulfide-type HMGB1, and antibodies that bind to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1) are not limited. Examples include antibodies obtained from various immunized animals such as mice, rabbits, and goats. Furthermore, polyclonal antibodies, antiserum containing polyclonal antibodies, monoclonal antibodies, or antibody fragments thereof (for example, Fab, F(ab′)2, and Fab′), low-molecular-weight antibodies (minibodies) (for example, single-chain Fv (scFv), diabody, and single-chain (Fv)2 (sc(Fv)2)), and their multimers (for example, dimers, trimers, tetramers, and polymers) may also be used.

(82) For example, polyclonal antibodies can be prepared by immunizing an animal such as rabbit with purified HMGB1 (disulfide-type HMGB1, reduced-type HMGB1, or such) or a partial peptide thereof, collecting the blood after a certain period of time, and then removing blood clots. On the other hand, monoclonal antibodies can be prepared by fusing bone tumor cells with antibody producing cells from an animal immunized with HMGB1 or a partial peptide thereof, isolating cells from a single clone that produces the antibody of interest (hybridoma), and obtaining antibodies from the cells.

(83) The origin of HMGB1 is not limited in the present invention. In the present invention, without limitation, HMGB1 derived from humans, mice, rats, rabbits, dogs, cats, cattle, horses, pigs, goats, rhesus monkeys, cynomolgus monkeys, chimpanzees, chickens, zebrafish, or such can be measured or detected.

(84) The NCBI (National Center for Biotechnology Information, U.S. National Library of Medicine) database accession numbers and the SEQ ID NOs used herein are shown below for the amino acid sequences of HMGB1 derived from various animals:

(85) TABLE-US-00001 human [Homo sapiens] CAG33144.1/SEQ ID NO: 9 mouse [Mus musculus] AAI10668.1/SEQ ID NO: 10 rat [Rattus norvegicus] NP_037095.1/SEQ ID NO: 11 rabbit [Oryctolagus cuniculus] NP_001164752.1/SEQ ID NO: 12 dog [Canis lupus familiaris] AAN11319.1/SEQ ID NO: 13 cat [Felis catus] XP_006927254.1/SEQ ID NO: 14 cattle [Bos taurus] AAI02930.1/SEQ ID NO: 15 horse [Equus caballus] BAF33339.1/SEQ ID NO: 16 pig [Sus scrofa] NP_001004034.1/SEQ ID NO: 17 goat [Capra hircus] XP_005687595.1/SEQ ID NO: 18 rhesus monkey [Macaca mulatta] AFJ72047.1/SEQ ID NO: 19 cynomolgus monkey [Macaca fascicularis] NP_001270285.1/ SEQ ID NO: 20 chimpanzee [Pan troglodytes] XP_509611.1/SEQ ID NO: 21 chicken [Gallus gallus] NP_990233.1/SEQ ID NO: 22 zebrafish [Danio rerio] AAH67193.1/SEQ ID NO: 23

(86) In the present invention, samples refer to solutions which contain or are suspected to contain HMGB1 (e.g., disulfide-type HMGB1, reduced-type HMGB1, and thrombin-cleaved HMGB1). Examples include isolated biological samples such as blood, serum, plasma, urine, semen, spinal fluid, saliva, sweat, tear, ascites, and amniotic fluid derived from humans or other animals, for example, mice, rats, rabbits, dogs, cats, bovines, horses, pigs, goats, sheep, monkeys (for example, rhesus monkeys and cynomolgus monkeys), chimpanzees, chickens, and zebrafish; and diluted solutions containing them, but are not limited thereto. Furthermore, solutions obtained by mixing solutions which contain or are suspected to contain HMGB1 with buffers and such are also included in the samples of the present invention. Methods of obtaining such samples are well known to those skilled in the art. Various aqueous solvents can be used as the solvents for mixing or dilution. Examples include purified water, physiological saline solution, or various buffers such as Tris buffer, phosphate buffer, or phosphate buffered saline solution, but are not limited thereto. Furthermore, pH of the buffers is not particularly limited, and suitable pH can be appropriately selected. Generally, pH in the range of pH 3 to 12 can be selected and used, but is not limited thereto. Furthermore, for structural protection of substances to be measured, the solvents may appropriately contain one, two or more kinds of proteins such as bovine serum albumin (BSA), human serum albumin (HSA), and casein; various saccharides; powdered skimmed milk; various animal sera such as normal rabbit serum; various antiseptics such as sodium azide and antibiotics; and various surfactants such as nonionic surfactants, amphoteric surfactants, and anionic surfactants.

(87) The means for contacting a sample with a HMGB1 antibody (an antibody which specifically binds to disulfide-type HMGB1, an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1, or such) is not particularly limited. More specifically, a HMGB1 antibody can be added to a container in which a sample is contained. Alternatively, a sample can be added to a container in which a HMGB1 antibody is contained.

(88) In the present invention, known techniques can be used for measuring or detecting HMGB1 (for example, disulfide-type HMGB1, and total HMGB1). Examples include immunological testing methods such as enzyme-linked immunosorbent assay (ELISA, EIA), fluoroimmunoassay (FIA), Western blotting, dot blotting, immunoprecipitation methods, radioimmunoassay (RIA), luminescent immunoassay (LIA), immunoenzyme technique, fluorescent antibody technique, immunochromatography method, immunonephelometry, latex turbidimetry, and latex agglutination assay, but are not limited thereto. Furthermore, measurement or detection in the present invention may be performed manually or by using an apparatus such as an analyzer.

(89) For example, when using enzyme immunoassay, it can be performed using a microplate on which a first HMGB1 antibody (an antibody which specifically binds to disulfide-type HMGB1, an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1, or such) is immobilized, a second HMGB1 antibody modified with an enzyme such as HRP, a washing buffer, a luminescentichromogenic substrate solution, a standard substance (human recombinant HMGB1), a positive control (human recombinant HMGB1), a sample diluent, a reaction-stopping solution, and such. Furthermore, HMGB1 can be measured or detected by reacting an enzyme used to modify the second HMGB1 antibody with a substrate of this enzyme under optimal conditions, and measuring the amount of the enzyme reaction products by optical methods. The second HMGB1 antibody (detection antibody) is preferably an antibody that recognizes an epitope that is different from the epitope recognized by the first HMGB1 antibody (immobilized antibody).

(90) Alternatively, when using fluoroimmunoassay, measurement or detection can be performed using an optical waveguide or a microplate onto which a first HMGB1 antibody is immobilized, a second HMGB1 antibody modified with a fluorescent substance, and washing buffers. Measurement or detection of HMGB1 can be carried out by applying excitation light to the fluorescent substance used to modify the second HMGB1 antibody, and measuring the intensity of the fluorescence emitted by the fluorescent substance. Furthermore, when using radioimmunoassay, HMGB1 can be measured or detected by measuring radiation quantity from a radioactive substance by operations similar to those of the method described above, and when using luminescent immunoassay, HMGB1 can be measured or detected by measuring the amount of luminescence from luminescent reaction systems.

(91) When using western blotting or dot blotting methods, after electrophoresis, transfer membranes or membranes to which samples are directly applied are subjected to blocking with BSA or skimmed milk, and then measurement or detection can be performed using an HMGB1 antibody modified with an enzyme such as HRP, washing buffers, and luminescentichromogenic substrate solutions, etc. A secondary antibody directly labeled with an enzyme, a fluorescent dye, or such may be reacted with a first HMGB1 antibody.

(92) HMGB1 can be measured or detected by reacting the above-mentioned substrate with an enzyme used to modify the HMGB1 antibody or the secondary antibody under appropriate conditions, and measuring the amount of products of the enzymatic reaction by optical methods.

(93) When using immunoprecipitation, blocking agents such as BSA or skimmed milk can be added during reaction of samples with the HMGB1 antibodies and the like. Precipitation is carried out using magnetic beads, agarose substrates, or such directly bound to HMGB1 antibodies, or by using secondary antibodies bound to those beads and such.

(94) Furthermore, when using immunoturbidimetry, a latex turbidimetry, a latex agglutination assay, or the like, HMGB1 can be measured or detected by measuring the transmitted light and the scattered light by an endpoint method or rate method. Also, when immunochromatography is used, the color of labeled substances appearing on the test line can be visually identified. Moreover, instruments such as an analyzer can be used instead of the visual identification.

(95) As the solid-phase carriers to be used in the above immunological assays, solid-phase carriers in the form of beads, microplates, test tubes, sticks, membranes, specimen pieces, or the like made of materials such as polystyrene, polycarbonate, polyvinyl toluene, polypropylene, polyethylene, polyvinyl chloride, nylon, polymethacrylate, polyacrylamide, latex, a liposome, gelatin, agarose, cellulose, sepharose, glass, metal, ceramic, or magnetic material can be used, but are not limited thereto.

(96) As methods for immobilization of HMGB1 antibodies mentioned above on a solid phase, known immobilization methods may be used. For example, methods for physical adsorption include methods of mixing antibodies and carriers in solutions such as buffers to contact them, or methods of contacting carriers with antibodies dissolved in buffers or such, but are not limited thereto.

(97) Furthermore, when immobilizing HMGB1 antibodies by chemical bonding methods, preparations can also be performed according to known methods. Examples of such methods include a method in which the antibodies and carriers are mixed with divalent cross-linking reagents such as glutaraldehyde, carbodiimide, imide ester, or maleimide and contacted with each other to react amino groups, carboxyl groups, thiol groups, aldehyde groups, hydroxyl groups, or the like of both the antibodies and the carriers, but are not limited thereto.

(98) Furthermore, if it is necessary to perform treatments for suppressing non-specific reactions, spontaneous aggregation of the carriers onto which the HMGB1 antibodies are immobilized, and the like, such treatments can be performed according to known methods. Examples of such methods include a method in which the antibody-immobilized surface or inner wall of the carriers is contacted with proteins such as bovine serum albumin (BSA), casein, gelatin, ovalbumin. or salts thereof, surfactants, powdered skimmed milk, or the like to coat the surface or the inner wall of the carriers, but are not limited thereto.

(99) Known modification methods can be used as the method for modifying the above-mentioned second HMGB1 antibody with labeling substances. Examples of physical adsorption methods include, but are not limited to, a method in which the second HMGB1 antibody and labeling substances are mixed and contacted with each other in solutions such as buffers and a method in which the antibody dissolved in buffers and the like is contacted with labeling substances. For example, when the labeling substance is gold colloid or latex, physical adsorption methods are effective. Antibodies labeled with gold colloid can be obtained by mixing the antibodies and gold colloid in buffers to contact them with each other.

(100) Furthermore, when modifying the second HMGB1 antibody with labeling substances by chemical bonding methods, the preparation can be carried out according to known methods. Examples of such methods include, but are not limited to, a method in which the antibody and labeling substances are mixed with divalent cross-linking reagents such as glutaraldehyde, carbodiimide, imide ester, or maleimide and contacted with each other to react amino groups, carboxyl groups, thiol groups, aldehyde groups, hydroxyl groups, or the like of both the antibody and the labeling substances. For example, when the labeling substance is a fluorescent substance, an enzyme, or a chemiluminescent substance, a chemical bonding method is effective.

(101) Furthermore, if it is necessary to perform treatments for suppressing non-specific reactions, spontaneous aggregation of the antibody modified with labeling substances, and the like, such treatments can be performed according to known methods. Examples of such methods include, but are not limited to, a method in which the antibodies conjugated with labeling substances are contacted with proteins such as bovine serum albumin (BSA), casein, gelatin, ovalbumin, or salts thereof, surfactants, powdered skimmed milk, or the like to coat the antibodies.

(102) For labeling substances, when an enzyme immunoassay is carried out, without being limited to the following, peroxidase (POD), alkaline phosphatase (ALP), β-galactosidase, urease, catalase, glucose oxidase, lactate dehydrogenase, amylase, or the like can be used.

(103) When a fluorescent immunoassay is carried out, without being limited to the following, fluorescein isothiocyanate, tetramethylrhodamine isothiocyanate, substituted rhodamine isothiocyanate, dichlorotriazine isothiocyanate, cyanine, merocyanine, or the like can be used.

(104) When a radioimmunoassay is carried out, without being limited to the following, tritium, iodine-125, iodine-131, or the like can be used.

(105) When a luminescence immunoassay is carried out, without being limited to the following, luminol compounds, luciferase compounds, acridinium esters, dioxetane compounds, or the like can be used.

(106) When immunochromatography, immunoturbidimetry, latex turbidimetry, and latex agglutination assay are carried out, without being limited to the following, particles can be used, which are made of materials such as polystyrene, styrene-styrene sulfonate copolymer, acrylonitrile-butadiene-styrene copolymer, vinyl chloride-acrylic acid ester copolymer, vinyl acetate-acrylic acid copolymer, polyacrolein, styrene-methacrylic acid copolymer, styrene-glycidyl (meth)acrylic acid copolymer, styrene-butadiene acid copolymer, methacrylic acid polymer, acrylic acid polymer, latex, gelatin, liposome, microcapsule, silica, alumina, carbon black, metal compound, metal, metal colloid, ceramic, or magnetic material.

(107) The kits or reagents of the present invention are characterized in that they are used by contacting the HMGB1 antibody with a sample. The kits or reagents of the present invention are not particularly limited so long as they are constituted so that HMGB1 in a sample (for example, disulfide-type HMGB1, reduced-type HMGB1, or thrombin-cleaved HMGB1) binds to a HMGB1 antibody (for example, an antibody which specifically binds to disulfide-type HMGB1, or an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1).

(108) For the constitution of the kits of the present invention, substances may be combined with other reagents or they can be adhered to solid phases in advance. For example, when combined in advance with other reagents, the reagents to be combined include buffers necessary for binding between HMGB1 in the samples and the HMGB1 antibodies, sample dilution solutions, solutions of HMGB1 antibodies containing labeling substances such as an enzyme, reagents containing substances that generate a signal such as color development, reagents containing substances involved in generation of a signal such as color development, reagents containing substances for calibration, and reagents containing substances used for accuracy control. Examples of the solid phase include carriers and test papers to be used in the immunological testing kits, microplates, glass plates, microtubes, filter papers, and polymer resins.

(109) The kits or reagents of the present invention include materials that are necessary for measuring or detecting HMGB1. Kits or reagents of the present invention also include a kit or reagent including various sets necessary for measuring or detecting HMGB1, a disposable kit or reagent which contains various substances necessary for measuring or detecting HMGB1, a microplate-type testing kit or reagent for simultaneously measuring multiple samples, and test paper or immunochromatography that contains reagents and such and allows determination of results by visual observation.

(110) As an example of the form of a disposable kit or reagent, one can consider a constitution where a spherical or rod-shaped carrier on which the first HMGB1 antibody is immobilized, a reagent dilution solution, a second HMGB1 antibody modified with an enzyme such as ALP, a washing solution, a luminescent substrate solution, a standard substance (human recombinant HMGB1), a positive control (human recombinant HMGB1), a sample dilution solution, a reaction-stopping solution, and such are contained in a testing container, but it is not limited thereto.

(111) The form of the testing containers is not particularly limited as long as HMGB1 in the samples can be measured or detected. Examples include, but are not limited to, boat-shaped containers in which multiple reaction chambers and reagent storage chambers are aligned, and flow-channel-type containers in which grooves are provided on a sheet-type substrate and reaction chambers and storage chambers are connected by flow channels. Furthermore, while the size of the testing container is not particularly limited, but for use by incorporation into an automated analyzer and such, a small size such as approximately 10 cm×10 cm or smaller is desired. Furthermore, to avoid intrusion of foreign matter into the reaction chambers and evaporation/deterioration of reagents packed in the reagent storage chambers, the upper portion of each chamber may be sealed. Examples include a method of adhesion of aluminum foil, polymeric film, or such to the upper portion of the reaction chambers and storage chambers of the testing container. In particular, sealing with aluminum foil is preferred since it can be easily opened using the tip of a dispenser chip or the punching structure of an analyzer. The material for the testing container is not particularly limited as long as it does not inhibit the reaction for measuring the substances to be measured. Examples include, but are not limited to, polystyrene resins, polyethylene resins, and polypropylene resins.

(112) Furthermore, the following constitution can be considered as a form of the microplate-type kit or reagent. For example, a sample dilution solution, a second HMGB1 antibody modified with an enzyme such as HRP, a washing solution, a chromogenic substrate solution, a standard substance (human recombinant HMGB1), a positive control (human recombinant HMGB1), a sample dilution solution, a reaction-stopping solution, and such are respectively provided in reagent bottles and they are included with a microplate to which the first HMGB1 antibody is immobilized.

(113) A suitable form of immunochromatography is lateral flow composed of a housing case, sample pad, conjugation pad, membrane filter, and absorption pad. Lateral flow is prepared by the following procedure. First, a first HMGB1 antibody labeled with gold colloid or colored beads is prepared, and this is applied to the conjugation pad, and this is dried. On the other hand, a second HMGB1 antibody is applied on the test line of the membrane filter, and this is dried. Next, a third antibody that specifically recognizes the second HMGB1 antibody is applied on the control line of the membrane filter, and this is dried. Finally, the above-mentioned conjugation pad, sample pad, and absorption pad are attached to this filter to provide the lateral flow.

(114) In the present invention, the forms of the reagents are not particularly limited and may be solutions containing the HMGB1 antibody. Alternatively, they may have volumes and forms in accordance with the test of interest; for example, they are tablets or powders, or in dry forms adhered to containers.

(115) The kits or reagents of the present invention may be kits or reagents for sandwich ELISA which comprise a labeled antibody for detection and the antibody which specifically binds to disulfide-type HMGB1 of the present invention. In particular, when measuring or detecting total HMGB1 including disulfide-type HMGB1, reduced-type HMGB1, and thrombin-cleaved HMGB1, in one embodiment, this can be performed by sandwich ELISA which uses monoclonal antibodies HMa166 and HMa186 as the solid-phase antibodies, and monoclonal antibody CP11-1 as the detection antibody. Monoclonal antibody CP11-1 is produced by a hybridoma deposited with the Patent Microorganisms Depositary (NPMD) of the National Institute of Technology and Evaluation. The matters specifying the deposit are described below.

(116) (1) Depositary institution: The National Institute of Technology and Evaluation

(117) (2) Contact information: 2-5-8, Kazusakamatari, Kisarazu-city, Chiba, 292-0818, Japan

(118) (3) Accession No.: NITE BP-02021

(119) (4) Indication for identification: CP11-1

(120) (5) Date of national deposit: Mar. 5, 2015

(121) (6) Date of request for transfer to international depositary: Nov. 4, 2016

(122) Furthermore, the present invention relates to methods for diagnosing sepsis or sepsis-related diseases such as systemic inflammation, which comprise the step of measuring or detecting HMGB1 (disulfide-type HMGB1 or total HMGB1) in a sample using the measurement or detection method of the present invention.

(123) Furthermore, the present invention relates to kits or reagents for diagnosing sepsis or sepsis-related diseases such as systemic inflammation, which comprise a disulfide-type HMGB1-specific antibody or an antibody that binds to both disulfide-type HMGB1 and reduced-type HMGB1 but does not bind to des-HMGB1.

(124) In the diagnosis methods, and kits or reagents for diagnosis of the present invention, for example, when disulfide-type HMGB1 is detected, a subject is determined to be suffering from sepsis or a sepsis-related disease. The present invention may comprise a step of administering a known therapeutic agent for sepsis or a sepsis-related disease to or performing a known therapeutic method on a subject in which HMGB1 was detected.

(125) While further future research is necessary regarding the correlation between blood HMGB1 concentration and the severity of sepsis and sepsis-related diseases, it is known that blood concentration of HMGB1 is high in sepsis patients (Wang, SCIENCE, 285, 248-251, 1999). Furthermore, it has been reported that blood HMGB1 concentration and diagnostic criteria for sepsis such as SOFA score, lactate level, and procalcitonin level are highly correlated (Gibot, Intensive Care Medicine, 33, 1347-1353, 2007). Furthermore, it has been reported that after onset of sepsis, the blood concentration of disulfide-type HMGB1 decreased with passage of time in patients who did not die, but the blood concentration of disulfide-type HMGB1 increased with passage of time in patients with poor prognosis or died after onset of the disease (Gibot, Intensive Care Medicine, 33, 1347-1353, 2007). Furthermore, there is a report of treated cases where blood purifying treatment was performed on sepsis patients, and elevated HMGB1 concentrations recovered to normal levels, and finally discharge from the hospital was achieved (Nakamura, Blood Purification, 32, 139-142, 2011). Thus, blood HMGB1 concentration can serve as important information for initiation of and withdrawal from various treatments.

(126) The relationship between the sequences of monoclonal antibodies HMa186 and HMa166 and the SEQ ID NOs shown in the Sequence Listing is summarized below.

(127) Monoclonal antibody HMa186:

(128) Heavy chain CDR1 nucleotide sequence: SEQ ID NO: 24

(129) Heavy chain CDR1 amino acid sequence: SEQ ID NO: 25

(130) Heavy chain CDR2 nucleotide sequence: SEQ ID NO: 26

(131) Heavy chain CDR2 amino acid sequence: SEQ ID NO: 27

(132) Heavy chain CDR3 nucleotide sequence: SEQ ID NO: 28

(133) Heavy chain CDR3 amino acid sequence: SEQ ID NO: 29

(134) Light chain CDR1 nucleotide sequence: SEQ ID NO: 30

(135) Light chain CDR1 amino acid sequence: SEQ ID NO: 31

(136) Light chain CDR2 nucleotide sequence: SEQ ID NO: 32

(137) Light chain CDR2 amino acid sequence: SEQ ID NO: 33

(138) Heavy chain FR1 nucleotide sequence: SEQ ID NO: 34

(139) Heavy chain FR1 amino acid sequence: SEQ ID NO: 35

(140) Heavy chain FR2 nucleotide sequence: SEQ ID NO: 36

(141) Heavy chain FR2 amino acid sequence: SEQ ID NO: 37

(142) Heavy chain FR3 nucleotide sequence: SEQ ID NO: 38

(143) Heavy chain FR3 amino acid sequence: SEQ ID NO: 39

(144) Light chain FR1 nucleotide sequence: SEQ ID NO: 40

(145) Light chain FR1 amino acid sequence: SEQ ID NO: 41

(146) Light chain FR2 nucleotide sequence: SEQ ID NO: 42

(147) Light chain FR2 amino acid sequence: SEQ ID NO: 43

(148) Light chain FR3 nucleotide sequence: SEQ ID NO: 44

(149) Light chain FR3 amino acid sequence: SEQ ID NO: 45

(150) Heavy chain variable region nucleotide sequence: SEQ ID NO: 46

(151) Heavy chain variable region amino acid sequence: SEQ ID NO: 47

(152) Light chain variable region nucleotide sequence: SEQ ID NO: 48

(153) Light chain variable region amino acid sequence: SEQ ID NO: 49

(154) Monoclonal antibody HMa166:

(155) Heavy chain CDR1 nucleotide sequence: SEQ ID NO: 50

(156) Heavy chain CDR1 amino acid sequence: SEQ ID NO: 51

(157) Heavy chain CDR2 nucleotide sequence: SEQ ID NO: 52

(158) Heavy chain CDR2 amino acid sequence: SEQ ID NO: 53

(159) Heavy chain CDR3 nucleotide sequence: SEQ ID NO: 54

(160) Heavy chain CDR3 amino acid sequence: SEQ ID NO: 55

(161) Heavy chain FR1 nucleotide sequence: SEQ ID NO: 56

(162) Heavy chain FR1 amino acid sequence: SEQ ID NO: 57

(163) Heavy chain FR2 nucleotide sequence: SEQ ID NO: 58

(164) Heavy chain FR2 amino acid sequence: SEQ ID NO: 59

(165) Heavy chain FR3 nucleotide sequence: SEQ ID NO: 60

(166) Heavy chain FR3 amino acid sequence: SEQ ID NO: 61

(167) Heavy chain variable region nucleotide sequence: SEQ ID NO: 62

(168) Heavy chain variable region amino acid sequence: SEQ ID NO: 63

(169) All prior art references cited herein are incorporated by reference into this description.

EXAMPLES

(170) Herein below, the present invention will be specifically described with reference to the Examples, but it is not to be construed as being limited thereto.

(171) 1. Preparation of Escherichia coli (E. coli) Recombinant Human HMGB1

(172) The method for preparing recombinant human HMGB1 using E. coli is indicated below.

(173) A gene having an upstream restriction enzyme site NdeI and a downstream restriction enzyme site BamHI for cloning added to the human HMBG1 gene sequence registered in GenBank (GenBank: CR456863.1/SEQ ID NO: 7) was prepared by chemical synthesis. The synthesized human HMGB1 gene was ligated to the pET15b plasmid vector which can add a histidine tag at the N-terminus, and after sequence confirmation, this was used to transform E. coli BL21 (DE3). The HMGB1-NT gene which encodes human HMGB1 from its N terminus to lysine at position 82 (M1-K82) was prepared similarly.

(174) E. coli BL21(DE3) (HMGB1/pET15b) (i.e., E. coli BL21(DE3) into which the obtained human HMGB1 gene was transferred) and E. coli BL21(DE3) (HMGB1-NT/pET15b) were individually cultured in approximately 2 L of E. coli culture medium such as Circle Grow (Funakoshi) or 2× YT (DIFCO). When the turbidity (OD.sub.600 nm) reached around 0.5, 0.5 mM IPTG was added for induction at 30° C. for three hours to express the recombinant human HMGB1 proteins.

(175) E. coli BL21(DE3) (HMGB1/pET15b) and E. coli BL21(DE3)(HMGB1-NT/pET15b) cells with the expression were collected by centrifugation, and they were rapidly frozen at −80° C., and then the cells were suspended by adding 20 mM Tris-HCl (pH7.5), 0.5 M NaCl. and 1% Triton X-100. The suspension was placed on ice, and the bacterial cells were disrupted using a sonicator.

(176) Thereafter, centrifugation was performed, and supernatants of the disrupted cells were sterilized by filtration through 0.22-μm filters for filter sterilization.

(177) To the filtered disrupted cell supernatant, 50 mM imidazole was added, and this was applied to 5-mL HisTrap HP column (GE Healthcare) for purification using the histidine tag. After washing, elution was conducted stepwise using 75 mM, 100 mM, and 500 mM imidazole. The fractions found to have the proteins of interest were subjected to buffer exchange with 10 mM sodium phosphate buffer (pH7.0), then this was applied to histidine tag HiTrap Heparin HP 1-mL column (GE Healthcare) and eluted using linear gradient of NaCl from 50 mM to 1100 mM.

(178) The fractions found to have the proteins of interest were subjected to five-fold dilution using 10 mM Hepes, and this was applied to Hitrap CMFF column (GE Healthcare), and then eluted using linear gradient of NaCl from 0 mM to 180 mM. The fractions found to have the proteins of interest were concentrated using ultrafiltration membranes, and this was subjected to buffer exchange using 50 mM Hepes (pH8.0) in 500 mM NaCl, and then purified.

(179) 2. Preparation of Monoclonal Antibodies

(180) (1) Method of Producing Monoclonal Antibody CP11-1

(181) A hapten-carrier protein complex was prepared by adding a cysteine (C) to the C terminus of the peptide No. 5 of positions 167 to 180 (KPDAAKKGVVKAEK/SEQ ID NO: 6) in the amino acid sequence of human HMGB1, which was used as a hapten, and linking it via the SH group of the cysteine to keyhole limpet hemocyanin (KLH) which is a carrier. Initial immunization of mice (Balb/c) was carried out using 100 μg of the prepared hapten-carrier protein complex antigen together with Freund's complete adjuvant (FCA), and 14 days later, as a booster, the mice were immunized with 50 μg of the hapten-carrier protein complex, which was used for the initial immunization, together with Freund's incomplete adjuvant (FIA). Thereafter, with 14-day intervals, immunization was carried out four times in total using 50 μg of the hapten-carrier protein complex with FIA. After the final immunization, the spleen was removed, and lymphocytes were prepared according to a standard method and fused with myeloma Sp2/0-Ag14 (ATCC: CRL-1581). The hybridomas resulting from the fusion were cultured and cloned using a ClonaCell-HY Hybridoma Cloning Kit (STEM CELL TECHNOLOGIES). The obtained clones were examined in further detail using Biacore (GE Healthcare), and CP11-1 was selected.

(182) Monoclonal antibody CP11-1 is produced by a hybridoma that has been deposited as the accession number “NITE BP-02021” with the Patent Microorganisms Depositary (NPMD) of the National Institute of Technology and Evaluation.

(183) (2) Method for Producing Monoclonal Antibodies HMa166 and HMa186

(184) 100 μg of rhHMGB1 antigen together with Freund's complete adjuvant (FCA) were used for the initial immunization of mice (Balb/c). Fourteen days later, as a booster, 50 μg of the rhHMGB1 antigen was used with Freund's incomplete adjuvant (FIA) for immunization. Thereafter, with 14-day intervals, immunization was carried out four times in total using 50 μg of rhHMGB1 antigen with FIA. After the final immunization, the spleen was removed, and lymphocytes were prepared according to a standard method, and they were fused with myeloma Sp2/0-Ag14 (ATCC: CRL-1581). The fused hybridomas were cultured and cloned by a limiting dilution method according to a standard method, and this was subjected to screening by ELISA, and 18 clones were obtained. A total of 19 clones including the obtained 18 clones and CP11-1 were individually immobilized onto the sensor chip of Biacore (GE Healthcare) via an anti-mouse IgG antibody, and after binding of rHMGB1, the respective antibodies were added, and the affinity to rHMGB1 was examined in detail, and combinations of antibodies against different epitopes were selected. As a result, HMa166 and HMa186, regardless of which is immobilized, showed strong reaction with rHMGB1, and do not interfere with each other when each of them binds to HMGB1. Thus, it was considered that HMa166 and HMa186 recognize different epitopes (Table 1).

(185) TABLE-US-00002 TABLE 1 Epitope Mapping of HMGB1 Monoclonal Antibodies Primary Secondary Antibody Antibody 1-2 2 11-2 33 34-2 74 87 91 94 115 135 145 166 168 176 186 231 235 GP11-1  1-2 + − − − + + + + − + − + + + + − + + 2 − − − − − − + − − + − − − − − − − + 11-2 − − − − + + + − − + − + + + + − − + 33 + + + + + + − + − + − + + + + − + − 34-2 − + − − − + + + − + − + + + + − + + 74 − − + − − − + − − +++ − − − +++ +++ − − + 87 + − + − + − + − − + − − − +++ +++ − − − 91 + + + − + +++ + + − − − + + − − − + − 94 + − − − + − − + − + − − − + + − − + 115 + + + − + + − + + + − + + + + − + − 135 + + + − + +++ + − + + − + + + + − + + 145 + − + − + + − − − − − − − + + − − − 166 + − + − + − − + − − + − − +++ +++ − − + 168 + − + − + − − + − − + − − +++ +++ − − + 176 + + + + + +++ +++ − +++ +++ − + +++ +++ − + +++ +++ 186 + +++ + − + +++ +++ + + +++ + − +++ +++ + + +++ +++ 231 + + + − + +++ + + + − + − + + + + + + 235 + − − − + + − +++ − − +++ − + + +++ +++ − + CP11-1   +++ +++ +++ − +++ +++ +++ +++ +++ − +++ − +++ +++ +++ +++ + +++ +++ Clear binding of secondary antibody (different epitopes)/Same reactivity even when the primary and secondary antibodies are interchanged. The optimum pair is selected from these antibody pairs. +++ Clear binding of secondary antibody (different epitopes)/Different reactivity when the primary and secondary antibodies are interchanged. + Weaker binding of secondary antibody (the recognition sites overlap or are regions nearby). − No observed binding of secondary antibody (same epitope).

(186) Monoclonal antibodies HMa166 and HMa186 are produced by hybridomas deposited as accession numbers “NITE BP-02020” and “NITE-BP-02019”, respectively, with the Patent Microorganisms Depositary (NPMD) of the National Institute of Technology and Evaluation.

(187) (3) Screening Method for Monoclonal Antibody Production

(188) For screening, the culture supernatant of each clone was added to an ELISA plate prepared by immobilizing 50 μL of rhHMHB1 (2 μg/mL) by a standard method and then blocking it using ImmunoBlock (DS Pharma Biomedical) diluted five-fold with purified water, and this was incubated for two hours and then washed. Subsequently, HRP-labeled anti-mouse IgG was added thereto as a secondary antibody, and this was incubated for two hours and then washed. Coloring substrate TMBZ (KPL) was added according to a standard method, and the reaction was stopped using phosphoric acid, and the absorbance at 450 nm was measured using a microplate reader.

(189) 3. Epitope Analysis of Monoclonal Antibodies HMa166 and HMa186

(190) Epitopes of monoclonal antibodies HMa166 and HMa186 were examined by analyzing the binding of various peptides of HMGB1 with the antibodies using Biacore. As a control, a similar examination was performed using monoclonal antibody CP11-1 obtained by immunization with Peptide No. 5 (KPDAAKKGVVKAEK/SEQ ID NO: 6).

(191) As a result, Peptide No. 1 (G.sub.2-A.sub.17) (GKGDPKKPRGKMSSYA/SEQ ID NO: 1) bound to HMa166, and the stability of the antigen/antibody complex which indicates the amount of binding after washing was also observed. Peptide No. 3 (K.sub.65-Y.sub.78) (KADKARYEREMKTY/SEQ ID NO: 3) also bound to HMa166; however, since the stability of the complex was low, it was thought that this would be non-specific absorption (FIG. 2A).

(192) Furthermore, HMa186 did not show affinity to any of Peptide Nos. 1.2, 3, 4, and 5 (FIG. 2B).

(193) CP11-1 showed affinity and stability of the antigen/antibody complex only with Peptide No. 5 (KPDAAKKGVVKAEK/SEQ ID NO: 6) used for immunization (FIG. 2C).

(194) Furthermore, monoclonal antibodies HMa166 and HMa186 were examined by analyzing their affinity to HMGB1-NT using Biacore. Recombinant human HMGB1 was used as a control.

(195) As a result, HMGB1-NT (M.sub.1-K.sub.82) (MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHP-DASVNFSEFSKKCSERWKTMSAKE KGKFEDMAKADKARYEREMKTYIPPK/SEQ ID NO: 4) showed affinity to both monoclonal antibodies HMa166 and HMa186 (FIG. 3A, B).

(196) Furthermore, the reactivity of HMGB1-NT (M.sub.1-K.sub.82) (MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHP-DASVNFSEFSKKCSERWKTMSAKE KGKFEDMAKADKARYEREMKTYIPPK/SEQ ID NO: 4) and recombinant human HMGB1 to each of the monoclonal antibodies was confirmed by dot blotting.

(197) 100 ng of each protein was spotted onto a PVDF membrane, and 20% ImmunoBlock (DS Pharma) was used for blocking at room temperature for two hours, and this was washed with TBSt. Then, each antibody was added at 1 μg/mL to 10% ImmunoBlock-containing PBS, and incubation was performed at room temperature for two hours. After washing, HRP-labeled anti-mouse IgG (GE Healthcare #NA931 V) diluted 10000-fold in 10% ImmunoBlock-containing PBS was reacted at room temperature for one hour. After washing, color development was performed using ECL Prime Western Blotting Detection Reagent (GE Healthcare #RPM2236).

(198) As a result, monoclonal antibodies HMa166 and HMa186 showed affinity to HMGB1-NT and recombinant human HMGB1. CP11-1 showed affinity only to recombinant human HMGB1 (FIG. 4).

(199) HMa166 and HMa186 were thought to recognize different epitopes (Table 1), and they did not react with Peptide No. 2 (C.sub.23-F.sub.38) (CREEHKKKHPDASVNF/SEQ ID NO: 2) or Peptide No. 3 (K.sub.65-Y.sub.75) (KADKARYEREMKTY/SEQ ID NO: 3). Therefore, the possibility that HMa186 recognizes the structure near cysteine at position 45 (C.sub.45) or the three-dimensional structure where the disulfide bond is formed by cysteines at position 23 (C.sub.23) and position 45 (C.sub.45) was considered (FIG. 5).

(200) 4. Confirmation of the Redox State of E. coli Recombinant Human HMGB1.

(201) The redox state of purified recombinant human HMGB1 was confirmed by the following method.

(202) There are reports showing that, in disulfide-type HMGB1 having cytokine-inducing ability, cysteines at position 23 (C.sub.23) and position 45 (C.sub.45) form a disulfide bond; whereas, in reduced-type HMGB1 which is involved in chemotaxis but does not have cytokine-inducing ability, this disulfide bond has been reduced. To conveniently determine which of the redox states a purified recombinant human HMGB1 is in, SDS-PAGE was performed, and their molecular weights were compared.

(203) To prevent oxidation (disulfide bond formation) of the purified recombinant human HMGB1, 10 mM glutathione and 1 mM EDTA were added, then 2× sample buffer (Daiichi Kagaku Yakuhin) (0.125 M Tris-HCl [pH 6.8], 4.3% SDS, 30% Glycerol, 0.01% BPB) was added in the presence or absence of 10% β-ME. After incubation at room temperature for ten minutes, SDS-PAGE was performed using 4-15% acrylamide gradient gel (Bio-Rad). As a control, SDS-PAGE was performed in the same manner using conunercially available disulfide HMGB1 (HMGBiotech).

(204) As a result, since commercially available disulfide HMGB subjected to SDS-PAGE under non-reducing conditions in the absence of β-ME retained the disulfide bond, the molecule was folded and the calculated molecular weight in SDS-PAGE was as low as 23.3 kDa (FIG. 7, Lane 4). On the other hand, since in commercially available disulfide HMGB subjected to SDS-PAGE under reducing conditions in the presence of β-ME, the disulfide bond was cleaved, and the folded structure of the molecule became cancelled, and thus the calculated molecular weight in SDS-PAGE was increased to 24.9 kDa (FIG. 7, Lane 5).

(205) The indicated molecular weights for recombinant human HMGB1 are higher than those of the commercially available HMGB1 because the recombinant human HMGB1 has an expression vector-derived sequence added to its N terminus. Its value under non-reducing condition was as low as 26.7 kDa (FIG. 7, Lane 2), and its value under reducing condition was as high as 27.4 kDa (FIG. 7, Lane 3). Accordingly, recombinant human HMGB1 was thought to retain its disulfide bond as with disulfide-type HMGB1.

(206) 5. Preparation of Reduced-Type Human Recombinant HMGB1

(207) Reduced-type HMGB1 was prepared by the following method. To purified recombinant human HMGB1 (1 mg/mL), DTT was added at 20 mM, and this was incubated at 37° C. for 60 minutes. Thereafter, buffer exchange was performed using a Nap-5 column for buffer exchange (GE Healthcare) equilibrated using PBS containing 20 mM glutathione.

(208) 6. Preparation of Alkylated Human Recombinant HMGB1

(209) As with reduced-type human recombinant HMGB1, DTT was added at 20 mM to alkylated HMGB1, and this was incubated at 37° C. for 60 minutes. After reduction, iodoacetamide (GE Healthcare) was added at 40 mM, and this was incubated at room temperature for 30 minutes. Thereafter, to inactivate excessive iodoacetamide, DTT was added at 10 mM. Then, buffer exchange was performed using a Nap-5 column for buffer exchange (GE Healthcare) equilibrated using PBS containing 20 mM glutathione.

(210) Disulfide-type HMGB1 was subjected to buffer exchange using a Nap-5 column for buffer exchange (GE Healthcare) equilibrated with PBS containing 20 mM glutathione.

(211) Protein quantification was performed by the Bradford staining method (Bio-Rad).

(212) 7. Disulfide Human Recombinant HMGB1-Specific Antibodies

(213) For the three types of anti-HMGB1 monoclonal antibodies, i.e., HMa116, HMa186, and CP11-1, the reactivity to disulfide-type human recombinant HMGB1, reduced-type human HMGB1, and alkylated human recombinant HMGB1 was examined using an intermolecular interaction-measuring apparatus, Biacore (GE Healthcare).

(214) An anti-mouse IgG antibody was immobilized onto a sensor chip by covalent bond, and after blocking with mouse IgG (Rockland Inc.), each of the monoclonal antibodies at 20 μg/mL was individually bound. After washing, 20 μg/mL of disulfide-type human recombinant HMGB1, reduced-type recombinant human HMGB1, and alkylated human recombinant HMGB1 were bound, and the amount of binding was measured.

(215) As a result, HMGB1 of three types of structures, i.e., disulfide-type human recombinant HMGB1, reduced-type human recombinant HMGB1, and alkylated human recombinant HMGB1, bound to monoclonal antibodies HMa166 and CP11-1. On the other hand, only disulfide-type human recombinant HMGB1 bound to HMa186, but not to reduced-type human recombinant HMGB1 or alkylated human recombinant HMGB1 (FIG. 8). That is, the HMa186 monoclonal antibody was found to be an antibody that specifically recognizes the disulfide bond region formed by cysteine C.sub.23 at position 23 and cysteine C.sub.45 at position 45 of disulfide-type HMGB1 which has cytokine-inducing ability.

(216) 8. Preparation of Thrombin-Cleaved HMGB1

(217) WO2014/147873 A1 reports that HMGB1 is cleaved by thrombin between arginine at position 10 (R.sub.10) and glycine at position 1 (G.sub.11) (N-terminal M1-R10 of HMGB1 is cleaved off), and des-HMGB1 which is a HMGB1 degradation product and has “GKMSS . . . ” (SEQ ID NO: 76) as the newly exposed N-terminal amino acid residues. Furthermore, WO2014/147873 A1 reports that des-HMGB1 is inactivated and has lowered cytotoxicity (WO2014/147873 A1, page 3, lines 15-22)

(218) Accordingly, the reactivity of each of the monoclonal antibodies to thrombin-cleaved HMGB1 was investigated. Thrombin cleavage was performed using a Thrombin Clean Cleave kit manufactured by Sigma-Aldrich according to the manufacturer's instructions. To 90 μL of human recombinant HMGB1 at 1 mg/mL, 10 μL of 10× buffer was added, and then washed thrombin-agarose was added, and this was incubated at 37° C. for three hours or 20 hours. After incubation, this was centrifuged at 500×g to remove thrombin-agarose, and SDS-PAGE was performed, and decrease in molecular weight was confirmed (FIG. 9). Furthermore, after SDS-PAGE, electrotransfer to a PVDF membrane was performed by a standard method using a transblotter (Bio-Rad), and a band suspected to be thrombin-cleaved HMGB1 was cut out, and N-terminal amino acid sequence analysis was performed using a protein sequencer (ABI). As a result, the determined sequence was N-GKMSSYAFFVQTXXEEHKKK-C (X: unknown amino acid/SEQ ID NO: 8), and this was verified to be equivalent to the sequence of des-HMGB1 (FIG. 9).

(219) 9. Reactivity of the Antibodies to des-HMGB1

(220) The affinity between des-HMGB1 and anti-HMGB1 monoclonal antibody HMa166 or Hma186 was examined using Biacore (GE Healthcare).

(221) An anti-mouse IgG antibody was immobilized onto a sensor chip by covalent bond, and after blocking with mouse IgG (Rockland Inc.), each of the monoclonal antibodies at 20 μg/mL was individually bound. After washing, 20 μg/mL of des-HMGB1 was bound, and the amount of binding was measured.

(222) As a result, HMa166 no longer reacted with des-HMGB1, but HMa186 was also able to bind to des-HMGB1 (FIG. 10).

(223) 10. Preparation of ELISA which can Measure Disulfide-Type HMGB1

(224) 100 μL of anti-HMGB1 antibody HMa186 at 10 μg/mL was added to a 96-well ELISA plate (Maxsorp, Nunc), and the antibody was immobilized by a standard method, and then 200 μL of ImmunoBlock (DS Pharma Biomedical) diluted five-fold with purified water was dispensed to perform blocking. After washing with TBSt (10 mM Tris pH7.4, 150 mM NaCl, 0.05% Tween-20), recombinant HMGB1 was added at 0 ng/mL to 80 ng/mL, and this was reacted at room temperature for two hours, then washed with TBSt. Then, HRP-labeled anti-HMGB1 antibody CP11-1 was added, and this was washed, and then coloring substrate TMBZ (KPL) was added according to a standard method, and the reaction was stopped using phosphoric acid. The absorbance at 450 nm was measured using a microplate reader.

(225) As a result, linearity was obtained with recombinant HMGB1 at 2.5 ng/mL to 80 ng/mL (FIG. 11).

(226) 11. Preparation of ELISA that can Measure Total HMGB1

(227) To accurately grasp the progression, course, and such of a pathological condition, it is important to measure not only disulfide-type HMGB1 having cytokine-inducing ability, but also reduced-type HMGB1 and cleaved des-HMGB1. Therefore, by using HMa166 and HMa186 in combination, ELISA that can measure all of HMGB1 (total HMGB1) including disulfide-type HMGB1, reduced-type HMGB1, and des-HMGB1, was prepared.

(228) 100 μL of HMa166 and HMa186 mixed to be 10 μg/mL was added to a 96-well ELISA plate (Maxsorp. Nunc), and the antibodies were immobilized by a standard method, and then 200 μL of ImmunoBlock (DS Pharma Biomedical) diluted five-fold with purified water was dispensed to perform blocking. After washing with TBSt (50 mM Tris pH7.4, 150 mM NaCl, 0.05% Tween-20), recombinant HMGB1 was added at 0 ng/mL to 80 ng/mL, and this was reacted at room temperature for two hours. After washing with TBSt, the HRP-labeled anti-HMGB1 antibody CP11-1 was added, and this was washed. Then, coloring substrate TMBZ (KPL) was added according to a standard method, and the reaction was stopped using phosphoric acid, and the absorbance at 450 nm was measured using a microplate reader.

(229) As a result, linearity was obtained with recombinant HMGB1 at 2.5 ng/mL to 80 ng/mL (FIG. 12).

(230) 12. Optimization of ELISA for Measuring Total HMGB1

(231) In antigen/antibody reactions such as ELISA, some antibodies are interfered even in a salt concentration or pH range used in common antigen/antibody reactions, and sometimes they cannot react efficiently. Accordingly, optimum salt concentration and pH for the reaction buffer used in ELISA for measuring total HMGB1 were examined by addition/recovery experiments. 100 μL of HMa166 and HMa186 mixed to be 10 μg/mL was added to a 96-well ELISA plate (Maxsorp, Nunc), and the antibodies were immobilized by a standard method, and then 300 μL of 100 mM Tris-HCl (pH8.8) with 1% BSA was dispensed to perform blocking. This was washed with TBSt (50 mM Tris-HCl (pH7.4), 150 mM NaCl, 0.05% Tween-20). Human pooled plasma (Kohjin Bio) was diluted ten-fold with the following buffers where pH was adjusted to 7.0, 7.5, 8.0, 8.5, and 9.0:

(232) 5% BSA, 100 mM Tris-HCl containing 0.1% Tween-20, 100 mM NaCl buffer (total salt concentration: 200 mM);

(233) 5% BSA, 100 mM Tris-HCl containing 0.1% Tween-20, 40 mM NaCl buffer (total salt concentration: 140 mM);

(234) 5% BSA, 20 mM Tris-HCl containing 0.1% Tween-20, 100 mM NaCl buffer (total salt concentration: 120 mM).

(235) Additionally, 20 ng of recombinant HMGB1 was added, and this was allowed to react at 37° C. for two hours. After washing with TBSt, the HRP-labeled anti-HMGB1 antibody CP11-1 which was diluted to 2 μg/mL using HRP Protector (CANDOR Bioscience GmbH) was added, and this was reacted at room temperature for one hour. After washing, coloring substrate TMBZ (KPL) was added according to a standard method, and the reaction was stopped using phosphoric acid, and the absorbance at 450 nm was measured using a microplate reader. The recovery rate was calculated by subtracting the HMGB1 concentration in the pooled plasma measured for each condition from the actually measured HMGB1 value, and dividing the obtained value by the amount of addition, 20.

(236) As a result, when the addition recovery rates of HMGB1 added to and recovered from human pooled plasma were compared, no large differences were observed, and the recovery rates were nearly within 100%±10% when the buffers were used at any of the salt concentrations except that a recovery rate of 121% was obtained when 100 mM Tris-HCl (pH7.0) with 40 mM NaCl was used as the buffer. It was found that ELISA in this case was not affected by differences in buffer salt concentrations at around 150 mM which are physiological salt concentrations often used in ELISA and such. Furthermore, also for pH, no large influences were found for pH values from 7.0 to 9.0 often used in ELISA and such (FIG. 13).

(237) 13. Sequences of the CDR Regions of HMa166 and HMa186

(238) (1) RNA Extraction

(239) 0.75 mL of Trizol LS Reagent (Invitrogen, Inc.) was added to HMa166- and HMa186-producing hybridomas (1×10.sup.7 cells), and the cells were directly dissolved by pipetting up and down. After incubating at room temperature for five minutes, 0.2 mL of chloroform was added, and this was mixed by shaking vigorously for 15 seconds. After incubation at room temperature for 15 minutes, this was subjected to centrifugation at 12,000 g for 15 minutes at 4° C. After centrifugation, the aqueous layer was collected, and 0.5 mL of isopropanol was added, and this was incubated at room temperature for ten minutes, and then subjected to centrifugation at 12,000 g for ten minutes at 4° C. 1 mL of 80% ethanol was added to the obtained precipitate, and the precipitate was washed, dried, and then dissolved in RNAse-free water to yield the RNA.

(240) (2) cDNA Synthesis

(241) cDNA synthesis was performed using PrimeScript II 1st strand cDNA Synthesis Kit (TAKARA BIO Inc.). 5 μM oligo dT primer, 1 mM dNTP, and RNase-free water were added to 2 μg of the RNA, to make the volume 10 μL, and this was incubated at 65° C. for five minutes. Thereafter, 5× PrimeScript II Buffer, RNase Inhibitor 20 U, PrimeScript IIRTase 200 U, and RNase-free water were added to make the volume 20 μL. After incubating the mixed solution at 42° C. for 45 minutes, this was heated to 72° C. for 15 minutes.

(242) (3) PCR of the CDR Regions

(243) The CDR regions were cloned according to the method of Wang et al. (J. Immunol. Method 2000, 233, 167-177). TaKaRa Ex Taq (TAKARA BIO Inc.) was used for the PCR enzyme. For PCR for the heavy chain, IgG1 primer (5′-ATAGACAGATGGGGGTGTCGTTTGGC-3′/SEQ ID NO: 64) and 5′ MH1 primer (5′-SARGTNMAGCTGSAGSAGTC-3′/SEQ ID NO: 65) were used as a set; and for PCR for the light chain, 3′ KC primer (5′-GGATACAGTTGGTGCAGCATC-3′/SEQ ID NO: 66) and 5′ MK primer (5′-GAYATTGTGMTSACMCARWCTMCA-3′/SEQ ID NO: 67) were used as a set.

(244) 1 μL of cDNA, 4 μL of 10× ExTaq buffer, 3.2 μL of dNTP, 0.5 μM each of the primer set, 1 U ExTaq, and sterilized purified water were added to make the volume 40 μL. The mixed solution was subjected to denaturation at 94° C. for three minutes; then repetition of 30 cycles of 94° C. for 30 seconds, 48° C. for 30 seconds, and 72° C. for 30 seconds; and then elongation reaction at 72° C. for three minutes.

(245) (4) Cloning of the CDR Regions

(246) Each of the obtained heavy-chain and light-chain PCR products was purified, and TA-cloned into the pT7 T-vector (Novagen). After incubation at 16° C. for one day and night, the ligated product was used to transform E. coli JM109, the cells were inoculated into LB agar medium containing 50 μg/mL ampicillin, and this was cultured overnight. The grown colonies were picked, and template DNAs prepared by the boiling method were subjected to PCR.

(247) (5) Sequences of the CDR Regions

(248) TaKaRa Ex Taq (TAKARA BIO Inc.) was used for the PCR enzyme. 1 μL of template DNA, 4 μL of 10× ExTaq buffer, 3.2 μL of dNTP, 0.5 μM each of the M13U primer (5′-TGTAAAACGACGGCCAGT-3′/SEQ ID NO: 68) and M13R primer (5′-GAAACAGCTATGACCATG-3′/SEQ ID NO: 69), 1 U ExTaq, and sterilized purified water were added to make the volume 40 μL. The mixed solution was subjected to denaturation at 94° C. for three minutes; then repetition of 30 cycles of 94° C. for 30 seconds, 55° C. for 30 seconds, and 72° C. for 30 seconds; and then elongation reaction at 72° C. for three minutes. The obtained PCR products were purified, and sequencing reaction was performed by a standard method using each of the M13U and M13R primers, and sequencing was performed using an ABI 3100 Genetic Analyzer (Applied Biosystems)

(249) (6) Sequence Analysis of the CDR Regions

(250) The obtained sequences were verified using the sequencer, and the CDR regions were analyzed using IGBLAST (www.ncbi.nlm.nih.gov/igblast/). The results are shown in FIGS. 14 to 16.