ROR2 ANTIBODY COMPOSITIONS AND RELATED METHODS
20210347892 · 2021-11-11
Inventors
Cpc classification
C07K2317/24
CHEMISTRY; METALLURGY
A61K47/6889
HUMAN NECESSITIES
C07K2317/90
CHEMISTRY; METALLURGY
A61K47/6809
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
Abstract
The invention provides antibodies, antibody fragments or antigen-binding fragments, as well as related antibody drug conjugates (ADCs) and chimeric antigen receptors (CARs), that specifically recognize human ROR2. Also provided in the invention are methods of using such antibodies in various diagnostic and therapeutic applications.
Claims
1. A polynucleotide encoding the heavy chain variable region and/or the light chain variable region of an antibody that specifically binds to the extracellular domain of human receptor tyrosine kinase-like orphan receptor 2 (ROR2), wherein the antibody comprises heavy chain CDR1, CDR2 and CDR3 sequences and light chain CDR1, CDR2 and CDR3 sequences respectively shown in SEQ ID NOs:25-27 and SEQ ID NOs:61-63.
2. The polynucleotide of claim 1, wherein the antibody comprises a heavy chain variable region sequence and a light chain variable region sequence that are at least 95% identical to SEQ ID NO:1 and SEQ ID NO:13, respectively.
3. The polynucleotide of claim 1, wherein the antibody comprises a heavy chain variable region sequence and a light chain variable region sequence that are respectively identical to SEQ ID NO:1 and SEQ ID NO:13.
4. A vector harboring the polynucleotide of claim 1.
5. A pharmaceutical composition comprising (1) a therapeutically effective amount of the vector of claim 4, and (2) a pharmaceutically acceptable carrier.
6. A kit comprising the vector of claim 4.
7. A method of killing or inhibiting the growth of a cell expressing ROR2 in a subject, comprising administering a pharmaceutical composition of claim 5 to a subject in need thereof, thereby killing or inhibiting the growth of the cell expressing ROR2 in the subject.
8. A method of treating a disease or condition associated with elevated expression of ROR2 in a subject, comprising administering a pharmaceutical composition of claim 5 to a subject having a disease or condition associated with elevated expression of ROR2, thereby treating the disease or condition associated with elevated expression of ROR2 in the subject.
9. An antibody, an antibody-based binding protein or an antibody fragment that specifically binds to the extracellular domain of human receptor tyrosine kinase-like orphan receptor 2 (ROR2), comprising heavy chain CDR1-3 sequences and light chain CDR1-3 sequences that are that are respectively identical to (i) SEQ ID NOs:28-30 and SEQ ID NOs:64-66, (ii) SEQ ID NOs:31-33 and SEQ ID NOs:67-69, (iii) SEQ ID NOs:34-36 and SEQ ID NOs:70-72, (iv) SEQ ID NOs:37-39 and SEQ ID NOs:73-75, (v) SEQ ID NOs:40-42 and SEQ ID NOs:76-78, (vi) SEQ ID NOs:43-45 and SEQ ID NOs:79-81, (vii) SEQ ID NOs:46-48 and SEQ ID NOs:82-84, (viii) SEQ ID NOs:49-51 and SEQ ID NOs:85-87, (ix) SEQ ID NOs:52-54 and SEQ ID NOs:88-90, (x) SEQ ID NOs:55-57 and SEQ ID NOs:91-93, or (xi) SEQ ID NOs:58-60 and SEQ ID NOs:94-96.
10. The antibody, antibody-based binding protein or antibody fragment of claim 9, comprising a heavy chain variable region sequence and a light chain variable region sequence that are at least 95% identical, respectively, to (i) SEQ ID NO:2 and SEQ ID NO:14; (ii) SEQ ID NO:3 and SEQ ID NO:15; (iii) SEQ ID NO:4 and SEQ ID NO:16; (iv) SEQ ID NO:5 and SEQ ID NO:17; (v) SEQ ID NO:6 and SEQ ID NO:18; (vi) SEQ ID NO:7 and SEQ ID NO:19; (vii) SEQ ID NO:8 and SEQ ID NO:20; (viii) SEQ ID NO:9 and SEQ ID NO:21; (ix) SEQ ID NO:10 and SEQ ID NO:22; (x) SEQ ID NO:11 and SEQ ID NO:23; or (xi) SEQ ID NO:12 and SEQ ID NO:24.
11. The antibody, antibody-based binding protein or antibody fragment of claim 9, comprising a heavy chain variable region sequence and a light chain variable region sequence that are respectively shown in (i) SEQ ID NO:2 and SEQ ID NO:14; (ii) SEQ ID NO:3 and SEQ ID NO:15; (iii) SEQ ID NO:4 and SEQ ID NO:16; (iv) SEQ ID NO:5 and SEQ ID NO:17; (v) SEQ ID NO:6 and SEQ ID NO:18; (vi) SEQ ID NO:7 and SEQ ID NO:19; (vii) SEQ ID NO:8 and SEQ ID NO:20; (viii) SEQ ID NO:9 and SEQ ID NO:21; (ix) SEQ ID NO:10 and SEQ ID NO:22; (x) SEQ ID NO:11 and SEQ ID NO:23; or (xi) SEQ ID NO:12 and SEQ ID NO:24.
12. The antibody, antibody-based binding protein or antibody fragment of claim 9, wherein the antibody or antibody fragment is chimeric or humanized.
13. An antibody drug conjugate (ADC), comprising the antibody or antibody fragment of claim 9 and at least one cytotoxic agent.
14. The antibody, antibody-based binding protein or antibody fragment of claim 9, wherein the antibody or antibody fragment is IgA1, IgA2, IgD, IgE, IgG1, IgG2, IgG3, IgG4, synthetic IgG, IgM, F(ab)2, Fv, scFv, IgGACH2, F(ab′)2, scFv2CH3, Fab, VL, VH, scFv4, scFv3, scFv2, dsFv, Fv, scFv-Fc, (scFv)2, a non-depleting IgG, a diabody, or a bivalent antibody.
15. The antibody, antibody-based binding protein or antibody fragment of claim 9, which is conjugated to a synthetic molecule.
16. The antibody, antibody-based binding protein or antibody fragment of claim 15, wherein the synthetic molecule is a cytotoxic agent, a label, a therapeutic radioisotope, or a liposome.
17. The antibody or antigen-binding fragment of claim 16, wherein the cytotoxic agent is selected from a small molecule weight toxin, or a peptide toxin, or a protein toxin.
18. A pharmaceutical composition comprising (1) a therapeutically effective amount of (a) an antibody, antibody-based binding protein or antibody fragment of claim 9, and (2) a pharmaceutically acceptable carrier.
19. A method of killing or inhibiting the growth of a cell expressing ROR2 in a subject, comprising administering a pharmaceutical composition of claim 18 to a subject in need thereof, thereby killing or inhibiting the growth of the cell expressing ROR2 in the subject.
20. A method of treating a disease or condition associated with elevated expression of ROR2 in a subject, comprising administering a pharmaceutical composition of claim 18 to a subject having a disease or condition associated with elevated expression of ROR2, thereby treating the disease or condition associated with elevated expression of ROR2 in the subject.
Description
DESCRIPTION OF THE DRAWINGS
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
DETAILED DESCRIPTION
I. Overview
[0045] Receptor tyrosine kinase orphan receptors-1 and -2, ROR1 and ROR2, are the only two family members defining a new receptor tyrosine kinase family, based on the overall structural design and some functional similarities. Both ROR1 and ROR2 proteins are type I-single pass trans-membrane receptors with an extracellular domain (ECD) consisting of an immunoglobulin domain, a cysteine rich frizzled domain and a Kringle domain. These three extracellular domains are followed by a trans-membrane domain connecting the ECD to an intracellular portion of the protein comprising kinase domains (Rabagay et al. (2012) Frontiers Oncol. 2: 1-8).
[0046] The human ROR1 and ROR2 proteins are 58% homologous between each other, but each of the ROR proteins is highly conserved between species. This represents a challenge for the development of human ROR2 specific monoclonal antibodies and very few antibodies are known, and no sequences of anti-ROR2 antibodies have been described in the literature.
[0047] In order to develop anti-hROR2 antibodies, the present inventors have generated a very high-complexity naïve rabbit antibody Fab library displayed by phage and selected this library for binders to the mammalian cell expressed human ECD of hROR2 and to cell-surface expressed human ROR2, in order to select most functional and diverse antibody clones reactive with native human ROR2 protein.
[0048] This strategy was chosen, because the antibody repertoire to be mined is still derived from natural rabbit B lymphocytes and thus selected for immune-system pre-selected antibody heavy and light chains. However, due to the applied screening strategy involving native recombinant and cell-expressed human ROR2 it was the hope that hROR2 specific antibodies would be identified with high functional qualities that are potentially useful for the therapy of human diseases associated with ROR2 expression, like in particular ROR2-positive cancer.
[0049] As a result of the chosen strategy a number of novel rabbit high-affinity anti-human ROR2 antibodies have been identified with diverse CDR1, 2 and 3 sequences (
[0050] In addition to this, several, mAbs were expressed as chimeric rabbit/human IgG1 with C-terminal sortase-recognition tags, allowing site-specific conjugation of payloads to the antibody C-termini by sortase-enzyme mediated antibody conjugation technology (SMAC-Technology™) essentially as described in WO2014140317. These anti-hROR2 antibodies have then been site-specifically conjugated to a highly potent anthracycline-based PNU-159682 toxin derivative, Gly5-EDA-PNU (
[0051] To further investigate the therapeutic utility of ROR2-targeting mAbs, CAR-T cells based on XBR2-401 were engineered using previously described methods (Hudecek, M, Lupo-Stanghellini, M T, Kosasih, P. L., Sommermeyer, D., Jensen, M C., Rader, C., and Riddell, S. R. (2013) Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T cells. Clin. Cancer Res. 19, 3153-3164). In brief, ex vivo expanded healthy donor CD8+CD62L+ T cells were lentivirally transduced with an EF1a promoter-driven expression cassette containing XBR2-401 in scFv format, followed by a short or long spacer, the transmembrane domain of human CD28, the signaling domain of 4-1BB, the signaling domain of CD3ζ, and a T2A-separated transmembrane EGFR fragment with truncated ligand binding and tyrosine kinase domains. FACS isolation of EGFR+ transduced T cells, revealed robust anti-ROR2 recognition in >90% of CAR-T cells. The activity of the ROR2-targeting XBR2-401 CAR-T with short and long spacer was tested against breast cancer cell lines T47D (ROR2+ROR1−) and MDA-MB-231 (ROR2−ROR1+). Since XBR2-401 binds to a membrane-proximal epitope in the Kr domain of ROR2, the inventors hypothesized predicted that XBR2-401 CAR-T cells are more active with a long rather than a short spacer. This was confirmed with respect to proliferation, IFN-γ and IL-2 secretion, and cytotoxicity in the presence of ROR2+ROR1− target cells (
[0052] In accordance with these studies, the present invention provides monoclonal antibodies and related antibody-based binding proteins and antibody fragments (antigen-binding fragments) thereof that specifically recognize hROR2. The invention also provides antibody drug conjugates (ADCs) and chimeric antigen receptors (CARs) derived from the hROR2 antibodies described herein. Further provided in the invention are methods of using these antibody agents and related compositions in therapeutic and diagnostic applications for diseases and conditions with associated abnormal or elevated ROR2 expression, e.g., cancer.
II. Definitions
[0053] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which this invention pertains. The following references provide one of skill with a general definition of many of the terms used in this invention: Academic Press Dictionary of Science and Technology, Morris (Ed.), Academic Press (1.sup.st ed., 1992); Oxford Dictionary of Biochemistry and Molecular Biology, Smith et al. (Eds.), Oxford University Press (revised ed., 2000); Encyclopaedic Dictionary of Chemistry, Kumar (Ed.), Anmol Publications Pvt. Ltd. (2002); Dictionary of Microbiology and Molecular Biology, Singleton et al. (Eds.), John Wiley & Sons (3.sup.rd ed., 2002); Dictionary of Chemistry, Hunt (Ed.), Routledge (1.sup.st ed., 1999); Dictionary of Pharmaceutical Medicine, Nahler (Ed.), Springer-Verlag Telos (1994); Dictionary of Organic Chemistry, Kumar and Anandand (Eds.), Anmol Publications Pvt. Ltd. (2002); and A Dictionary of Biology (Oxford Paperback Reference), Martin and Hine (Eds.), Oxford University Press (4.sup.th ed., 2000). In addition, the following definitions are provided to assist the reader in the practice of the invention.
[0054] The term “antibody” also synonymously called “immunoglobulins” (Ig), or “antigen-binding fragment” refers to polypeptide chain(s) which exhibit a strong monovalent, bivalent or polyvalent binding to a given antigen, epitope or epitopes. Unless otherwise noted, antibodies or antigen-binding fragments used in the invention can have sequences derived from any vertebrate species. They can be generated using any suitable technology, e.g., hybridoma technology, ribosome display, phage display, gene shuffling libraries, semi-synthetic or fully synthetic libraries or combinations thereof. Unless otherwise noted, the term “antibody” as used in the present invention includes intact antibodies, antigen-binding polypeptide fragments and other designer antibodies that are described below or well known in the art (see, e.g., Serafini, J Nucl. Med. 34:533-6, 1993).
[0055] An intact “antibody” typically comprises at least two heavy (H) chains (about 50-70 kD) and two light (L) chains (about 25 kD) inter-connected by disulfide bonds. The recognized immunoglobulin genes encoding antibody chains include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.
[0056] Each heavy chain of an antibody is comprised of a heavy chain variable region (V.sub.H) and a heavy chain constant region. The heavy chain constant region of most IgG isotypes (subclasses) is comprised of three domains, C.sub.H1, C.sub.H2 and C.sub.H3, some IgG isotypes, like IgM or IgE comprise a fourth constant region domain, CH4. Each light chain is comprised of a light chain variable region (V.sub.L) and a light chain constant region. The light chain constant region is comprised of one domain, C.sub.L. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system and the first component (Clq) of the classical complement system.
[0057] The V.sub.H and V.sub.L regions of an antibody can be further subdivided into regions of hypervariability, also termed complementarity determining regions (CDRs), which are interspersed with the more conserved framework regions (FRs). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The locations of CDR and FR regions and a numbering system have been defined by, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, U.S. Government Printing Office (1987 and 1991).
[0058] An “antibody-based binding protein”, as used herein, may represent any protein that contains at least one antibody-derived V.sub.H, V.sub.L, or C.sub.H immunoglobulin domain in the context of other non-immunoglobulin, or non-antibody derived components. Such antibody-based proteins include, but are not limited to (i) F.sub.c-fusion proteins of binding proteins, including receptors or receptor components with all or parts of the immunoglobulin C.sub.H domains, (ii) binding proteins, in which V.sub.H and or V.sub.L domains are coupled to alternative molecular scaffolds, or (iii) molecules, in which immunoglobulin V.sub.H, and/or V.sub.L, and/or C.sub.H domains are combined and/or assembled in a fashion not normally found in naturally occurring antibodies or antibody fragments (antigen-binding fragments).
[0059] “Binding affinity” is generally expressed in terms of equilibrium association or dissociation constants (K.sub.A or K.sub.D, respectively), which are in turn reciprocal ratios of dissociation and association rate constants (k.sub.off and k.sub.on, respectively). Thus, equivalent affinities may correspond to different rate constants, so long as the ratio of the rate constants remains the same. The binding affinity of an antibody is usually be expressed as the K.sub.D of a monovalent fragment (e.g. a F.sub.ab fragment) of the antibody, with K.sub.D values in the single-digit nanomolar range or below (subnanomolar or picomolar) being considered as very high and of therapeutic and diagnostic relevance.
[0060] As used herein, the term “binding specificity” refers to the selective affinity of one molecule for another such as the binding of antibodies to antigens (or an epitope or antigenic determinant thereof), receptors to ligands, and enzymes to substrates. Thus, all monoclonal antibodies that bind to a particular antigenic determinant of an entity (e.g., a specific epitope of ROR1 or ROR2) are deemed to have the same binding specificity for that entity.
[0061] The term “Antibody Drug Conjugate”, or “ADC” refers to an antibody to which a therapeutically active substance or an active pharmaceutical ingredient (API) has been covalently coupled, such that the therapeutically active substance or an active pharmaceutical ingredient (API) can be targeted to the binding target of the antibody to exhibit its pharmacologic function. The therapeutically active substance or an active pharmaceutical ingredient can be a cellular toxin that is able to effect killing of the cells targeted by the ADCs, preferably malignant or cancer cells. The covalent attachment of a therapeutically active substance, an active pharmaceutical ingredient or a cellular toxin can be performed in a non-site specific manner using standard chemical linkers that couple payloads to lysine or cysteine residues, or, preferably the conjugation is performed in a site-specific manner, that allows full control of conjugation site and drug to antibody ratio (DAR) of the ADC to be generated.
[0062] The term “conservatively modified variant” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence.
[0063] For polypeptide sequences, “conservatively modified variants” refer to a variant which has conservative amino acid substitutions, amino acid residues replaced with other amino acid residue having a side chain with a similar charge. Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
[0064] The term “contacting” has its normal meaning and refers to combining two or more agents (e.g., polypeptides or phage), combining agents and cells, or combining two populations of different cells. Contacting can occur in vitro, e.g., mixing an antibody and a cell or mixing a population of antibodies with a population of cells in a test tube or growth medium. Contacting can also occur in a cell or in situ, e.g., contacting two polypeptides in a cell by coexpression in the cell of recombinant polynucleotides encoding the two polypeptides, or in a cell lysate. Contacting can also occur in vivo inside a subject, e.g., by administering an agent to a subject for delivery the agent to a target cell.
[0065] The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
[0066] Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, Adv. Appl. Math. 2:482c, 1970; by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; by the search for similarity method of Pearson and Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444, 1988; by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, Madison, Wis.); or by manual alignment and visual inspection (see, e.g., Brent et al., Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (ringbou ed., 2003)). Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402, 1977; and Altschul et al., J. Mol. Biol. 215:403-410, 1990, respectively.
[0067] The term “subject” refers to human and non-human animals (especially non-human mammals). The term “subject” is used herein, for example, in connection with therapeutic and diagnostic methods, to refer to human or animal subjects. Animal subjects include, but are not limited to, animal models, such as, mammalian models of conditions or disorders associated with elevated ROR2 expression such as neuroblastoma, osteosarcoma, renal cell carcinoma, breast cancer, gastric cancer, prostate cancer, melanoma, squamous cell carcinoma, multiple myeloma and other cancers. Other specific examples of non-human subjects include, e.g., cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys.
[0068] Artificial T cell receptors (also known as chimeric T cell receptors, chimeric immunoreceptors, chimeric antigen receptors (CARs) or T-bodies) are engineered receptors, which graft an arbitrary specificity onto an immune effector cell. Typically, these receptors are used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral or lentiviral vectors or by transposons. CAR-engineered T cells (also abbreviated CAR-T cells) are genetically engineered T cells armed with chimeric receptors whose extracellular recognition unit is comprised of an antibody-derived recognition domain and whose intracellular region is derived from lymphocyte stimulating moiety(ies). The structure of the prototypic CAR is modular, designed to accommodate various functional domains and thereby to enable choice of specificity and controlled activation of T cells. The preferred antibody-derived recognition unit is a single chain variable fragment (scFv) that combines the specificity and binding residues of both the heavy and light chain variable regions of a monoclonal antibody. The most common lymphocyte activation moieties include a T-cell costimulatory (e.g. CD28) domain in tandem with a T-cell triggering (e.g. CD3zeta) moiety. By arming effector lymphocytes (such as T cells and natural killer cells) with such chimeric receptors, the engineered cell is redirected with a predefined specificity to any desired target antigen, in a non-HLA restricted manner. CAR constructs are introduced ex vivo into T cells from peripheral lymphocytes of a given patient using retroviral or lentiviral vectors or transposons. Following infusion of the resulting CAR-engineered T cells back into the patient, they traffic, reach their target site, and upon interaction with their target cell or tissue, they undergo activation and perform their predefined effector function. Therapeutic targets for the CAR approach include cancer and HIV-infected cells, or autoimmune effector cells.
[0069] The terms “treat,” “treating,” “treatment,” and “therapeutically effective” used herein do not necessarily imply 100% or complete treatment. Rather, there are varying degrees of treatment recognized by one of ordinary skill in the art as having a potential benefit or therapeutic effect. In this respect, the inventive method can provide any amount of any level of treatment. Furthermore, the treatment provided by the inventive method can include the treatment of one or more conditions or symptoms of the disease being treated.
[0070] A “vector” is a replicon, such as plasmid, phage or cosmid, to which another polynucleotide segment may be attached so as to bring about the replication of the attached segment. Vectors capable of directing the expression of genes encoding for one or more polypeptides are referred to as “expression vectors”.
III. Antibodies, Antibody-Based Binding Proteins, Antibody Fragments Thereof, Antibody Drug Conjugates (ADCs), or CARs Specifically Binding to ROR2 and Related Derivative Compounds
[0071] In one aspect, the invention provides novel antibodies, antibody-based binding proteins, antibody fragments (also termed “antigen-binding fragments”) thereof, ADCs or CARs that specifically bind to human ROR2 with the same binding specificity as that of anti-ROR2 antibody exemplified herein (
[0072] Antibodies of the invention also encompass antibody fragments, like single chain antibodies. The term “single chain antibody” refers to a polypeptide comprising a V.sub.H domain and a V.sub.L domain in polypeptide linkage, generally linked via a spacer peptide, and which may comprise additional domains or amino acid sequences at the amino- and/or carboxyl-termini. For example, a single-chain antibody may comprise a tether segment for linking to the encoding polynucleotide. As an example, a single chain variable region fragment (scFv) is a single-chain antibody. Compared to the V.sub.L and V.sub.H domains of the Fv fragment which are coded for by separate genes, a scFv has the two domains joined (e.g., via recombinant methods) by a synthetic linker. This enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules.
[0073] Antibodies of the present invention also encompass single domain antigen-binding units, which have a camelid scaffold. Animals in the camelid family include camels, llamas, and alpacas. Camelids produce functional antibodies devoid of light chains. The heavy chain variable (V.sub.H) domain folds autonomously and functions independently as an antigen-binding unit. Its binding surface involves only three CDRs as compared to the six CDRs in classical antigen-binding molecules (Fabs) or single chain variable fragments (scFvs). Camelid antibodies are capable of attaining binding affinities comparable to those of conventional antibodies.
[0074] The various antibodies, antibody-based binding proteins, and antibody fragments thereof described herein can be produced by enzymatic or chemical modification of the intact antibodies, or synthesized de novo using recombinant DNA methodologies, or identified using phage display libraries. Methods for generating these antibodies, antibody-based binding proteins, and antibody fragments thereof are all well known in the art. For example, single chain antibodies can be identified using phage display libraries or ribosome display libraries, gene shuffled libraries (see, e.g., McCafferty et al., Nature 348:552-554, 1990; and U.S. Pat. No. 4,946,778). In particular, scFv antibodies can be obtained using methods described in, e.g., Bird et al., Science 242:423-426, 1988; and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988. Fv antibody fragments can be generated as described in Skerra and PlUckthun, Science 240:1038-41, 1988. Disulfide-stabilized Fv fragments (dsFvs) can be made using methods described in, e.g., Reiter et al., Int. J. Cancer 67:113-23, 1996. Similarly, single domain antibodies (dAbs) can be produced by a variety of methods described in, e.g., Ward et al., Nature 341:544-546, 1989; and Cai and Garen, Proc. Natl. Acad. Sci. USA 93:6280-85, 1996. Camelid single domain antibodies can be produced using methods well known in the art, e.g., Dumoulin et al., Nat. Struct. Biol. 11:500-515, 2002; Ghahroudi et al., FEBS Letters 414:521-526, 1997; and Bond et al., J. Mol. Biol. 332:643-55, 2003. Other types of antigen-binding fragments (e.g., Fab, F(ab′)2 or Fd fragments) can also be readily produced with routinely practiced immunology methods. See, e.g., Harlow & Lane, Using Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1998.
[0075] In some embodiments, the antibodies, antibody fragments, antibody-based binding proteins, ADCs or CARs of the invention have their heavy chain CDR1, CDR2 and CDR3 sequences and their light chain CDR1, CDR2 and CDR3 sequences that are substantially identical to that of the antibodies shown in
[0076] In some embodiments, the antibodies, antibody fragments, antibody-based binding proteins, ADCs or CARs of the invention comprise the heavy chain CDR1-CDR3 and light chain CDR1-CDR3 sequences that are respectively identical to the sequences shown in (1) SEQ ID NOs:25-27 and SEQ ID NOs:61-63 (antibody XBR2-401), (2) SEQ ID NOs:28-30 and SEQ ID NOs:64-66 (antibody XBR2-416), (3) SEQ ID NOs:31-33 and SEQ ID NOs:67-69 (antibody XBR2-433), (4) SEQ ID NOs:34-36 and SEQ ID NOs:70-72 (antibody XBR2-327), (5) SEQ ID NOs:37-39 and SEQ ID NOs:73-75 (antibody XBR2-TOP9), (6) SEQ ID NOs:40-42 and SEQ ID NOs:76-78 (antibody XBR2-TOP72), (7) SEQ ID NOs:43-45 and SEQ ID NOs:79-81 (antibody ERR2-302), (8) SEQ ID NOs:46-48 and SEQ ID NOs:82-84 (antibody ERR2-308), (9) SEQ ID NOs:49-51 and SEQ ID NOs:85-87 (antibody ERR2-316), (10) SEQ ID NOs:52-54 and SEQ ID NOs:88-90 (antibody ERR2-317), (11) SEQ ID NOs:55-57 and SEQ ID NOs:91-93 (antibody ERR2-TOP2), or (12) SEQ ID NOs:58-60 and SEQ ID NOs:94-96 (antibody ERR2-TOP35).
[0077] In other embodiments, the antibodies, antibody fragments, antibody-based binding proteins, ADCs or CARs of the invention that specifically bind to human ROR2 contain (a) a light chain variable domain having a sequence that is substantially identical to any one of SEQ ID NOs:13-24, (b) a heavy chain variable domain having a sequence that is substantially identical to any one of SEQ ID NOs:1-12, or (c) both a light chain of (a) and a heavy chain of (b). In some embodiments, the antibody, antibody fragment, antibody-based binding protein, ADC or CAR of the invention comprises both a light chain of (a) and a heavy chain of (b). In some embodiments, the antibody, antibody fragment, antibody-based binding protein, ADC or CAR of the invention contains (a) a light chain variable domain having at least 90% identity to any one of SEQ ID NOs:13-24, (b) a heavy chain variable domain having at least 90% sequence identity to any one of SEQ ID NOs:1-12, or (c) both a light chain of (a) and a heavy chain of (b). In some embodiments, the percentage identity can be at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, or even 100%. In some embodiments, the light chain variable domain has at least 95% identity to any one of SEQ ID NOs:13-24. In some embodiments, the light chain variable domain has 100% identity to any one of SEQ ID NOs:13-24. In some embodiments, the antibody, antibody fragment, antibody-based binding protein, ADC or CAR of the invention contains a heavy chain variable domain having at least 90% identity to any one of SEQ ID NOs:1-12. In other embodiments, the percentage identity can be at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, or even 100%. In some embodiments, the heavy chain variable domain has at least 95% identity to any one of SEQ ID NOs:1-12. In some embodiments, the heavy chain variable domain has 100% identity to any one of SEQ ID NOs:1-12.
[0078] In some embodiments, the antibody, antibody fragment, antibody-based binding protein, ADC or CAR of the invention of the invention can comprise any heavy chain as described herein (e.g., heavy chains shown in
[0079] The antibody, antibody fragment, antibody-based binding protein, ADC or CAR of the invention of the invention can be any antibody including a full length antibody or an antibody fragment that specifically recognizes or binds to the extracellular domain of human ROR2. For example, the antibody, antibody fragment or antibody-based binding protein can be polyclonal, monoclonal, recombinant, chimeric, or humanized. Furthermore, the antibody can be of any isotype including without limitation IgA, IgD, IgE, IgG, or IgM. Thus, for example, the antibody can be any IgA such as IgA1 or IgA2, or any IgG such as IgG1, IgG2, IgG3, IgG4, or synthetic IgG. The antibody can also be any antibody fragment or antibody-based binding protein having specificity for the extracellular domain of human ROR2, such as F(ab)2, Fv, scFv, IgGACH2, F(ab′)2, scFv2CH3, Fab, VL, VH, scFv4, scFv3, scFv2, dsFv, Fv, scFv-Fc, (scFv)2, a diabody, and a bivalent antibody. The antibody can be any modified or synthetic antibody, including, but not limited to, non-depleting IgG antibodies, CARs, or other Fc or Fab variants of antibodies.
[0080] In addition to a heavy chain as described above, the antibody, antibody-based binding proteins or antibody fragments thereof of the invention can further comprise a light chain selected from a Fab library using sequential naïve chain shuffling. Likewise, in addition to a light chain as described above, the antibody of the invention can further comprise a heavy chain selected from a Fab library using sequential naïve chain shuffling.
[0081] In some embodiments, the invention provides antibodies, antibody-based binding proteins or antibody fragments thereof that are conservatively modified variants of the anti-ROR2 antibodies exemplified herein. Typically, the variable regions of these variants have an amino acid sequence that is identical to one of these exemplified sequences except for conservative substitutions at one or more amino acid residues. In some embodiments, the antibody, antibody fragment, antibody-based binding protein, ADC or CAR of the invention specifically binds to human ROR2 and contains at least one CDR having a sequence selected from the group consisting of SEQ ID NOs:25-96. The invention also provides an isolated antibody, antibody fragment, antibody-based binding protein, ADC or CAR with specificity for ROR2 containing one or more variants of the foregoing CDR sequences or substantially identically CDR sequences. The variant CDR sequences in these antibodies can include 1, 2, or 3 substitutions, insertions, deletions, or combinations thereof in a sequence selected from the group consisting of SEQ ID NOs:25-96. For example, a recombinant chimeric or humanized antibody (or fragment thereof) can include one, two, three, four, five, or six of the foregoing CDR sequences. In some embodiments, however, the recombinant chimeric or humanized antibody (or fragment thereof) includes three CDR sequences of the same light or heavy chain, e.g., light chain CDRS shown in SEQ ID NOs:61-63, SEQ ID NOs:64-66, or SEQ ID NOs:67-69; and heavy chain CDRs shown in SEQ ID NOs:25-27, SEQ ID NOs:28-30; or SEQ ID NOs:31-33. In some embodiments, the recombinant chimeric or humanized antibody (or fragment thereof) includes six CDR sequences of the same antibody, e.g., (a) SEQ ID NOs:61-63 and SEQ ID NOs:25-27; (b) SEQ ID NOs:64-66 and SEQ ID NOs:28-30; or (c) SEQ ID NOs:67-69 and SEQ ID NOs:31-33.
[0082] In some embodiments, the invention provides antibodies, antibody-based binding proteins or antibody fragments thereof with avidity for ROR2 of about 10 μM or less, 5 μM or less, 2 μM or less, 1 μM or less, 500 nM or less, 400 nM or less, 300 nM or less, or 200 nM or less. In some embodiments, the antibodies, antibody-based binding proteins or antibody fragments thereof bind to ROR2 with an avidity of about 100 nM or less, about 75 nM or less, about 50 nM or less, about 25 nM or less, about 10 nM or less, or about 5 nM or less. In some embodiments, the antibodies, antibody-based binding proteins or antibody fragments thereof bind to ROR2 with an avidity of about 1 nM or less, about 800 pM or less, about 700 pM or less, about 600 pM or less, about 500 pM or less, about 400 pM or less, about 300 pM or less, about 200 pM or less, or about 100 pM or less. Avidity can be measured using art-known techniques, such as ELISA, biolayer inferometry, or surface plasmon resonance.
[0083] The antibody, antibody-based binding protein or antibody fragment thereof of the invention can be produced by any suitable technique, for example, using any suitable eukaryotic or non-eukaryotic expression system. In certain embodiments, the antibody, antibody-based binding protein or antibody fragment thereof is produced using a mammalian expression system. Some specific techniques for generating the antibodies or antigen-binding fragments of the invention are exemplified herein. In some embodiments, the antibodies or antigen-binding fragments of the invention can be produced using a suitable non-eukaryotic expression system such as a bacterial expression system. Bacterial expression systems can be used to produce fragments such as a F(ab)2, Fv, scFv, IgGACH2, F(ab′)2, scFv2CH3, Fab, VL, VH, scFv4, scFv3, scFv2, dsFv, Fv, scFv-Fc, (scFv)2, and diabodies. Techniques for altering DNA coding sequences to produce such fragments are known in the art.
[0084] The antibodies, antibody-based binding proteins or antibody fragments thereof of the invention can be conjugated to a synthetic molecule using any type of suitable conjugation. Recombinant engineering and incorporated selenocysteine (e.g., as described in U.S. Pat. No. 8,916,159 issued on Dec. 23, 2014) can be used to conjugate a synthetic molecule. Other methods of conjugation can include covalent coupling to native or engineered lysine side-chain amines or cysteine side-chain thiols. See, e.g., Wu et al., Nat. Biotechnol, 23: 1 137-1 146 (2005).
[0085] In a preferred embodiment, the antibodies, antibody-based binding proteins or antibody fragments thereof of the invention conjugated to a synthetic molecule (called “ADC” for antibody drug conjugate with the synthetic molecule being a toxin) are obtained by means of site-specific sortase-enzyme mediated antibody conjugation. As disclosed in WO2014140317, sortases (also called sortase transpeptidases) form a group of prokaryotic enzymes that modify surface proteins by recognizing and cleaving a specific peptide motif called “sortase recognition tag” or “sortase tag”. Usually, a given sortase enzyme recognizes one or more sortase recognition tags. Sortase enzymes can be naturally occurring, or may have undergone genetic engineering (Dorr et al., PNAS 2014; 111, 13343-8).
[0086] In a preferred embodiment, the conjugate is obtained by means of site-specific sortase-enzyme mediated conjugation of (a) an antibody, antibody-based binding protein or antibody fragment thereof as described herein carrying one or more sortase recognition tags, and (b) one or more synthetic molecules carrying a glycine or oligoglycine tag, Gly(n). Preferably, the sortase recognition tag is fused or conjugated to the C-terminus of at least one subdomain of the antibody. Said sortase recognition tag is preferably selected from the group consisting of LPXSG (SEQ ID NO:137), LPXAG (SEQ ID NO:138), LPXTG (SEQ ID NO:139), LAXTG (SEQ ID NO:140), 3 and NPQTG (SEQ ID NO:141), with X being any amino acid residue. Preferably, the oligoglycine tag, Gly(n), has a length of 1 to 21 glycine residues, preferably with a length of 3 to 5 amino acids, i.e., Gly.sub.(3), Gly.sub.(4), or Gly.sub.(5).
[0087] The synthetic molecule can be any molecule such as one targeting a tumor. In some embodiments, the synthetic molecule for conjugation to the antibody is a protein (e.g., an antibody) or an RNA or DNA aptamer. In one embodiment, the antibodies, antibody-based binding proteins or antibody fragments thereof of the invention conjugated to a synthetic molecule have the general formula A-(L-P).sub.n, in which: A is an antibody, antibody-based binding protein or antibody fragment thereof as described herein, L is one or more linkers, P is one or more payloads selected from the group consisting of a label and a cytotoxic or cytostatic agent, and in which n is an integer between ≥1 and ≤10. In this embodiment, the linker preferably comprises, or consists of, at least one selected from the group consisting of: an oligopeptide linker (including cleavable and non-cleavable oligopeptide linkers), a hydrazine linker, a thiourea linker, a self-immolative linker, a succinimidyl trans-4-(maleimidylmethyl)cyclohexane-1-carboxylate (SMCC) linker, a maleimide linker, a disulfide linker, a thioether linker, and/or a maleimide linker.
[0088] The skilled person understands that further linkers may be suitable. Such linkers may be non-cleavable or may be cleaved by changes in pH, redox potential or specific intracellular enzymes. Cleavable oligopeptide linkers include protease- or matrix metalloprotease-cleavable linkers. It is understood that the linker may comprise combinations of the above. For example, the linker may be a valine-citruline PAB linker. In a preferred embodiment, the linker comprises an oligopeptide with a sequence comprising the penta-peptide motif LPXSG (SEQ ID NO:137), LPXAG (SEQ ID NO:138), LPXTG (SEQ ID NO:139), LAXTG (SEQ ID NO:140), or NPQTG (SEQ ID NO:141) with X being any amino acid, followed by an oligo-glycine stretch, Gly.sub.(n), with n being an integer between ≥1 and ≤21. In a preferred embodiment, the linker is conjugated to the C-terminus of at least one subdomain of the antibody, antibody-based binding proteins or antibody fragments thereof.
[0089] In various embodiments, suitable synthetic molecules (“payloads”) for conjugation to the antibody include, e.g., therapeutic agents such as cytotoxic, cytostatic, or antiangiogenic agents, radioisotopes, and liposomes. A cytotoxic agent can be a plant, fungal, or bacterial molecule. In some embodiments, the cytotoxic agent for conjugation to the antibody of the invention is a small molecular weight toxin (MW<2′000 Dalton, preferably MW<1′000 Dalton), a peptide toxin, or a protein toxin. Many specific examples of these toxins are well known in the art. See, e.g., Dyba et al., Curr. Pharm. Des. 10:2311-34, 2004; Kuyucak et al., Future Med. Chem. 6:1645-58, 2014; Beraud et al., Inflamm. Allergy Drug Targets. 10:322-42, 2011; and Middlebrook et al., Microbiol. Rev. 48:199-221, 1984. In some embodiments, a therapeutic agent is conjugated to the antibody. For example, the therapeutic agent can be a maytansinoid (e.g., maytansinol or DM1 maytansinoid), a taxane, a calicheamicin, a cemadotin, a monomethylauristatin (e.g., monomethylauristatin E or monomethylauristatin F), a pyrrolobenzodiazepine (PBD), preferably an anthracycline, more preferably a derivative of the highly potent anthracycline PNU-159682. Particularly preferred derivatives of the highly potent anthracycline PNU-159682 are disclosed in WO2016102679 (which is incorporated by reference herein). Therapeutic agents also include vincristine and prednisone. In various embodiments, the therapeutic agent that may be employed in the invention can be an antimetabolite (e.g., an antifolate such as methotrexate, a fluoropyrimidine such as 5-fluorouracil, cytosine arabinoside, or an analogue of purine or adenosine); an intercalating agent an intercalating agent (for example, an anthracycline such as doxorubicin, nemorubicine, or preferably a derivative of PNU-159682), daunomycin, epirabicin, idarubicin, mitomycin-C, dactinomycin, or mithramycin, or other intercalating agents such as pyrrolobenzodiazepine); a DNA-reactive agent such as calicheamicins, tiancimycins, and other enediynes; a platinum derivative (e.g., cisplatin or carboplatin); an alkylating agent (e.g., nitrogen mustard, melphalan, chlorambucil, busulphan, cyclophosphamide, ifosfamide nitrosoureas or thiotepa); an RNA polymerase inhibitor such as α-amanitin; an antimitotic agent (e.g., a vinca alkaloid such as vincristine, or a taxoid such as paclitaxel or docetaxel); a topoisomerase inhibitor (for example, etoposide, teniposide, amsacrine, topotecan); a cell cycle inhibitor (for example, a flavopyridol); or a microbtubule agent (e.g., an epothilone, a tubulysine, a pre-tubulysine, a discodermolide analog, or an eleutherobin analog). A therapeutic agent can be a proteosome inhibitor or a topoisomerase inhibitor such as bortezomib, amsacrine, etoposide, etoposide phosphate, teniposide, or doxorubicin. Therapeutic radioisotopes include iodine (.sup.131I), yttrium (.sup.90Y), lutetium (.sup.177Lu), actinium (.sup.225Ac), praseodymium, astatine (At), rhenium (Re), bismuth (Bi or Bi), and rhodium (Rh). Antiangiogenic agents include linomide, bevacuzimab, angiostatin, and razoxane.
[0090] In a preferred embodiment, the synthetic toxin molecule is selected from PNU-159682 as described in Quintieri et al. (2005) and derivatives thereof (see formula (i) below), maytansine, monomethyl auristatin MMAE, and monomethyl auristatin MMAF. In a preferred embodiment, the toxin, joined to the linker at its wavy line, is of formula (i), as described in WO 2016102679 (which is incorporated by reference herein):
##STR00001##
[0091] In the embodiment where the synthetic molecule is of formula (i), it is preferred that the linker comprise an alkyldiamino group of the form NH.sub.2—(CH.sub.2).sub.m—NH.sub.2, where m≥1 and ≤11, preferably m=2, such that one amino group is directly linked at the wavy line of formula (i) to form an amide bond. It is moreover preferred that the second amino group is linked to an oligopeptide linker, which is more preferably an oligoglycine, Gly.sub.(n), with n being ≥1 and ≤21. The most preferred payload is shown in
[0092] In some embodiments, the synthetic molecule can be conjugated to any antibody, antibody-based binding protein, or antibody-fragment. In some embodiments, the synthetic molecule can be a label. Labels can be useful in diagnostic applications and can include, for example, contrast agents. A contrast agent can be a radioisotope label such as iodine (.sup.131I or .sup.125I) indium (.sup.111In), technetium (.sup.99Tc), phosphorus (.sup.32P), carbon (.sup.14C), tritium (.sup.3H), other radioisotope (e.g., a radioactive ion), or a therapeutic radioisotope such as one of the therapeutic radioisotopes listed above. Additionally, contrast agents can include radiopaque materials, magnetic resonance imaging (MRI) agents, ultrasound imaging agents, and any other contrast agents suitable for detection by a device that images an animal body. A synthetic molecule can also be a fluorescent label, a biologically active enzyme label, a luminescent label, or a chromophore label.
[0093] In some other embodiments, the synthetic molecule can be a liposome, as described in Bendas, BioDrugs, 15: 215-224, 2001. In such embodiments, the antibody can be conjugated to a colloidal particle, e.g., a liposome, and used for controlled delivery of an agent to diseased cells. In preparing an antibody conjugated to a liposome, e.g., an immunoliposome, an agent such as a chemotherapeutic or other drug can be entrapped in the liposome for delivery to a target cell. In some embodiments, the antibodies, antibody-based binding proteins or antibody fragments thereof of the invention can also have specificity for one or more antigens in addition to ROR2. For example, the antibody of the invention can be engineered (e.g., as a bivalent diabody or a conjugated Fab dimer or trimer) to have specificity for ROR2 and another tumor antigen, e.g., an antigen associated with neuroblastoma, renal cell carcinoma, breast cancer, gastric cancer, prostate cancer, colon cancer (e.g., colon adenocarcinoma), or breast cancer (e.g., breast adenocarcinoma). The antibody can be engineered to have specificity for ROR2 and an antigen that promotes activation or targeting of cytotoxic effector cells.
[0094] To further investigate the therapeutic utility of ROR2-targeting mAbs, chimeric antigen receptors (CARs) and CAR-T cells based on the mAbs were generated. Typically, the chimeric antigen receptor of the invention contains a hROR2 antibody or antibody fragment described herein that is fused to a transmembrane region and an intracellular T-cell receptor (TCR) signaling domain. CAR-T cells based on XBR2-401 were engineered using previously described methods (Hudecek, M, Lupo-Stanghellini, M T, Kosasih, P. L., Sommermeyer, D., Jensen, M C., Rader, C., and Riddell, S. R. (2013) Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T cells. Clin. Cancer Res. 19, 3153-3164). In brief, ex vivo expanded healthy donor CD8+CD62L+ T cells were lentivirally transduced with an EF1α promoter-driven expression cassette containing XBR2-401 in scFv format, followed by a short or long spacer, the transmembrane domain of human CD28, the signaling domain of 4-1BB, the signaling domain of CD3, and a T2A-separated transmembrane EGFR fragment with truncated ligand binding and tyrosine kinase domains. FACS isolation of EGFR+ transduced T cells, revealed robust anti-ROR2 recognition in >90% of CAR-T cells. The activity of the ROR2-targeting XBR2-401 CAR-T with short and long spacer against breast cancer cell lines T47D (ROR2+ROR1−) and MDA-MB-231 (ROR2−ROR1+). Since XBR2-401 binds to a membrane-proximal epitope in the Kr domain of ROR2, it is likely that XBR2-401 CAR-T cells are more active with a long rather than a short spacer. This was confirmed with respect to proliferation, IFN-γ and IL-2 secretion, and cytotoxicity in the presence of ROR2+ROR1—target cells (
IV. Polynucleotides, Vectors and Host Cells for Producing ROR2 Antibodies
[0095] The invention provides substantially purified polynucleotides (DNA or RNA) that are identical or complementary to sequences encoding polypeptides comprising segments or domains of the antibody, antibody-based binding protein or antibody fragment thereof chains described herein. In some embodiments, the polynucleotides of the invention encode the heavy chain or light chain domains sequences shown in
[0096] Also provided in the invention are polynucleotides which encode at least one CDR region and usually all three CDR regions from the heavy or light chain of the antibodies described herein. Some other polynucleotides encode all or substantially all of the variable region sequence of the heavy chain and/or the light chain of the exemplified antibodies. For example, some of these polynucleotides encode the amino acid sequence of the heavy chain variable region shown in any one SEQ ID NOs:1-12, and/or the amino acid sequence of the light chain variable region shown in any one SEQ ID NOs:13-24. Because of the degeneracy of the code, a variety of nucleic acid sequences will encode each of the immunoglobulin amino acid sequences.
[0097] The polynucleotides of the invention can encode only the variable region sequences of the exemplified antibodies. They can also encode both a variable region and a constant region of the antibody. Some of polynucleotide sequences of the invention nucleic acids encode a mature heavy chain variable region sequence that is substantially identical (e.g., at least 80%, 90%, 95% or 99%) to the mature heavy chain variable region sequence shown in any one SEQ ID NOs:1-12. Some other polynucleotide sequences encode a mature light chain variable region sequence that is substantially identical to the mature light chain variable region sequence shown in any one SEQ ID NOs:13-24. Some of the polynucleotide sequences encode a polypeptide that comprises variable regions of both the heavy chain and the light chain of one of the exemplified antibodies. Some other polynucleotides encode two polypeptide segments that respectively are substantially identical to the variable regions of the heavy chain or the light chain of one of the exemplified antibodies.
[0098] The polynucleotide sequences can be produced by de novo solid-phase DNA synthesis or by PCR mutagenesis of an existing sequence (e.g., sequences as described in the Examples below) encoding an exemplified functional antibody. Direct chemical synthesis of nucleic acids can be accomplished by methods known in the art, such as the phosphotriester method of Narang et al., Meth. Enzymol. 68:90, 1979; the phosphodiester method of Brown et al., Meth. Enzymol. 68:109, 1979; the diethylphosphoramidite method of Beaucage et al., Tetra. Lett., 22:1859, 1981; and the solid support method of U.S. Pat. No. 4,458,066. Introducing mutations to a polynucleotide sequence by PCR can be performed as described in, e.g., PCR Technology: Principles and Applications for DNA Amplification, H. A. Erlich (Ed.), Freeman Press, NY, NY, 1992; PCR Protocols: A Guide to Methods and Applications, Innis et al. (Ed.), Academic Press, San Diego, Calif., 1990; Mattila et al., Nucleic Acids Res. 19:967, 1991; and Eckert et al., PCR Methods and Applications 1:17, 1991.
[0099] Also provided in the invention are expression vectors and host cells for producing the functional antibodies described herein. Specific examples of plasmid and transposon based vectors for expressing the antibodies are described in the Examples below. Various other expression vectors can also be employed to express the polynucleotides encoding the functional antibody chains or binding fragments. Both viral-based and nonviral expression vectors can be used to produce the antibodies in a mammalian host cell. Nonviral vectors and systems include plasmids, episomal vectors, typically with an expression cassette for expressing a protein or RNA, and human artificial chromosomes (see, e.g., Harrington et al., Nat. Genet. 15:345, 1997). For example, nonviral vectors useful for expression of the antibody polynucleotides and polypeptides in mammalian (e.g., human) cells include pCEP4, pREP4, pThioHis A, B & C, pcDNA3.1/His, pEBVHis A, B & C (Invitrogen, San Diego, Calif.), MPSV vectors, and numerous other vectors known in the art for expressing other proteins. Other useful nonviral vectors comprise expression cassettes that can be mobilized with Sleeping Beauty, PiggyBack and other transposon systems. Useful viral vectors include vectors based on lentiviruses or other retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, vectors based on SV40, papilloma virus, HBP Epstein Barr virus, vaccinia virus vectors and Semliki Forest virus (SFV). See, Brent et al., supra; Smith, Annu. Rev. Microbiol. 49:807, 1995; and Rosenfeld et al., Cell 68:143, 1992.
[0100] The choice of expression vector depends on the intended host cells in which the vector is to be expressed. Typically, the expression vectors contain a promoter and other regulatory sequences (e.g., enhancers) that are operably linked to the polynucleotides encoding a functional antibody chain or fragment. In some embodiments, an inducible promoter is employed to prevent expression of inserted sequences except under inducing conditions. Inducible promoters include, e.g., arabinose, lacZ, metallothionein promoter or a heat shock promoter. Cultures of transformed organisms can be expanded under noninducing conditions without biasing the population for coding sequences whose expression products are better tolerated by the host cells. In addition to promoters, other regulatory elements may also be required or desired for efficient expression of a functional antibody chain or fragment. These elements typically include an ATG initiation codon and adjacent ribosome binding site (Kozak consensus sequence) or other sequences. In addition, the efficiency of expression may be enhanced by the inclusion of enhancers appropriate to the cell system in use (see, e.g., Scharf et al., Results Probl. Cell Differ. 20:125, 1994; and Bittner et al., Meth. Enzymol., 153:516, 1987). For example, the SV40 enhancer or CMV enhancer may be used to increase expression in mammalian host cells.
[0101] The expression vectors may also provide a secretion signal sequence position to form a fusion protein with polypeptides encoded by inserted functional antibody sequences. More often, the inserted functional antibody sequences are linked to a signal sequences before inclusion in the vector. Vectors to be used to receive sequences encoding the functional antibody light and heavy chain variable domains sometimes also encode constant regions or parts thereof. Such vectors allow expression of the variable regions as fusion proteins with the constant regions thereby leading to production of intact antibodies or fragments thereof. Typically, such constant regions are human, and preferably of human IgG1 antibodies.
[0102] The host cells for harboring and expressing the functional antibody chains can be either prokaryotic or eukaryotic. In some preferred embodiments, mammalian host cells are used to express and to produce the antibody polypeptides of the present invention. For example, they can be either a hybridoma cell line expressing endogenous immunoglobulin genes or a mammalian cell line harboring an exogenous expression vector. These include any normal mortal or normal or abnormal immortal animal or human cell. In addition to the cell lines exemplified herein, a number of other suitable host cell lines capable of secreting intact immunoglobulins are also known in the art. These include, e.g., the CHO cell lines, various HEK 293 cell lines, various Cos cell lines, HeLa cells, myeloma cell lines, transformed B-cells and hybridomas. The use of mammalian tissue cell culture to express polypeptides is discussed generally in, e.g., Winnacker, From Genes to Clones, VCH Publishers, N.Y., N. Y., 1987. Expression vectors for mammalian host cells can include expression control sequences, such as an origin of replication, a promoter, and an enhancer, and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. These expression vectors usually contain promoters derived from mammalian genes or from mammalian viruses. Suitable promoters may be constitutive, cell type-specific, stage-specific, and/or modulatable or regulatable. Useful promoters include, but are not limited to, EF 1α and human UbC promoters exemplified herein, the metallothionein promoter, the constitutive adenovirus major late promoter, the dexamethasone-inducible MMTV promoter, the SV40 promoter, the MRP pol III promoter, the constitutive MPSV promoter, the tetracycline-inducible CMV promoter (such as the human immediate-early CMV promoter), the constitutive CMV promoter, and promoter-enhancer combinations known in the art.
[0103] Methods for introducing expression vectors containing the polynucleotide sequences of interest vary depending on the type of cellular host. For example, calcium chloride transformation is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment or electroporation may be used for other cellular hosts (see generally Brent et al., supra). Other methods include, e.g., electroporation, calcium phosphate treatment, liposome-mediated transformation, injection and microinjection, ballistic methods, virosomes, immunoliposomes, polycation:nucleic acid conjugates, naked DNA, artificial virions, fusion to the herpes virus structural protein VP22 (Elliot and O'Hare, Cell 88:223, 1997), agent-enhanced uptake of DNA, and ex vivo transduction. For long-term, high-yield production of recombinant proteins, stable expression will often be desired. For example, cell lines which stably express the antibody chains or binding fragments can be prepared using expression vectors of the invention which contain viral origins of replication or endogenous expression elements and a selectable marker gene. Following introduction of the vector, cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media. The purpose of the selectable marker is to confer resistance to selection, and its presence allows growth of cells which successfully express the introduced sequences in selective media. Resistant, stably transfected cells can be proliferated using tissue culture techniques appropriate for the cell type.
[0104] The invention further provides eukaryotic or non-eukaryotic cells (e.g., T lymphocytes) that have been recombinantly engineered to produce the antibodies, antibody-based binding proteins or antibody fragments thereof of the invention. The eukaryotic or non-eukaryotic cells can be used as an expression system to produce the antibody of the invention. In some embodiments, the invention provides ROR2 targeted immune cells that are engineered to recombinantly express an ROR2 specific antibody of the invention. For example, the invention provides a T cell engineered to express an antibody of the invention (e.g., an scFv, scFv-Fc, or (scFv)2), which is linked to a synthetic molecule containing one or more of the following domains: a spacer or hinge region (e.g., a CD28 sequence or a IgG4 hinge-Fc sequence), a transmembrane region (e.g., a transmembrane canonical domain), and an intracellular T-cell receptor (TCR) signaling domain, thereby forming a chimeric antigen receptor (CAR) or T-body. Intracellular TCR signaling domains that can be included in a CAR (or T-body) include, but are not limited to, CD3ζ, FcR-γ, and Syk-PT signaling domains as well as the CD28, 4-1BB, and CD134 co-signaling domains. Methods for constructing T-cells expressing a CAR (or T-body) are known in the art. See, e.g., Marcu-Malina et al., Expert Opinion on Biological Therapy, Vol. 9, No. 5 (posted online on Apr. 16, 2009).
V. Therapeutic and Diagnostic Applications
[0105] In one aspect, the invention provides methods for inhibiting cells that express ROR2 (ROR2 cells) by contacting the cells with an antibody, antibody-based binding protein or antibody fragment thereof of the invention, or an antibody drug conjugate (ADC) or an engineered cell harboring a chimeric antigen receptor (CAR) described herein. The antibody, antibody-based binding protein or antibody fragment thereof can be a naked (unconjugated) molecule or an antibody molecule conjugated to a synthetic molecule, e.g., a cytotoxic, cytostatic, or antiangiogenic agent, a radioisotope, or even to a liposome. The method can be used to inhibit ROR2 cells in vitro or in a subject (i.e., in vivo). The contacted ROR2 cells can be in, for example, a cell culture or animal model of a disorder associated with elevated levels of ROR2. The methods are useful, for example, to measure and/or rank (relative to another antibody) the antibody's inhibitory activity for a specific ROR2 cell type. Inhibiting ROR2 cells can include blocking or reducing the activity or growth of ROR2 cells. Inhibiting can also include the killing of ROR2 cells. While the methods are not bound by or limited to any particular mechanism of action, inhibitory activity can be mediated by blocking ROR2-mediated signaling or by blocking the signaling of an ROR2 associated receptor. Inhibitory activity can also be mediated by recruitment of immune system effectors that attack ROR2 cells, e.g., by activating constituents of the antibody-dependent cell-mediated cytotoxicity (ADCC) or complement systems.
[0106] In some related embodiments, the invention provides methods for treating a subject that has, is suspected to have, or is at risk of developing a disorder associated with elevated levels of ROR2. Generally, the methods include administering a pharmaceutical composition that contains a therapeutically effective amount of an isolated antibody, antibody-based binding protein, antibody fragment thereof, ADC or CAR of the invention to the subject. The antibody can be any anti-ROR2 antibody of the invention as described herein. Thus, the antibody can be chimeric, humanized, synthetic, F(ab)2, Fv, scFv, IgGACH2, F(ab′)2, scFv2CH3, Fab, VL, VH, scFv4, scFv3, scFv2, dsFv, Fv, or (scFv)2. In some embodiments, the method includes administering an IgG, an scFv, a dsFv, a F(ab′)2, a diabody, or a bivalent antibody. The administered antibody or antigen-binding fragment can be conjugated to a synthetic molecule described above, e.g., a cytotoxic, cytostatic, or antiangiogenic agent, a therapeutic radioisotope, or a liposome. An exemplary cytotoxic agent is Pseudomonas exotoxin A (PE38). Disorders that can be treated include neuroblastoma, osteosarcoma, renal cell carcinoma, breast cancer, gastric cancer, prostate cancer, melanoma, squamous cell carcinoma, multiple myeloma and other disorders with elevated ROR2 expression.
[0107] In some embodiments, the invention provides methods for treating a subject that has, is suspected to have, or is at risk of developing a disorder associated with expression of ROR2 by adoptive transfer of the genetically engineered T-cells described herein, which express an antibody or antigen-binding fragment of the invention as a chimeric antigen receptor (CAR) that selectively binds ROR2. Recombinant technology can be used to introduce CAR-encoding genetic material into any suitable T-cells, e.g., central memory T-cells from the subject to be treated. The T-cells carrying the genetic material can be expanded (e.g., in the presence of cytokines). The genetically engineered T-cells are transferred, typically by infusion, to the patient. The transferred T-cells of the invention can then mount an immune response against ROR2 expressing cells in the subject. The adoptive transfer method can be used, for example, to treat subjects that have or are suspected to have any of the cancers associated with ROR2, including neuroblastoma, osteosarcoma, renal cell carcinoma, breast cancer, gastric cancer, prostate cancer, melanoma, squamous cell carcinoma, multiple myeloma and other cancers.
[0108] In some embodiments, the foregoing methods of treatment can further include coadministering a second therapeutic agent for treating the disorder associated with elevated ROR2. For example, when the disorder to be treated involves an ROR2-expressing cancer, the method can further include co-administration of a cytotoxic, cystostatic, or antiangiogenic or immune-stimulatory agent (e.g. immune-checkpoint inhibitor antibodies, for instance, but not limited to, those binding to PD1, PDL1, CTLA4, OX40, TIM3, GITR, LAG3 and the like) suitable for treating the cancer. If the cancer is a B-cell malignancy, the method can further include, for example, co-administration of rituximab, alemtuzumab, ofatumumab, ocrelizumab, or a CHOP chemotherapeutic regimen.
[0109] In some other embodiments, the invention provides method for detecting in a biological sample an altered level of ROR2 (e.g., cell surface ROR2), for example, relative to a control, either by FACS, immunohistochemistry (IHC) or Western Blotting. Generally, the method includes contacting a biological sample with an antibody, antibody-based binding protein, antibody fragment thereof of the invention and determining the amount of antibody that selectively binds to material (e.g., cells) in the sample to thereby determine the level of ROR2 in the biological sample. A biological sample can be from a cell culture or from a test subject, e.g., a plasma or a tissue sample from a subject that has, is suspected to have, or is at risk of developing a disease or condition associated with elevated ROR2 in a subject. A control level desirably corresponds to the ROR2 level detected using the same antibody in a corresponding sample(s) from one or more control cultures or disease-free subjects. Methods of using the antibody of the invention to determine ROR2 levels can include any immunoassay such as immuno-(Western) blotting, enzyme-linked immunosorbent assay (ELISA), Immunohistochemistry (IHC) and flow cytometry, e.g., fluorescence-activated cell sorting (FACS) analysis.
[0110] The methods of detection can be used to screen for the presence of a disorder associated with elevated ROR2. The methods include obtaining a sample from a test subject in need of screening, e.g., a subject that has, is suspected to have, or is at risk of developing a disorder associated with elevated ROR2. The level of ROR2 (e.g., the amount or concentration) in the sample is measured using an antibody, antibody-based binding protein, antibody fragment thereof of the invention, and the level in the sample is compared to a control level of ROR2. The control level represents, for example, the mean level (e.g., the amount or concentration) in sample(s) from one or, preferably, multiple control group subjects that do not have a disorder associated with elevated ROR2. Alternatively, the control level can correspond to the level or mean level of ROR2 in one or more samples taken from the test subject at one or more prior times, such as when the test subject did not have or did not exhibit, a condition associated with elevated ROR2. A significantly higher level of ROR2 in the biological sample relative to the control level is indicative of a disorder associated with elevated ROR2 in the subject. In subjects such as humans, where cell surface ROR2 expression is largely restricted to embryonic development, a control level of ROR2 can be zero or none. Thus, in some embodiments of the method of the detection provided by the invention, any significant and detectable amount of ROR2 in a biological sample can be indicative of a disorder associated with elevated ROR2 in the subject.
[0111] Additionally, the methods of detection can be used to monitor the progress of a disorder associated with elevated ROR2. The method includes obtaining a sample from a subject in need of screening, e.g., a subject having been diagnosed or suspected to have a disorder associated with elevated ROR2. The level of ROR2 in the sample is measured using an antibody, antibody-based binding protein, antibody fragment thereof of the invention, and the level in the sample is compared to a control level corresponding to the level or mean level of ROR2 in one or more samples taken from the test subject at one or more prior times. Levels of ROR2 that are significantly elevated or decreased relative to control indicate that the subject's disorder is deteriorating or improving, respectively. The foregoing methods of detection can be used to screen for the presence or to monitor the progress of disorders including, for example, neuroblastoma, osteosarcoma, renal cell carcinoma, breast cancer, gastric cancer, prostate cancer, melanoma, squamous cell carcinoma, multiple myeloma and other cancers.
[0112] In some embodiments, the invention provides methods for screening a subject for an altered level of ROR2. Generally, the methods entail administering to the subject an antibody, antibody-based binding protein, antibody fragment thereof of the invention that is conjugated to a label (e.g., a contrast agent), imaging the subject in a manner suitable for detecting the label, and determining whether a region in the subject has an altered density or concentration of label as compared to the background level of label in proximal tissue. Alternatively, the methods include determining whether there is an altered density or concentration of label in a region as compared to the density or concentration of label previously detected in the same region of the subject. Methods of imaging a subject can include x-ray imaging, x-ray computed tomography (CT) imaging (e.g., CT angiography (CTA) imaging), magnetic resonance (MR) imaging, magnetic resonance angiography (MRA), nuclear medicine, ultrasound (US) imaging, optical imaging, elastography, infrared imaging, microwave imaging, and the like, as appropriate for detecting the label conjugated to the antibody. In a preferred embodiment, the subject has, is suspected to have, or is at risk of developing an ROR2-expressing tumor, such as neuroblastoma, osteosarcoma, renal cell carcinoma, breast cancer, gastric cancer, prostate cancer, melanoma, squamous cell carcinoma, multiple myeloma and other cancers., and the method is used to screen for or detect the presence of the tumor. In another embodiment, the method can be used to monitor the size or density of a ROR2-expressing tumor over time, e.g., during a course of treatment.
VI. Pharmaceutical Compositions and Combinations
[0113] In another aspect, the invention provides pharmaceutical compositions that contain an antibody, an antibody fragment, an antibody-based binding protein, or an ADC as described herein and a pharmaceutically acceptable carrier. Pharmaceutical compositions can be prepared from any of the antibodies or related compounds described herein. Exemplary compositions include one or more of a chimeric antibody having SEQ ID NO:13 (light chain) and/or SEQ ID NO:1 (heavy chain), a chimeric antibody having SEQ ID NO:14 (light chain) and/or SEQ ID NO:2 (heavy chain), and a chimeric antibody having SEQ ID NO:15 (light chain) and/or SEQ ID NO:3 (heavy chain). Other antibodies, antibody fragments, antibody-based binding proteins, or ADCs suitable for the pharmaceutical compositions of the invention include those having a light chain sequence as shown in SEQ ID NOs:16-24 and/or a heavy chain sequence as shown in SEQ ID NOs:4-12. Other exemplary compositions of the invention can contain a humanized antibody having one, two, three, four, five, or six CDRs selected from the group consisting of SEQ ID NOs:25-96. In some embodiments, however, the antibody includes three CDR sequences of the same exemplified light or heavy chains shown in
[0114] In some embodiments, the compositions of the invention contain a carrier for the antibody, the antibody fragment, the antibody-based binding protein or the ADC, desirably a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier can be any suitable pharmaceutically acceptable carrier. It can be one or more compatible solid or liquid fillers, diluents, other excipients, or encapsulating substances which are suitable for administration into a human or veterinary patient (e.g., a physiologically acceptable carrier or a pharmacologically acceptable carrier). The term “carrier” denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the use of the active ingredient, e.g., the administration of the active ingredient to a subject. The pharmaceutically acceptable carrier can be co-mingled with one or more of the active components, e.g., a hybrid molecule, and with each other, when more than one pharmaceutically acceptable carrier is present in the composition, in a manner so as not to substantially impair the desired pharmaceutical efficacy. Pharmaceutically acceptable materials typically are capable of administration to a subject, e.g., a patient, without the production of significant undesirable physiological effects such as nausea, dizziness, rash, or gastric upset. It is, for example, desirable for a composition comprising a pharmaceutically acceptable carrier not to be immunogenic when administered to a human patient for therapeutic purposes.
[0115] Pharmaceutical compositions of the invention can additionally contain suitable buffering agents, including, for example, acetic acid in a salt, citric acid in a salt, boric acid in a salt, and phosphoric acid in a salt. The compositions can also optionally contain suitable preservatives, such as benzalkonium chloride, chlorobutanol, parabens, and thimerosal. Pharmaceutical compositions of the invention can be presented in unit dosage form and can be prepared by any suitable method, many of which are well known in the art of pharmacy. Such methods include the step of bringing the antibody of the invention into association with a carrier that constitutes one or more accessory ingredients. In general, the composition is prepared by uniformly and intimately bringing the active agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product.
[0116] A composition suitable for parenteral administration conveniently comprises a sterile aqueous preparation of the inventive composition, which preferably is isotonic with the blood of the recipient. This aqueous preparation can be formulated according to known methods using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation also can be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example, as a solution in 1,3-butane diol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed, such as synthetic mono- or di-glycerides. In addition, fatty acids such as oleic acid can be used in the preparation of injectables. Carrier formulations suitable for oral, subcutaneous, intravenous, intramuscular, etc. administrations can be found in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa.
[0117] Preparation of pharmaceutical compositions of the invention and their various routes of administration can be carried out in accordance with methods well known in the art. See, e.g., Remington: The Science and Practice of Pharmacy, Mack Publishing Co., 20.sup.th ed., 2000; and Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978. The delivery systems useful in the context of the invention include time-released, delayed release, and sustained release delivery systems such that the delivery of the inventive composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. The inventive composition can be used in conjunction with other therapeutic agents or therapies. Such systems can avoid repeated administrations of the inventive composition, thereby increasing convenience to the subject and the physician, and may be particularly suitable for certain compositions of the invention.
[0118] Many types of release delivery systems are available and known to those of ordinary skill in the art. Suitable release delivery systems include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075,109. Delivery systems also include non-polymer systems that are lipids including sterols such as cholesterol, cholesterol esters, and fatty acids or neutral fats such as mono-di- and triglycerides; hydrogel release systems; sylastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosional systems in which the active composition is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775, 4,667,014, 4,748,034, and 5,239,660 and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Pat. Nos. 3,832,253 and 3,854,480. In addition, pump-based hardware delivery systems can be used, some of which are adapted for implantation.
[0119] The invention also provides kits suitable for carrying out the methods of the invention. Typically, the kits contain two or more components required for performing the therapeutic or diagnostic methods of the invention. Kit components include, but are not limited to, one or more antibodies, antibody-based binding proteins, antibody fragments thereof, or ADCs of the invention, appropriate reagents, and/or equipment. In some embodiments, the kits can contain an antibody, antibody-based binding protein, antibody fragment thereof, or ADC of the invention and an immunoassay buffer suitable for detecting ROR2 (e.g. by ELISA, flow cytometry, magnetic sorting, or FACS). The kit may also contain one or more microtiter plates, standards, assay diluents, wash buffers, adhesive plate covers, magnetic beads, magnets, and/or instructions for carrying out a method of the invention using the kit. The kit scan include an antibody, antibody-based binding protein, antibody fragment thereof of the invention bound to a substrate (e.g., a multi-well plate or a chip), which is suitably packaged and useful to detect ROR2. In some embodiments, the kits include an antibody, antibody-based binding protein, antibody fragment thereof of the invention that is conjugated to a label, such as, a fluorescent label, a biologically active enzyme label, a luminescent label, or a chromophore label. The kits can further include reagents for visualizing the conjugated antibody, antibody-based binding protein, antibody fragment thereof, e.g., a substrate for the enzyme. In some embodiments, the kits include an antibody or antigen-binding fragment of the invention that is conjugated to a contrast agent and, optionally, one or more reagents or pieces of equipment useful for imaging the antibody, antibody-based binding protein, antibody fragment thereof in a subject.
[0120] Generally the antibody, antibody-based binding protein, antibody fragment thereof or ADC of the invention in a kit is suitably packaged, e.g., in a vial, pouch, ampoule, and/or any container appropriate for a therapeutic or detection method. Kit components can be provided as concentrates (including lyophilized compositions), which may be further diluted prior to use, or they can be provided at the concentration of use. For use of the antibody of the invention in vivo, single dosages may be provided in sterilized containers having the desired amount and concentration of components.
EXAMPLES
[0121] The following examples are provided to further illustrate the invention but not to limit its scope. Other variants of the invention will be readily apparent to one of ordinary skill in the art and are encompassed by the appended claims.
Example 1. Generation of Human ROR2-Specific Monoclonal Antibodies
[0122] Cell lines: MDA-MB-231 and T47D from ATCC were cultured in DMEM (Invitrogen; Carlsbad, Calif.) supplemented with 10% (v/v) heat inactivated FBS (Thermo Scientific; Logan, Utah), 100 U/mL penicillin, and 100 μg/mL streptomycin (Invitrogen). Mouse pre-B cells 63-12 (Shinkai et al., Cell 68, 855-867, 1992), as well as the 63-12 cells ectopically expressing hROR1 or hROR2, were cultured in IMEM (Invitrogen) supplemented with 10% (v/v) heat inactivated FBS (Thermo Scientific), 0.1% (v/v) beta-ME, 100 U/mL penicillin, and 100 μg/mL streptomycin (Invitrogen). HEK 293F cells were purchased from Invitrogen and maintained in FreeStyle Medium supplemented with 1% (v/v) heat inactivated FBS (Thermo Scientific), 100 U/mL penicillin, and 100 μg/mL streptomycin (Invitrogen).
[0123] Cloning of full-length hROR2 mammalian expression vectors: Transposable vector backbones (pPB-Puro) were assembled from modular parts with flanking restriction sites that were synthesized or derived from sequence-verified commercially available vectors, and are described in detail in Patent WO2014013026A1. These original transposable vector backbones were modified by exchanging IRES-driven expression of the Puromycin resistance gene in the original vector with separate, phosphoglycerate kinase promoter (PGK) driven expression. This was done by replacing the IRES sequence with an SV40-pA sequence located 3′ of the multiple cloning site, followed by introduction of the PGK-promoter sequence 5′ of the Puromycin resistance gene. Full-length ROR2 open reading frames were synthesized by total gene synthesis (Genscript, Piscataway) with flanking restriction sites (5′NotI/3′BstBI) and were then cloned into the multiple cloning site of the transposable vectors using the respective restriction enzymes.
[0124] Cell line engineering for ectopic expression of hROR2 in the EMT-6 murine breast cancer cell line: Murine EMT-6 breast cancer cells (kind gift from Prof. Dr. med. Alfred Zippelius, University Hospital of Basel, Switzerland) were cultured in DMEM complete (Dulbecco's Modified Eagle Medium (DMEM) High Glucose (4.5 g/l) with L-Glutamine with 10% (v/v) Fetal Calf Serum (FCS), 100 IU/mL of Pen-Strep-Fungizone and 2 mM L-glutamine (all Bioconcept, Allschwil, Switzerland)) at 37° C. and 5% CO.sub.2. Cells were engineered to overexpress human ROR2 by transposition as follows: cells were centrifuged (6 min, 1200 rpm, 4° C.) and resuspended in RPMI-1640 media (5×10.sup.6 cells/mL). 400 μL of this cell suspension was then added to 400 μL of RPMI containing 13.3 μg of transposable vector pPB-PGK-Puro-ROR2, directing co-expression of full-length human ROR2 (NP_004551.2) and the puromycin-resistance gene, and 6.6 μg of transposase-containing vector pCDNA3.1_hy_mPB. DNA/EMT-6 cell mixture was transferred to electroporation cuvettes (0.4 cm-gap, 165-2088, BioRad, Cressier, Switzerland) and electroporated using the Biorad Gene Pulser II with capacitance extender at 300V and 950 μF. Then, cells were incubated for 5-10 min at room-temperature. Following the incubation, cells were centrifuged at 1200 rpm for 6 min, washed once and subsequently resuspended in DMEM complete prior to incubation at 37° C. in a humidified incubator at 5% CO2 atmosphere. One day after electroporation, cell pools stably expressing human ROR2 were selected by adding 3 μg/mL puromycin (Sigma-Aldrich, P8833).
[0125] ROR2 expression on selected EMT-6-ROR2 cells was confirmed by flow cytometry. Briefly, following trypsinization, 10.sup.6 cells were centrifuged in FACS tubes; obtained pellets were resuspended in buffer (PBS with 2% (v/v) FCS). Cells were then incubated with XBR2-401 (mAb003); 30 min, 4° C., final concentration 2 μg/mL), followed by centrifugation and washing. Cells were then resuspended as previously and incubated with anti-human IgG antibody (Fc gamma-specific) PE (eBioscience, Vienna, Austria, 12-4998-82) with a 1:250 dilution in the dark (30 min, 4° C.), washed once in buffer and kept on ice until FACS sorting.
[0126] Using a FACS Aria II, cells were single cell sorted into a 96-well flat-bottom plate containing 200 μL of DMEM complete per well. This plate was incubated at 37° C. and clones were expanded to 6-well plates before analysis of ROR2-expression by flow cytometry as outlined above, using a FACSCalibur instrument (BD Biosciences) and FlowJo analytical software (Tree Star, Ashland, Oreg.) for analysis.
Example 2. Generation of High-Complexity Rabbit Fab Library and Reagents for Screening
[0127] Construction, expression, purification, and biotinylation of recombinant human ROR2 protein hFc-hROR2-T.sup.245: A human ROR2 cDNA from Thermo Scientific (Clone ID: 40/46553) was used as template. ROR2 has a single nucleotide polymorphism (SNP) at amino acid position 245. As part of the cloning, we mutated the less common alanine at position 245 of clone 40/46553 to the more frequent threonine. Briefly, two cDNA fragments encoding N-terminal and C-terminal portions of the extracellular domain (ECD) of ROR2 were PCR-amplified with (i) primers hROR2ECD_F (gcctaagcttgtctccgggtgccgaagtggaggttctggatccgaacg) (SEQ ID NO:97) and hROR2_A245T_R (gctcacgcggcttgggtgtccgggagcgcgcgtcgc) (SEQ ID NO:98) and (ii) primers hROR2_A245T_F (gcgacgcgcgctcccggacacccaagccgcgtgagc) (SEQ ID NO:99) and hROR2ECD_R (agctctcgagtcaccccatcttgctgctgtctcggggactacacgagg) (SEQ ID NO:100). Subsequently, the whole ROR2 ECD (amino acids 55-394) was assembled by overlap extension PCR using the flanking primers hROR2ECD_F and hROR2ECD_R and cloned into pCEP4-hFc (Hofer et al., 2008) via HindIII/XhoI. The resulting pCEP4-hFc-hROR2 construct was then transiently transfected into HEK 293F cells (Invitrogen) using 293fectin (Invitrogen) and conditions detailed in the manufacturer's protocol. Transfected cells were cultured in FreeStyle protein-free medium (Invitrogen) and the hFc-hROR2 fusion protein was purified from supernatants by Protein A affinity chromatography. Purified hFc-hROR2 was biotinylated using the Biotin-Tag Micro Biotinylation kit (Sigma-Aldrich). Briefly, 300 μg hFc-hROR2 in 50 μL of 0.1 M sodium phosphate buffer (pH 7.2) was incubated with 1 μL of 5 mg/mL biotinamidohexanoic acid 3-sulfo-N-hydroxysuccinide ester for 30 min at room temperature with gentle stirring. Biotinylated hFc-hROR2 was isolated using MicroSpin G-50 Columns provided by the kit.
[0128] Construction, expression, and purification of recombinant human ROR1 (hROR1-His) and human ROR2 (hROR2-His) proteins: hROR1-His was PCR-amplified with primers SP-hROR1_F (5′ gctgggtaccggcgcgccaccatggactggacttggagaatcctgtttctcgtagctgctgcaactggagcacactccgcccgggg cgccgccgcccag 3′) (SEQ ID NO:101) and hROR1-His_R (5′ cggcctcgagtcagtgatggtgatggtggtgctccatcttgttcttctcctt 3′) (SEQ ID NO:102) using pCEP4-hFc-hROR1 (Yang et al., 2011) as template, while hROR2-His was PCR-amplified with primers SP-hROR2_F (gctgggtaccggcgcgccaccatggactggacttggagaatcctgtttctcgtagctgctgcaactggagcacactccgaagtgga ggttctggatccg) (SEQ ID NO:103) and hROR2-His_R (cggcctcgagtcagtgatggtgatggtggtgccccatcttgctgctgtctcg) (SEQ ID NO:104) using pCEP4-hFc-hROR2 as template. Following cloning into pCEP4 (Invitrogen) separately via KpnI/XhoI, the constructs were transiently transfected into HEK 293F cells (Invitrogen) using 293fectin (Invitrogen), and the corresponding recombinant protein products were purified by Immobilized Metal Ion Affinity Chromatography using a 1-mL HisTrap column (GE Healthcare) as described (Kwong and Rader, 2009). The quality and quantity of purified hROR1-His and hROR2-His were analyzed by SDS-PAGE and A280 absorbance, respectively.
[0129] Generation and selection of naïve chimeric rabbit/human Fab libraries: All rabbit handling was carried out by veterinary personnel at Pocono Rabbit Farm & Laboratory (Canadensis, PA) or R & R Research (Stanwood, Wash.). A total of nine rabbits (ages 3-4 months) were used. Five of these rabbits were of the New Zealand White (NZW) strain, with three obtained from Pocono Rabbit Farm & Laboratory (Canadensis, PA) and two obtained from R & R Research (Stanwood, Wash.). Four b9 wild-type rabbits were derived from a separate R & R Research colony that originated from a pedigreed colony developed and characterized at the National Institute of Allergy and Infectious Diseases (NIAID) (McCartney-Francis et al., 1984; Popkov et al., 2003). Spleen and bone marrow from each rabbit were collected and processed for total RNA preparation and RT-PCR amplification of rabbit V.sub.κ, V.sub.λ, and V.sub.H encoding sequences using established protocols (Rader, 2009). Rabbit (rb) V.sub.κ/human (hu) C.sub.κ/rbV.sub.H and rbV.sub.λ/huC.sub.λ/rbV.sub.H segments, respectively, were assembled in one fusion step based on 3-fragment overlap extension PCR. Note that the V.sub.L derived from b9 rabbits were also assembled with V.sub.H from NZW rabbits. The Fab-encoding fragments were digested with SfiI and ligated with SfiI-treated phage display vector pC3C (Hofer et al., 2007) at 16° C. for 24 h. Subsequently, 15 μg purified pC3C-rbV.sub.λ/hC.sub.κ/rbV.sub.H ligated products were transformed into E. coli strain SR320 (a kind gift from Dr. Sachdev S. Sidhu, University of Toronto, Toronto, Ontario, Canada) by 30 separate electroporations (each using 0.5 μg DNA in 50 μl electrocompetent cells) and yielded 7.5×10.sup.9 independent transformants for library κ. For library λ, 4.8×10.sup.9 independent transformants were obtained using the same procedure. Using VCSM13 helper phage (Stratagene; La Jolla, Calif.), the phagemid libraries were converted to phage libraries and stored at −80° C. Phage library κ and library λ were re-amplified using XL1-Blue (Stratagene) or ER2738 (Lucigen) and mixed equally before four rounds of panning against biotinylated hFc-hROR2. During the panning, 5 μg/mL antigen was pre-incubated with streptavidin coated magnetic beads (Dynabeads MyOne Streptavidin C1; Invitrogen) at 37° C. for 30 min and then binders from the phage library were captured in the presence of 1 mg/mL unspecific polyclonal human IgG (Thermo Scientific). Starting from the third round of panning, the input phage was negatively depleted by incubation with empty beads before selection against antigen-loaded beads. Following selection, supernatants of IPTG-induced bacterial clones were analyzed by ELISA and by flow cytometry. Repeated clones were identified by DNA fingerprinting with AluI, and the V.sub.L and V.sub.H sequences of unique clones were determined by DNA sequencing (
Example 3. Expression and Purification of Chimeric Rabbit/Human Fab and Full-Length IgG1 Antibodies
[0130] Construction, expression, and purification of chimeric rabbit/human Fab and IgG1: MAbs XBR2-401, XBR2-416, and XBR2-433 in chimeric rabbit/human Fab format were cloned into E. coli expression plasmid pC3C-His and expressed and purified as described (Kwong and Rader, 2009). For the expression of mAbs XBR2-401, XBR2-416, and XBR2-433 in chimeric rabbit/human IgG1 format, the previously described vector PIGG-R11 was used (Yang et al., 2011). The various primer sequences used in the expression are shown in Table 1. The V.sub.H encoding sequences of Fab XBR2-401, XBR2-416, and XBR2-433 were PCR amplified using primers 4-1_VH_F and 4-1_VH_R, 4-16_VH_F and 4-16_VH_R, and 4-33_VH_F and 4-33_VH_R, respectively, and cloned via ApaI/SacI into PIGG-R11. The light chain encoding sequences of Fab 4-1, 4-16, and 4-33 were PCR amplified using primers 4-1_κ_F, 4-16_κ _F, and 4-33_λ_F, respectively, in combination with LEAD-B, and cloned via HindIII/XbaI into PIGG-R11 with the corresponding heavy chain encoding sequences. Note that an internal ApaI site in FR4 of V.sub.H encoding sequences of Fab XBR2-401 was removed by silent mutation in primer 4-1_VH_R. In addition, for, XBR2-416, and XBR2-433, we changed a TAG stop codon, which was suppressed during selection in E. coli strain XL1-Blue, to CAG (glutamine) encoding the first amino acid of native V.sub.H of both, XBR2-416, and XBR2-433 (
[0131] All the other mAbs in chimeric rabbit/human Fab format were cloned into E. coli expression plasmid pET11a and expressed and purified as described (Kwong and Rader, 2009) For the expression of mAbs ERR2-302, ERR2-308, ERR2-317, XBR2-327 and XBR2-TOP72 in chimeric rabbit/human IgG1 format, pCEP4 (Invitrogen) was used to clone the heavy chain and light chain separately. For heavy chain, a gBlock containing a heavy-chain signal peptide encoding sequence, V.sub.H of ERR2-302 and C.sub.H1 (1-49) of human IgG1 was synthesized by IDT (San Jose, Calif.) and amplified with primers KpnI/AscI-Signal and CH1-internal/overlap-R, and fused to C.sub.H1 (50-88)-C.sub.H2-C.sub.H3 amplified from PIGG with primers CH1-internal/overlap-F and HC—CH3-R-XhoI by overlap extension PCR with primers KpnI/AscI-Signal and HC—CH3-R-XhoI, and then cloned into pCEP4 by AscI/XhoI. Note that a NheI site was introduced into C.sub.H1 at Ala.sup.12 by synonymous mutation when the gBLOCK was synthesized. This construct served as vector to clone other mAb heavy chain by replacing the V.sub.H using AscI/NheI: V.sub.H of ERR2-308, ERR2-317, XBR2-327 and XBR2-TOP72 were amplified with forward primer ERR2-308 HC-F, ERR2-317 HC-F, XBR2-327 and ERR2-308 HC-F and reverse primer VH-CH1-R-EheI separately, followed by extension PCR to add the signal peptide with primer KpnI/AscI-Signal and VH-CH1-R-EheI. Then each V.sub.H was inserted into the vector by AscI/NheI. For light chain cloning, while lambda light chains of ERR2-302 and XBR2-TOP72 were amplified with primers ERR2-302 LC-F and XBR2-TOP72 LC-F separately combined with primer LC—R-XhoI, kappa light chains of ERR2-308, ERR2-317 and XBR2-327 were amplified with primers ERR2-308 KC-F, ERR2-317 KC-F and ERR2-317 KC-F separately combined with primer KC—R-XhoI. Then signal peptide was added by extension PCR with forward primer KpnI/AscI-Signal and reverse primer LC—R-XhoI or KC—R-XhoI. Subsequently, each light chain PCR products was cloned into pCEP4 by AscI/XhoI. The resulting constructs containing heavy chain or light chain for each IgG were co-transfected transiently into HEK 293F cells (Invitrogen) using 293fectin (Invitrogen), and the corresponding recombinant protein products were purified with a 1-mL recombinant Protein A HiTrap column (GE Healthcare, Piscataway, N.J.) as described (Yang et al., 2011; Yang and Rader, 2012). The quality and quantity of purified IgG1 were analyzed by SDS-PAGE and A.sub.280 absorbance, respectively.
TABLE-US-00001 TABLE 1 Primer sequences for cloning antibody sequences SEQ ID Primer Sequence NO: 4-1_VH_F GAGGAGGAGCTCACTC 105 TCAGTCAGTGAAGGAG TCCGAGGGAG 4-1_VH_R CGATGGGCCCTTGGTG 106 GAGGCTGAAGAGACGG TGACGAGGGTCCCTGG TCCCCAGATGTT 4-16_VH_F GAGGAGGAGCTCACTC 107 TCAGGAGCAGCTGGAG GAGTCCGGG 4-16_VH_R CGATGGGCCCTTGGTG 108 GAGGCTGAGGAGATGG TGACCAGGGTGCCTGG CCCCCACAAGTC 4-33_VH_F GAGGAGGAGCTCACTC 109 TCAGTCAGTGAAGGAG TCCGAGGGA 4-33_VH_R CGATGGGCCCTTGGTG 110 GAGGCTGAGGAGATGG TGACCAGGGTGCCTGG CCCCCAGATGTT 4-1_κ_F GAGAAGCTTGTTGCTC 111 TGGATCTCTGGTGCCT ACGGGGACCCTATGCT GACCCAGACTCC 4-16_κ_F GAGAAGCTTGTTGCTC 112 TGGATCTCTGGTGCCT ACGGGCAAGTGCTGAC CCAGACTCCATC 4-33_λ_F GAGAAGCTTGTTGCTC 113 TGGATCTCTGGTGCCT ACGGGTCCTTCGTGCT GACTCAGCCAGC LEAD-B GGCCATGGCTGGTTGG 114 GCAGC KpnI/AscI- GGTACCGGCGCGCCAC 115 Signal CATGGACTGGACTTGG AGAATCCTGTTTCTCG TAGCTGCTGCAA CH1- GCCGCTGGTCAGGGCT 116 internal/ CCTG overlap-R CH1- CAGGAGCCCTGACCAG 117 internal/ CGGC overlap-F HC-CH3- GGCCTCGAGTCATTTA 118 R-XhoI CCCGGAGACAGGGA ERR2-308 TTTCTCGTAGCTGCTG 119 HC-F CAACTGGAGCACACTC CCAGGAGCAGCTGGAG GAGTCC ERR2-317 TTTCTCGTAGCTGCTG 120 HC-F CAACTGGAGCACACTC CCAGTCGTTGGAGGAG TCCGGG XBR2-327 TTTCTCGTAGCTGCTG 121 HC-F CAACTGGAGCACACTC CCAGGAGCAGCTGAAG GAGTCC VH-CH1- GGAGGGCGCCAGGGGG 122 R-EheI AAGACCGATGGGCCCT TGGT ERR2-302 TTTCTCGTAGCTGCTG 123 LC-F CAACTGGAGCACACTC CTCCTATGAGCTGACA CAGCTG XBR2-TOP72 TTTCTCGTAGCTGCTG 124 LC-F CAACTGGAGCACACTC CCAGTTTGTGCTGACT CAGTCG ERR2-308 TTTCTCGTAGCTGCTG 125 KC-F CAACTGGAGCACACTC CGACCCTATGCTGACC CAGACT ERR2-317 TTTCTCGTAGCTGCTG 126 KC-F CAACTGGAGCACACTC CGACCCTGTGCTGACC CAGACT LC-R-XhoI GGCCTCGAGTTATGAA 127 CATTCTGTAGGGGC KC-R-XhoI. GGCCTCGAGTTAACAC 128 TCTCCCCTGTTGAA
Example 4. Examination of Antibody Binding Activities
[0132] ELISA: Binding properties of the ROR2 antibodies were examined via ELISA. For coating, each well of a 96-well Costar 3690 plate (Corning, Corning, N.Y.) was incubated with 100 ng antigen in 25 μL coating buffer (0.1 M Na.sub.2CO.sub.3, 0.1 M NaHCO.sub.3, pH 9.6) for 1 h at 37° C. After blocking with 150 μL 3% (w/v) BSA/TBS for 1 h at 37° C., 100 ng/50 μL of Fab was added, incubated for 2 h at 37° C., washed with 150 μL PBS ten times and incubated with 50 μL of a 1:1000 dilution of a mouse anti-His tag mAb conjugated to horse radish peroxidase (HRP) (R&D Systems, Minneapolis, Minn.) in 1% (w/v) BSA/TBS for 1 h at 37° C. Washing with PBS was repeated and colorimetric detection was performed using 2,2′-azino-bis (3-ethylbenzthiazoline)-6-sulfonic acid (Roche) as substrate according to the manufacturer's directions. The absorbance was measured at 405 nm using a SpectraMax M5 microplate reader (Molecular Devices; Sunnyvale, Calif.) and SoftMax Pro software (Molecular Devices), as shown in
[0133] Flow cytometry: Antigen binding characteristics of the antibodies were also examined via flow cytometry analysis. Specifically, cells were stained using standard flow cytometry methodology. Briefly, for purified anti-ROR2 Fab, 0.1-1×10.sup.6 cells were stained with 1 μg/100 μL of Fab on ice for 1 h. After washing twice with ice-cold flow cytometry buffer (PBS containing 1% (v/v) BSA, 0.1% sodium azide and 1 mM EDTA), the cells were incubated with a 1:1000 dilution of a mouse anti-His tag mAb conjugated to Alexa Fluor 488 (Qiagen) in 100 μL flow cytometry buffer on ice for 30 min. For purified anti-ROR2 IgG1, 0.1-1×10.sup.6 cells were incubated with 100 ng/100 μL of IgG on ice for 1 h. After washing twice with ice-cold flow cytometry buffer, cells were stained with a 1:500 dilution of goat anti-human IgG, Fcγ pAbs conjugated to APC (Jackson ImmunoResearch) in 100 μL flow cytometry buffer on ice for 30 min. Finally, 4′6-diamidino-2-phenylindole (DAPI) was added to a final concentration of 100 ng/mL to exclude dead cells from analysis. Cells were analyzed using a FACSCalibur instrument (BD Biosciences) and FlowJo analytical software (Tree Star, Ashland, Oreg.). Results of the study are shown in
[0134] Additional studies were performed to examine cross-reactivity and epitope mapping of the isolated antibodies. In these studies, extracellular domains of human ROR2 with Thr at 145 (hROR2-T.sup.245) (55-394) and human ROR2 with less frequent SNP hROR2-A.sup.245 (55-394), as well as mouse ROR2 (34-403), were separately fused to a (G4S)3 linker followed by an HA tag (YPYDVPDYAS) and a PDGFRB segment (amino acids 513-561) that included the transmembrane domain (amino acids 533-553), and stably displayed on HEK 293F cells (
[0135] Surface plasmon resonance: Furthermore, a surface plasmon resonance study was performed to measure the affinities of all Fabs to hFc-hROR2 and epitope mapping studies were performed on a Biacore X100 instrument using Biacore reagents and software (GE Healthcare, Piscataway, N.J.). Anti-Human IgG (Fc) antibody was immobilized on a CM5 sensor chip following the instruction of Human Antibody Capture Kit (GE Healthcare, Piscataway, N.J.). Then hFc-hROR2 fusion proteins were captured at certain density (indicated in
[0136] Western blotting: A Western blotting assay was performed to examine the binding activity of the isolated antibodies for denatured ROR2 polypeptide. Cells or proteins were lysed by 1×sample buffer (containing 1% β-mercaptoethanol) and boiled before running on NuPAGE Novex 4-12% Bis-Tris gels (Invitrogen). After membrane transferring and blocking by 5% milk, 2 μg/mL chimeric rabbit/human IgG1 XBR2-401 was applied to detect the denatured proteins, followed by incubation with 1/1000 anti-human Fc conjugated to HRP before developing using ECL Prime Western Blotting Detection Reagent (GE Healthcare). As shown in
Example 5. Expression of Purified, Recombinant Twin Strep-Tagged Human, Murine and Cynomolgus ROR2
[0137] Twin strep-tagged human, mouse and cynomolgus ROR2-extracellular domain was produced as follows: the nucleotide sequence encoding the extracellular domain of human ROR2 (NP_004551.2), murine ROR2 (NP_038874.3) and cynomolgus ROR2 (XP_005582291.1) were each N-terminally fused to a signal sequence (MNFGLRLIFLVLTLKGVQC) and C-terminally fused with a sequence encoding a twin strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEKG). The entire nucleotide sequences with flanking 5′NotI and 3′HindIII sites were produced by total gene synthesis (GenScript, Piscataway, USA), assembled in the mammalian expression vector pCB14 and verified by DNA sequencing. This vector, a derivative of the episomal mammalian expression vector pCEP4 (Invitrogen), carries the EBV replication origin, encodes the EBV nuclear antigen (EBNA-1) to permit extrachromosomal replication, and contains a puromycin selection marker in place of the original hygromycin B resistance gene.
[0138] Recombinant human twin strep-tagged ROR2 (NP_004551.2), murine twin strep-tagged ROR2 (NP_038874.3) and cynomolgus twin strep-tagged ROR2 (XP_005582291.1) were expressed and purified in-house according to the following protocol: the EBNA expression vector pCB14b-ROR2-ECD-TwinStrep (human ROR2), pCB14g-mouseROR2-ECD-TwinStrep (mouse ROR2) or pCB14b-cynomolgusROR2-ECD-TwinStrep (cynomolgus monkey ROR2), directing expression of ROR2 extracellular domain (ECD), C-terminally tagged with a TwinStrep tag, was transfected into HEK293T using Lipofectamine® LTX with PLUS™ Reagent (Thermo Fisher Scientific, 15388100). Following a 1-day incubation (37° C., 5% CO2, growth media: Dulbecco's Modified Eagle Medium (DMEM) High Glucose (4.5 g/l) with L-Glutamine with 10% (v/v) Fetal Calf Serum (FCS), 100 IU/mL of Pen-Strep-Fungizone and 2 mM L-glutamine (all Bioconcept)), cells were expanded under selection conditions (2 μg/mL of puromycin (Sigma-Aldrich, P8833-25 mg stock at 2 mg/mL)). Cells were split and further expanded (37° C., 5% CO2); once confluency was reached, tissue culture dishes were coated with 20 μg/ml poly-L-Lysine (Sigma-Aldrich, P1524) for 2 hrs at 37° C. and washed twice with PBS. Then, cells were trypsinized, washed with PBS and split 1:3 onto poly-L-lysine-coated plates. Again after reaching confluency, cells were washed with PBS followed by with media replacement using production media (DMEM/F-12, Gibco/Thermo Fisher Scientific, 31330-03) supplemented with 1 μg/mL puromycin (Sigma-Aldrich, P8833), 100 IU/mL of Pen-Strep-Fungizone (Bioconcept, 4-02F00-H), 161 μg/mL of N-acetyl-L-cysteine (Sigma-Aldrich, A8199) and 10 μg/mL of L-glutathione reduced (Sigma-Aldrich, G6529). Supernatant, harvested bi-weekly and filtered (0.22 μm) to remove cells, was stored at 4° C. until purification. For purification, filtered supernatant was loaded onto a Streptactin® Superflow® high capacity cartridge (IBA, Gottingen, Germany, 2-1238-001) column; purification and elution was performed according to the manufacturer's protocol on an AEKTA pure (GE Healthcare). Fractions were analyzed for protein purity and integrity by SDS-PAGE. Protein-containing fractions were mixed and subjected to buffer exchange using Amicon filtration units (Millipore, Schaffhausen, Switzerland) to reach a dilution of ≥1:100 in PBS, and then sterile filtered using a low retention filter (0.20 μm, Carl Roth, Karlsruhe, Germany, Pa. 49.1).
Example 6. Expression of Purified, Recombinant Anti-Human ROR2 and Isotype Control Antibodies
[0139] Expression vectors: Antibody variable region coding regions were produced by total gene synthesis (GenScript) using MNFGLRLIFLVLTLKGVQC as leader sequence, and were assembled with human IgH-γ 1 and IgL-κ (ERR2-308, ERR2-316, ERR2-317, XBR2-327, Huluc63) or IgL-λ (ERR2-302, ERR2-Top35) constant regions in the expression vector pCB14.
[0140] Expression vectors encoding each of the full-length heavy and light chains were assembled in a proprietary mammalian expression vector, Switzerland. Antibodies were transiently expressed in CHO cells by methods known in the art and recombinant antibodies were purified by standard protein A purification from CHO cell supernatants, as known in the art. In short, the CHO cell supernatants were harvested by centrifugation and sterile filtered (0.2 μm) before FPLC-based affinity purification using Amsphere protein A columns (JSR Life Sciences) performed as described below.
[0141] In-house expression and purification: pCB14-based expression vectors were transfected into HEK293T cells using Lipofectamine® LTX Reagent with PLUS™ Reagent (Thermo Fisher Scientific, Reinach, Switzerland, 15388100); following a 1-day incubation (37° C., 5% CO2, growth media: Dulbecco's Modified Eagle Medium (DMEM) High Glucose (4.5 g/1) with L-Glutamine with 10% (v/v) Fetal Calf Serum (FCS), 100 IU/mL of Pen-Strep-Fungizone and 2 mM L-glutamine (all Bioconcept, Allschwil, Switzerland)), cells were expanded under selection conditions (2 μg/mL of puromycin (Sigma-Aldrich, Buchs SG, Switzerland, P8833-25 mg stock at 2 mg/mL)). Cells were split and further expanded (37° C., 5% CO2); once confluency was reached, tissue culture dishes were coated with 20 μg/ml poly-L-Lysine (Sigma-Aldrich, P1524) for 2 h at 37° C. and washed twice with PBS. Then, cells were trypsinized and split 1:3 onto poly-L-lysine-coated plates. Again after reaching confluency, cells were washed with PBS followed by media replacement to production media (DMEM/F-12, Gibco/Thermo Fisher Scientific, 31330-03) supplemented with 1 μg/mL puromycin (Sigma, P8833), 100 IU/mL of Pen-Strep-Fungizone (Bioconcept), 161 μg/mL of N-acetyl-L-cysteine (Sigma-Aldrich, A8199) and 10 μg/mL of L-glutathione reduced (Sigma-Aldrich, G6529). Supernatant, harvested bi-weekly and filtered (0.22 μm) to remove cells, was stored at 4° C. until purification.
[0142] For purification, filtered supernatant was loaded onto a PBS-equilibrated Protein A HiTrap column (GE Healthcare, Frankfurt am Main, Germany, 17-0405-01) or a JSR Amsphere™ Protein A column (JSR Life Sciences, Leuven, Belgium, JWT203CE) and washed with PBS; elution was performed using 0.1 M glycine (pH 2.5) on an AEKTA pure (GE Healthcare). Fractions were immediately neutralized with 1 M Tris-HCl buffer (pH 8.0), and analyzed for protein purity and integrity by SDS-PAGE. Protein-containing fractions were mixed and subjected to buffer exchange using Amicon filtration units (Millipore, Schaffhausen, Switzerland, UFC901008) to reach a dilution of 1:100 in the buffer listed in Table 2, and then sterile filtered using a low retention filter (0.20 μm, Carl Roth, Karlsruhe, Germany, Pa. 49.1).
[0143] Table 2 lists the antibodies used in subsequent examples, along with their final concentration and buffer.
TABLE-US-00002 TABLE 2 List of antibodies used in the Examples C-Terminal Tags Final Antibody Antibody SEQ ID (HC: Heavy Chain, conc. (ref.) HC/LC LC: Light Chain) Buffer (mg/mL) ERR2-302 HC: SEQ ID NO. 7 HC: LPETG-Strep PBS 2.7 (mAb004) LC: SEQ ID NO. 19 LC: G.sub.5SLPETG- Strep ERR2-308 HC: SEQ ID NO. 8 HC: LPETG-Strep PBS 4.5 (mAb037) LC: SEQ ID NO. 20 LC: G.sub.5SLPETG- Strep ERR2-316 HC: SEQ ID NO. 9 HC: LPETG-Strep PBS 3.2 (mAb005) LC: SEQ ID NO. 21 LC: G.sub.5SLPETG- Strep ERR2-317 HC: SEQ ID NO. 10 HC: LPETG-Strep PBS 2.5 (mAb006) LC: SEQ ID NO. 22 LC: G.sub.5SLPETG- Strep XBR2-327 HC: SEQ ID NO. 4 HC: LPETG-Strep PBS 3.7 (mAb007) LC: SEQ ID NO. 16 LC: G.sub.5SLPETG- Strep ERR2- HC: SEQ ID NO. 12 HC: LPETG-Strep PBS 3.3 top35 LC: SEQ ID NO. 24 LC: G.sub.5SLPETG- (mAb130) Strep XBR2-401 HC: SEQ ID NO. 11 HC: LPETG-Strep PBS 6.0 (mAb003) LC: SEQ ID NO. 13 LC: G.sub.5SLPETG- Strep Huluc63 HC: SEQ ID NO. HC: LPETG-Strep PBS 8.0 (mAb047) 135 LC: G.sub.5SLPETG- LC: SEQ ID NO. Strep 136
[0144] Huluc63 corresponds to an unrelated control antibody; the heavy and light chain sequences are given below.
TABLE-US-00003 SEQ ID Amino Acid Sequence NO. (with constant domain Name underlined) SEQ ID EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWV NO. 135 RQAPGKGLEWIGEINPDSSTINYAPSLKDKFIISRDN Huluc63 AKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQ HC GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV amino KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS acid SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK SEQ ID DIQMTQSPSSLSASVGDRVTITCKASQDVGIAVAWYQ NO. 136 QKPGKVPKLLIYWASTRHTGVPDRFSGSGSGTDFTLT Huluc63 ISSLQPEDVATYYCQQYSSYPYTFGQGTKVEIKRTVA LC APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW amino KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKAD acid YEKHKVYACEVTHQGLSSPVTKSFNRGEC sequence
Example 7. Cross-Reactivity of Anti-Human ROR2 Antibodies on Murine and Cynomolgus ROR2
[0145] Each well of a 96-well plate was coated with 50 μL of 2 μg/mL twinstrep-tagged human, murine or cynomolgus ROR2 (from Example 4) in 0.1 M bicarbonate coating buffer (pH 9.6), and incubated for 12 h at 4° C. An additional 96-well plate was likewise prepared but with anti-human Fc (Jackson ImmunoResearch, 109-006-008).
After blocking with 150 μL of 3% (w/v) bovine serum albumin (BSA)/TBS for 1 h at 37° C., the following antibodies were added to a well within each plate at a concentration of 0.5 μg/mL, and serially diluted (dilution factor 4) with 1% (w/v) BSA/TBS, before incubation for 1 h at 37° C.: ERR2-302 (mAb004), ERR2-308 (mAb037), ERR2-316 (mAb0005), ERR2-317 (mAb006), XBR2-327 (mAb007), ERR2-Top35 (mab130), and XBR2-401 (mab003). After washing with PBS with 0.05% Tween 20, HRP-conjugated F(ab′).sub.2 anti-human FC-gamma (Jackson Immunoresearch, 109-036-008) was then added at a 1:10′000 dilution, 50 μl per well, and incubated for 1 h at 37° C. prior to detection using an Spark 10M plate reader (Tecan). Curves of OD 490 nm versus antibody concentration (ng/mL) were fitted with Graphpad Prism Software (Graphpad Software, La Jolla, Calif., U.S.A.). The IC.sub.50 values, determined using the built-in “log(inhibitor) vs. response—Variable slope (four parameters)” IC.sub.50 determination function of Prism Software, are reported in Table 3 for human and mouse ROR2, and in Table 4 for human and cynomolgus ROR2. As shown in
TABLE-US-00004 TABLE 3 Human and mouse ROR2 binding by anti-ROR2 antibodies. IC50 ng/mL ratio IC50 anti- human mouse human mouse Antibody human Fc ROR2 ROR2 ROR2/IgG ROR2/IgG ERR2-302 32.2 102.3 60.6 0.31 0.53 ERR2-308 33.6 466.8 150.7 0.07 0.22 ERR2-316 40 29.9 994.6 1.34 0.04 ERR2-317 39.1 1354.1 167.2 0.03 0.23 XBR2-327 43.3 167901.4 443.7 0 0.1 XBR2-401 85.6 50.5 361.1 1.69 0.24 ERR2-top35 41.9 24.4 17.3 1.72 2.41
TABLE-US-00005 TABLE 4 Human and cynomolgus ROR2 binding by anti-ROR2 antibodies IC50 ng/mL ratio IC50 anti-human human cynomolgus human cynomolgus Antibody Fc ROR2 ROR2 ROR2/IgG ROR2/IgG ERR2-302 13.4 5.5 7.1 0.41 0.53 ERR2-308 16.7 18.6 4.6 1.11 0.28 ERR2-316 11.2 40.7 44 3.63 3.93 ERR2-317 8.4 16.8 19 2 2.26 XBR2-327 10.2 0.57 0 0.06 0 XBR2-401 6.8 41.9 43.3 6.16 6.37 ERR2- 14.3 46.2 53.1 3.23 3.71 top35
Example 8. Binding Affinities of Anti-Human ROR2 Antibodies on Human and Cynomolgus ROR2
[0146] Surface plasmon resonance for the measurement of the affinities of anti-ROR2 antibodies to human ROR2 and cynomolgus ROR2 was performed on a Biacore T200 instrument (GE Healthcare). Goat α-human Fcγ-specific IgG (Jackson ImmunoResearch, 109-005-098) was covalently immobilized on a CM5 sensor chip (GE Healthcare, BR-1005-30. For affinity measurements, purified anti-human ROR2 antibodies were used. In all cases, anti-ROR2 antibodies were diluted to 7.5 μg/ml in 1×HBS-EP+ running buffer (10 mM HEPES, 150 mM NaCl, 3 mM EDTA (pH 7.4), and 0.05% (v/v) Tween P20) and captured for 60 s with a flow of 10 μl/min. Human ROR2-TwinStrep or cynomolgus ROR2-TwinStrep was diluted in running buffer using 2-fold serial dilutions ranging from 200 nM to 12.5 nM. Association and dissociation were measured at a flow of 30 μl/min for 120 s and 200 s, respectively. Calculation of association (k.sub.on) and dissociation (k.sub.off) rate constants was based on a 1:1 Langmuir binding model. The equilibrium dissociation constant (K.sub.d) was calculated from k.sub.off/k.sub.on. Values are reported in Table 5.
TABLE-US-00006 TABLE 5 Binding characteristics of anti-ROR2 antibodies against human and cynomolgus ROR2 as determined by SPR Antigen Antibody k.sub.on (M.sup.−1s.sup.−1) k.sub.off (s.sup.−1) K.sub.d (nM) Human ROR2 XBR2-401 (mab003) 9.78E+02 ≤1.00E−05 ≤10.2 Cynomolgus XBR2-401 (mab003) 8.71E+03 ≤1.00E−05 ≤1.1 ROR2 Human ROR2 ERR2-302 (mab004) 1.07E+05 5.60E−03 52.4 Cynomolgus ERR2-302 (mab004) 1.08E+05 5.27E−03 48.6 ROR2 Human ROR2 ERR2-308 (mab037) 1.37E+04 1.53E−04 11.2 Cynomolgus ERR2-308 (mab037) 2.38E+04 1.27E−04 5.4 ROR2
Example 9. Generation of Site-Specifically Conjugated ADCs Using SMAC-Technology
[0147] Sortase A enzyme. Recombinant and affinity purified Sortase A enzyme from Staphylococcus aureus was produced in E. coli as disclosed in WO2014140317A1.
[0148] Generation of glycine-modified toxins. In order to generate SMAC-Technology™ conjugated ADCs with pentaglycine-modified PNU-159682 derivative Gly.sub.5-EDA-PNU (
[0149] Sortase-mediated antibody conjugation. The above-mentioned toxin was conjugated to anti-ROR2 antibodies as per Table 3 by incubating LPETG-tagged mAbs [10 μM] with glycine modified toxin [200 μl M] and 3 μM Sortase A in the listed conjugation buffer for 3.5 h at 25° C. The reaction was stopped by passing it through an rProtein A GraviTrap column (BioRad). Bound conjugate was eluted with 5 column volumes of elution buffer (0.1 M glycine pH 2.5, 50 nM NaCl), with 1 column volume fractions collected into tubes containing 25% v/v 1M HEPES pH 8 to neutralise the acid. Protein containing fractions were pooled and formulated in the formulation buffer of Table 7 using a ZebaSpin desalting column.
[0150] ADC analytics. DAR was assessed by Reverse Phase Chromatography performed on a Polymer Labs PLRP 2.1 mm×5 cm, 5 μm column run at 1 mL/min/80° C. with a 25 minute linear gradient between 0.05 to 0.1% TFA/H.sub.2O and 0.04 to 0.1% TFA/C.sub.H3CN. Samples were first reduced by incubation with DTT at pH 8.0 at 37° C. for 15 minutes. The DAR determined by Reverse Phase Chromatography is summarized in Table 6 below.
TABLE-US-00007 TABLE 6 Manufacturing conditions and analytical summary of ADCs manufactured in this study. ADC (ref.) mAb (ref.) Toxin Conjugation Buffer Formulation Buffer DAR ERR2-302- ERR2-302 G5-PNU 50 mM HEPES (pH 7.5), 10 mM sodium succinate 3.5 G5-PNU (mAb004) 15 mM NaCl, 5 mM CaCl.sub.2 (pH 5.0), 175 mM (adc142) sucrose, 0.02% (w/v) Tween 20 ERR2-308- ERR2-308 G5-PNU 50 mM HEPES (pH 7.5), 10 mM sodium succinate 3.5 G5-PNU (mAb037) 15 mM NaCl, 5 mM CaCl.sub.2 (pH 5.0), 175 mM (adc143) sucrose, 0.02% (w/v) Tween 20 ERR2-317- ERR2-317 G5-PNU 50 mM HEPES (pH 7.5), 10 mM sodium succinate 3.5 G5-PNU (mAb006) 15 mM NaCl, 5 mM CaCl.sub.2 (pH 5.0), 175 mM (adc145) sucrose, 0.02% (w/v) Tween 20 XBR2-327- XBR2-327 G5-PNU 50 mM HEPES (pH 7.5), 10 mM sodium succinate 3.8 G5-PNU (mAb007) 15 mM NaCl, 5 mM CaCl.sub.2 (pH 5.0), 175 mM (adc146) sucrose, 0.02% (w/v) Tween 20 XBR2-401- XBR2-401 G5-PNU 50 mM HEPES (pH 7.5), 10 mM sodium succinate 3.6 G5-PNU (mAb003) 15 mM NaCl, 5 mM CaCl.sub.2 (pH 5.0), 175 mM (adc096) sucrose, 0.02% (w/v) Tween 20 ERR2- ERR2- G5-PNU 50 mM HEPES (pH 7.5), 25 mM HEPES (pH 6.8), ND top35-G5- top35 150 mM NaCl, 1 mM CaCl.sub.2 150 mM NaCl PNU (mAb130) (adc207) Huluc63- Huluc63 G5-PNU 50 mM HEPES (pH 7.5), 10 mM sodium succinate 3.6 G5-PNU (mAb047) 15 mM NaCl, 5 mM CaCl.sub.2 (pH 5.0), 175 mM (adc101) sucrose, 0.02% (w/v) Tween 20 DAR, drug-to-antibody ratio. ND, not determined.
Example 10. In Vitro Cytotoxicity Assays of Anti-ROR2 Antibody-Based ADCs on Wild Type EMT-6 and ROR2-Overexpressing EMT-6 Breast Cancer Cells
[0151] Cytotoxicity of the anti-ROR2 ADCs of Table 5 was investigated using wild type (WT) EMT-6 and EMT-6 cells engineered to overexpress human ROR2 (from Example 1). Huluc-G5-PNU (adc101) was included as isotype control.
[0152] For this, 9.75×10.sup.3WT EMT-6 and hROR2 overexpressing EMT-6 cells per well were plated on 96-well plates (excluding edge wells, which contained water) in 75 μL DMEM supplemented with 10% by vol. FCS, 100 IU/ml Pen-Strep-Fungizone and 2 mM L-Glutamine and were grown at 37° C. in a humidified incubator at 7.5% CO.sub.2 atmosphere. After 1-day incubation, each ADC was added to respective wells in an amount of 254, of 3.5-fold serial dilutions in growth medium (resulting in final ADC concentrations from 20 μg/mL to 0.88 ng/ml). After 4 additional days, plates were removed from the incubator and equilibrated to room temperature. After approximately 30 min, 50 μL was removed from each well, and then 50 μL of CellTiter-Glo® 2.0 Luminescent Solution (Promega, G9243) was added to each well. After shaking the plates at 750 rpm for 5 min followed by 20 min incubation without shaking, luminescence was measured on a Tecan iControl plate reader.
[0153] Curves of luminescence versus ADC concentration (ng/mL) were fitted with Graphpad Prism Software. The IC50 values, determined using the built-in “log(inhibitor) vs. response —Variable slope (four parameters)” IC.sub.50 determination function of Prism Software, are reported in Table 7.
TABLE-US-00008 TABLE 7 In vitro cell killing of EMT-6 cells and EMT-6/hROR2 expressing cells by anti-ROR2 or isotype control ADCs (IC.sub.50, ng/mL) hROR2-overexpressing ADC WT EMT-6 EMT-6 ERR2-302-G5-PNU (adc142) 2.1 × 10.sup.8 3.2 ERR2-308-G5-PNU (adc143) 8′983 10.3 ERR2-317-G5-PNU (adc145) 25′205 6.2 XBR2-401-G5-PNU (adc096) 7′452 10.2 XBR2-327-G5-PNU (adc146) 11′568 10.2 ERR2-top35-G5-PNU (adc207) 364 7.2 Huluc63-G5-PNU (adc101) 3398 1′207
[0154]
Example 11. Functional Evaluation of CAR-T Cells Expressing Anti-hROR2 CAR Based on XBR2-401
[0155] CAR-T cells based on XBR2-401 were engineered using previously described methods (Hudecek, M., Lupo-Stanghellini, M. T., Kosasih, P. L., Sommermeyer, D., Jensen, M. C., Rader, C., and Riddell, S. R. (2013) Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T cells. Clin. Cancer Res. 19, 3153-3164). Ex vivo expanded primary human CD8.sup.+ CD62L.sup.+ T cells were lentivirally transduced with XBR2-401 CARs containing CD3ζ and 4-1BB signaling domains and a short or long spacer. Transduced T cells were purified via tEGFR by FACS and their phenotype was assesed the day before functional assays. CD8+ purity varied between 97% and 99%, tEGFR expression varied between 95% and 99%. Following 72 h co-culture with ROR2-positive or ROR2-negative human breast cancer cells, CFSE-stained CD8+CD62L+ cells were analyzed by flow cytometry, revealing target-dependent proliferation of XBR2-401 (
Example 12. Specificity Analysis of XBR2-401
[0156]
[0157] Some additional references cited here are listed below. [0158] Hofer, T., W. Tangkeangsirisin, M. G. Kennedy, R. G. Mage, S. J. Raiker, K. Venkatesh, H. Lee, R. J. Giger, and C. Rader. 2007. Chimeric rabbit/human Fab and IgG specific for members of the Nogo-66 receptor family selected for species cross-reactivity with an improved phage display vector. J Immunol Meth 318:75-87. [0159] Hofer, T., J. D. Thomas, T. R. Burke, Jr., and C. Rader. 2008. An engineered selenocysteine defines a unique class of antibody derivatives. Proc Natl Acad Sci USA 105:12451-12456. [0160] Kwong, K. Y., S. Baskar, H. Zhang, C. L. Mackall, and C. Rader. 2008. Generation, affinity maturation, and characterization of a human anti-human NKG2D monoclonal antibody with dual antagonistic and agonistic activity. J Mol Biot 384:1143-1156. [0161] Kwong, K. Y., and C. Rader. 2009. E. coli expression and purification of Fab antibody fragments. Curr Protoc Protein Sci Chapter 6:Unit 6 10. [0162] McCartney-Francis, N., R. M. Skurla, Jr., R. G. Mage, and K. E. Bernstein. 1984. Kappa-chain allotypes and isotypes in the rabbit: cDNA sequences of clones encoding b9 suggest an evolutionary pathway and possible role of the interdomain disulfide bond in quantitative allotype expression. Proc Natl Acad Sci USA 81:1794-1798. [0163] Popkov, M., R. G. Mage, C. B. Alexander, S. Thundivalappil, C. F. Barbas, 3rd, and C. Rader. 2003. Rabbit immune repertoires as sources for therapeutic monoclonal antibodies: the impact of kappa allotype-correlated variation in cysteine content on antibody libraries selected by phage display. J Mol Biol 325:325-335. [0164] Rader, C. 2009. Generation and selection of rabbit antibody libraries by phage display. Methods Mol Biol 525:101-128, xiv. [0165] Yang, J., S. Baskar, K. Y. Kwong, M. G. Kennedy, A. Wiestner, and C. Rader. 2011. Therapeutic potential and challenges of targeting receptor tyrosine kinase ROR1 with monoclonal antibodies in B-cell malignancies. PloS One 6:e21018. [0166] Yang, J., and C. Rader. 2012. Cloning, expression, and purification of monoclonal antibodies in scFv-Fc format. Methods Mol Biol 901:209-232.
[0167] Some additional nucleotide sequences described herein are listed below.
TABLE-US-00009 SEQ ID NO: 129 5′-CAGTCAGTGAAGGAGTCCGAGGGAGGTCTCTTCAAGCCAACGGA TACCCTGACACTCACCTGCACAGTCTCTGGATTCTCCCTCAGTAGCT ATGGAGTGACCTGGGTCCGCCAGGCTCCAGGGAGCGGGCTGGAATGG ATCGGATACATTAATACTGCTGGTAACACATACTACGCGAGCTGGGC GAAAAGCCGGTCCACCATCACCAGGAACACCAACGAGAACACGGTGA CTCTGAAAATGACCAGTCTGACAGCCGCGGACACGGCCACCTATTTC TGTGCGAGAGATTGGACATCCCTTAACATCTGGGGACCAGGGACCCT CGTCACCGTCTCTTCA-3′. SEQ ID NO: 130 5′-CAGGAGCAGCTGGAGGAGTCCGGGGGTCGCCTGGTCACGCCTGG GACACCCCTGACACTCACCTGCACAGTCTCTGGATTCTCCCTCAGTA GCTACTGGATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAA TGGATCGGGACCATTACGCCTGGTGGTAACACGGACTACGCGACCTG GGCGAAAGCCCGATTCACCGTCTCCAAAACCTCGACCACGGTGGATC TAAAAATCACCAGTCCGACAACCGAGGACACGGCCACCTATTTCTGT GCCAGAGGGATAGGTGGTGCTGCTGACTTGTGGGGGCCAGGCACCCT GGTCACCATCTCCTCA-3′. SEQ ID NO: 131 5′-CAGTCAGTGAAGGAGTCCGAGGGAGGTCTCTTCAAGCCAACGGA TAGCCTGACACTCACCTGCACAGTCTCTGGATTCTCCCTCAGTACCT ATGGAGTGAGCTGGGTCCGCCAGGCTCCAGGGAACGGGCTGGAATGG ATCGGGGCCATTGGTAGTAGTGGTAGCGCAAACTACGCGAGCTGGGC GAAAGACCGATCCACCATCACCAGAAACACCAACCTGAACACGGTGA CTCTGAAAATGACCAGTCTGACAGCCGCGGACACGGCCACCTATTTC TGTGCGAGAGATGGTTACTATAGTAGTGGCTGGGGTCCCTACTTTAA CATCTGGGGGCCAGGCACCCTGGTCACCATCTCCTCA-3′. SEQ ID NO: 132 5′-GACCCTATGCTGACCCAGACTCCATCCTCCACGTCTACCGCTGT GGGAGACACAGTCACCATCAAGTGCCAGGCTAGTCAGAGCATTAGTA GTGACTTATCCTGGTATCAGCAGAAACCAGGGCAGCGTCCCAAGCTC CTGATCTACCAGGCATCCACTCTGGCATCTGGGGTCCCATCGCGGTT CAAAGGCAGTGGATATGGGACAGAGTACACTCTCACCATCAGCGGCG TGCAGCGTGAGGATGCTGCCATCTACTACTGTCTAGGTGGTTATGCT GATGCTTCTTATCGAACTGCTTTCGGCGGAGGAACCAAGCTGGAGAT CAAA-3′. SEQ ID NO: 133 5′-CAAGTGCTGACCCAGACTCCATCCTCCACGTCTGCCGCTGTGGG AGGCACAGTCACCATCAAGTGCCAGGCCAGTCAGAGCATTAGTAGTA GCGACTTATCCTGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTC CTGATCTATGCTACATCCTATCTGGCATCTGGAGTCCCATCGCGGTT CAAAGGCAGTGGATCTGGGACAGAGTACACTCTCACCATCAGCGGCG TGCAGCGTGAGGATGCTGCCACCTACTACTGTCTAGGTGGTTATCCT AATACTTCTTACCGGTCTGCTTTCGGCGGAGGGACCAAGGTGGAGAT CAAA-3′. SEQ ID NO: 134 5′-TCCTTCGTGCTGACTCAGCCAGCCTCAGTGCAGGTGAACTTGGG ACAGACGGTCTCCCTCACATGCACTGCAGATACACTGAGCAGAAGTT ATGCTTCCTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGCTC ATCTACAGGGATACCAGTCGGCCCTCAGGGGTCCCTGACCGCTTCTC TGGCTCCAGCTCAGGGAACACGGCCACCCTGACCATCAGTGGGGCCC AGGCTGGGGACGAGGCTGACTACTATTGTGCTACAAGCGGTGGCAGT GGCAGCAACCCTCAGTATGTGTTCGGCGGAGGGACCCAGCTGACCGT CACAGGC-3′.
[0168] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
[0169] All publications, databases, GenBank sequences, patents, and patent applications cited in this specification are herein incorporated by reference as if each was specifically and individually indicated to be incorporated by reference.