COMPOSITIONS AND METHODS

20220001007 · 2022-01-06

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention relates to a viral vector comprising nucleic acid having a polynucleotide sequence encoding at least one epitope of the varicella-zoster virus (VZV) Gly E antigen, wherein said viral vector is an adenoviral vector. The invention also relates to uses, compositions for use in medical treatments, and methods of medical treatment.

    Claims

    1. A composition comprising a viral vector comprising nucleic acid having a polynucleotide sequence encoding at least one epitope of the varicella-zoster virus (VZV) Gly E antigen, wherein the viral vector is an adenoviral vector.

    2. The composition of claim 1 wherein the at least one epitope comprises at least one CD4 T cell epitope and at least one CD8 T cell epitope.

    3. The composition of claim 1 wherein the adenoviral vector is of human or simian origin.

    4. The composition of claim 1 wherein the adenoviral vector is selected from the group consisting of ChAdOx 1 and ChAdOx 2.

    5. The composition of claim 1 wherein the composition is adjuvant-free.

    6. The composition of claim 1 wherein the Gly E antigen has the amino acid sequence is selected from the group consisting of SEQ ID NO: 1 and SEQ ID NO: 2.

    7. The composition of claim 1 wherein the polynucleotide sequence comprises a sequence selected from the group consisting of SEQ ID NO: 3 and SEQ ID NO: 4.

    8. The composition of claim 1 wherein the polynucleotide sequence further comprises the sequence of the bgh polyadenylation signal SEQ ID NO: 6.

    9. The composition of claim 1 wherein the polynucleotide sequence encoding at least one epitope of the varicella-zoster virus (VZV) Gly E antigen is operably connected to the long CMV promoter, wherein the long CMV promoter has the nucleotide sequence of SEQ ID NO: 7.

    10. The composition of claim 1 wherein the viral vector sequence is as in ECACC accession number 12052403 (ChAdOx1).

    11. The composition of claim 1 wherein the viral vector comprises the sequence of SEQ ID NO: 5 (ChAdOx2).

    12. The composition of claim 1 wherein the composition is configured such that administration of a single dose of the composition to a mammalian subject induces protective immunity in the subject.

    13. The composition of claim 1 wherein the composition is configured to induce an immune response against VZV in a subject by administration of the composition to the subject.

    14. (canceled)

    15. (canceled)

    16. The composition of claim 1, wherein the composition is configured such that annual administration to a subject is capable of inducing an immune response against VZV in the subject.

    17. The composition of claim 1, wherein the composition is configured for use in preventing VZV infection in a subject by administration of the composition to the subject.

    18. The composition of claim 1, wherein the composition is configured for use in prevention of shingles in a subject by administration of the composition to the subject.

    19. (canceled)

    20. (canceled)

    21. (canceled)

    22. (canceled)

    23. (canceled)

    24. (canceled)

    25. (canceled)

    26. A method of inducing an immune response against varicella-zoster virus (VZV) in a mammalian subject, the method comprising the steps of administering at least one dose of the composition of claim 1 to the subject.

    27. A method of preventing shingles in a mammalian subject, the method comprising the steps of administering at least one dose of the composition of claim 1 to the subject.

    28. (canceled)

    29. (canceled)

    30. The method of claim 26 wherein the composition is administered annually.

    31. The method of claim 26 wherein the composition is administered by a route of administration selected from the group consisting of subcutaneous, intradermal and intramuscular administration.

    32. (canceled)

    33. (canceled)

    34. The composition of claim 1 wherein the composition is configured for use in treatment or prevention of chickenpox in a subject.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0260] FIG. 1 shows a plot

    [0261] FIG. 2 shows a bar chart

    [0262] FIG. 3 shows a graph

    [0263] FIG. 4 shows a plot

    [0264] FIG. 5 shows a sequence alignment. “Insert” means SEQ ID NO: 4 (i.e. an exemplary nucleotide sequence encoding the antigen cassette). “AY253715.1” means SEQ ID NO: 3 (i.e. the wild type nucleotide sequence encoding the GlyE antigen).

    [0265] FIG. 6 shows a sequence alignment (CLUSTAL 0(1.2.4) multiple sequence alignment). “vaccine” means SEQ ID NO: 2 (i.e. an exemplary VZV GlyE amino acid sequence antigen cassette). “AY253715.1” means SEQ ID NO: 1 (i.e. the wild type VZV GlyE amino acid sequence).

    [0266] FIG. 7 shows a photograph

    [0267] FIG. 8 shows a plot and a graph

    [0268] FIG. 9 shows four graphs

    [0269] FIG. 10 shows a graph

    [0270] FIG. 11 shows a graph and two plots

    [0271] FIG. 12 shows a bar chart

    [0272] FIG. 13 shows a bar chart

    [0273] FIG. 14 shows a plot

    [0274] FIG. 15 shows a plot

    EXAMPLES

    Example 1—Viral Vectored Vaccines Against VZV

    [0275] We have generated viral vectored vaccines toward VZV.

    [0276] Our data suggest that the vaccine of the invention outperforms a currently licensed prior art Zoster vaccine as assessed for CMI pre-clinically (FIG. 1).

    [0277] The higher CMI routinely achieved with viral vectored vaccines, when compared to other vaccine modalities, is likely to translate to higher efficacy, while advantageously only a single shot of viral vectored vaccine may be required for efficacy in contrast to repeated administration of known protein-in-adjuvant vaccines.

    [0278] We refer to FIG. 1.

    [0279] Groups of Balb/c mice (n=5) were vaccinated intramuscularly with 1×10.sup.7 IU of ChAdOx1-VZVgpE or 1×10.sup.7 IU of ChAdOx2-VZVgpE or 1.3×10.sup.3 pfu Zostax.

    [0280] Splenocytes were collected 2 weeks after final vaccination and the cellular immune response against peptides spanning the whole glycoprotein-E were measured by ELISpot analysis.

    [0281] Responses post ChAdOx1-VZV-gE were significantly higher than those post Zostavax.

    [0282] This test is in young mice. Age was approx. >8 weeks.

    [0283] It is noted that the prior art Zostavax vaccine can replicate in humans and without wishing to be bound by theory partial immunogenicity may be argued to have come from this. However, it has been demonstrated that non-replicating Zostavax vaccine is comparable in terms of measured immunogenicity to replicating Zostavax in man and can induce a similar immune response.

    [0284] In any case, this is a fair test because none of the vaccines used replicate in mice.

    [0285] Thus it is demonstrated that the invention outperforms prior art Zostavax.

    [0286] We refer to FIG. 2.

    [0287] 8 wk.sup.+ old or aged ex-breeder female Balb/c mice were vaccinated intramuscularly with 1.00E+07 iu of ChAdOX1-VZV-gE Mice were culled approx. 2 weeks later and spleen ELISpot performed with peptides spanning the entire VZV gE insert.

    [0288] Responses post ChAdOx1-VZV-gE were not significantly different.

    [0289] This test is in aged mice.

    [0290] We refer to FIG. 3.

    [0291] 8 wk.sup.+ old female Balb/c mice were vaccinated intramuscularly with ChAdOX1-VZV-gE—group 1. 1.00E+07 iu ChAdOX1-VZV-gE then four weeks later boosted with 1.00E+07 iu ChAdOX1-VZV-gE ChAdOX2-VZV-gE—group 2. 1.00E+07 iu ChAdOX2-VZV-gE then four weeks later boosted with 1.00E+07 iu ChAdOX2-VZV-gE.

    [0292] Zostavax group 3. 1.29E+03 VZV Zostavax then four weeks later boosted with 1.29E+03 VZV Zostavax. Sera was taken at the indicated timepoints and assayed for anti-VZV-gpE specific antibodies.

    [0293] The inventors note that Kruskal-Wallis analysis shows with Dunn's multiple comparisons test significant difference in response between group 2 and 3, but not between group 1 and group 3 at 2 wk post-boost. This may represent a further advantage of this particular embodiment where the vector is ChAdOx1 i.e. the inventors would not have expected to see antibody response comparable to Zostavax (as evidenced by group 2—ChAdOx2) but group 1 (ChAdOx1 embodiment) generates a surprisingly good antibody response as well as good T cell responses.

    [0294] The inventors note that there is no significant difference in responses in FIG. 4 after one shot antibody responses as 2 weeks or 16 weeks.

    [0295] We refer to FIG. 4, 8 wk.sup.+ old female Balb/c mice were vaccinated intramuscularly with

    [0296] lane 1. 1.00E+07 iu ChAdOX1-VZV-gE then one week later boosted with 1.00E+07 iu ChAdOX1-VZV-gE. (filled box)

    [0297] lane 1. 1.00E+07 iu ChAdOX1-VZV-gE then one week later boosted with 1.00E+07 iu ChAdOX2-VZV-gE. (filled circle)

    [0298] lane 2. 1.00E+07 iu ChAdOX1-VZV-gE then four weeks later boosted with 1.00E+07 iu ChAdOX1-VZV-gE (filled box)

    [0299] lane 2. 1.00E+07 iu ChAdOX1-VZV-gE then four weeks later boosted with 1.00E+07 iu ChAdOX2-VZV-gE. (filled circle)

    [0300] lane 3 (no Boost). 1.00E+07 iu ChAdOX1-VZV-gE (open circle)

    [0301] Mice were culled approx. 2 weeks later and spleen ELISpot performed with peptides spanning the entire VZV gE insert.

    [0302] Thus, lane 3 (no boost) represents a “one-shot” scheme; lanes 2 and 3 ‘filled boxes’ represent ‘homologous prime-boost’ schemes; lanes 2 and 3 ‘filled circle’ represent ‘heterologous prime-boost’ schemes. It could be argued that a heterologous second shot does not show augmentation—however, augmentation might be expected to show at a later time point—this is considered to be due to a response-curve effect.

    [0303] Responses post ChAdOx1-VZV-gE were not significantly different across in young or aged animals for single-administration applications.

    [0304] A preferred interval between prime and boost (in prime-boost applications; overall single-administration embodiments are preferred) is 4 weeks; when prime and boost are both Ad vectors, the interval may be for example 2, 4, 6 or 8 weeks.

    [0305] Mouse Model System

    [0306] Regarding the mouse model system for testing these vaccines, it should be noted that a 25 non-replicating zoster virus can give the same response as a replicating zoster virus in humans. Therefore, the mouse data presented herein do indeed represent a fair comparison since although the prior art Zostavax™ does induce a limited infection in humans which is important to boosting the immune response, neither the adenoviral vector constructs of the invention nor the Zostavax prior art comparator can replicate 30 in mice, and therefore the data provided in the application comparing those to formulations in mice are indeed fair and indicative of the superior properties of the vectors according to the invention.

    Example 2: Vectors of the Invention Express Efficiently

    [0307] We present western blot analysis of viral vector expression of VZVgpE. Subconfluent HEK293T (ChAdOx 1) were infected with viruses with at the indicated MOI. Cells were harvested 18 h later, lysed and protein supernatant lysate run on a Biorad 4-12% gradient gel and probed with a 1:1000 dilution of abeam 52549 VZV in 0.05% PBST and expression detected with ECL reagent.

    [0308] Results are shown in FIG. 7; lanes are as follows: [0309] 0—molecular markers [0310] 1—ChAdOx1 VZVgpE MOI 1 on HEK293T [0311] 2—ChAdOx1 VZVgpE MOI 5 on HEK293T [0312] 3—ChAdOx2 VZVgpE MOI 1 on HEK293T [0313] 4—ChAdOx2 VZVgpE MOI 5 on HEK293T [0314] 5—VZV+ve control ˜100 ng [0315] 6—VZV+ve control ˜500 ng

    [0316] Thus it is demonstrated that the compositions of the invention produce expression of the antigen in human cells.

    Example 3: Immunogenicity of Viral Vectors Encoding Varicella Zoster Virus Glycoprotein E

    [0317] We demonstrate cellular immunogenicity after one-shot vaccination against VZV. We refer to FIG. 8A. Groups of Balb/c mice (n=5) were vaccinated intramuscularly with 1×10.sup.7 IU of ChAdOx1-VZVgpE or 1×10.sup.7 IU of ChAdOx2-VZVgpE or 1.3×10.sup.3 pfu Zostax. Splenocytes were collected 2 weeks after final vaccination and the cellular immune response against peptides spanning the whole glycoprotein-E were measured by ELISpot analysis.

    [0318] We refer to FIG. 8B. Groups of Balb/c mice (n=5, typically aged 8-10 weeks unless otherwise indicated) were vaccinated intramuscularly with 1×10.sup.7 IU of ChAdOx1-VZVgpE (‘aged mice’ are ex-breeders and typically >24 wk of age) or 1.3×10.sup.3 pfu Zostax. Splenocytes were collected at the times indicated after final vaccination and the cellular immune response against peptides spanning the whole glycoprotein-E were measured by ELISpot analysis.

    [0319] These ELISpot data show that a cellular immune response, as demonstrated by the T cell response, is induced according to the invention. The response is evident at 2 weeks. The response is induced by a single administration. The response is induced by a single dose. The response is a sustained response as shown by the data at the 16 week timepoints.

    [0320] We refer to FIG. 9. The cellular immune response of the same groups of Balb/c mice as in FIG. 8 were assessed by Intracellular Cytokine Staining (ICS). As before (n=5, typically aged 8-10 weeks unless otherwise indicated) were vaccinated intramuscularly with 1×10.sup.7 IU of ChAdOx1-VZVgpE (‘aged mice’ are ex-breeders and typically >24 wk of age) or 1.3×10.sup.3 pfu Zostax. Splenocytes were collected at the times indicated after final vaccination and the cellular immune response toward epitopes spanning the whole glycoprotein-E were measured by ICS analysis.

    [0321] FIG. 9A shows the percentage of CD8+ T cells secreting IFN-γ after stimulation with VZVgpE peptides and adjusted for background levels of secretion.

    [0322] FIG. 9B shows the percentage of CD4+ T cells secreting IFN-γ after stimulation with VZVgpE peptides and adjusted for background levels of secretion.

    [0323] FIG. 9C shows the percentage of IFN-γ+CD8+ T cells secreting TNFα and/or IL2 after stimulation with VZVgpE peptides and adjusted for background levels of secretion.

    [0324] FIG. 9D shows the percentage of IFN-γ+CD4+ T cells secreting TNFα and/or IL2 after stimulation with VZVgpE peptides and adjusted for background levels of secretion.

    [0325] Thus overall these FACS sorted experiments show that triple secreting CD4+ T cells (which are very good as without wishing to be bound by theory they are considered the most protective) are induced according to the invention. The data also show induction of CD8+ T cells, which are also very beneficial.

    [0326] We refer to FIG. 10 which shows humoral immunity after one-shot vaccination against VZV. Groups of Balb/c mice (n=5, aged 8-10 weeks unless otherwise indicated) were vaccinated intramuscularly with 1×10.sup.7 IU of ChAdOx1-VZVgpE (‘aged mice’ are ex-breeders and typically >24 wk of age) or 1.3×10.sup.3 pfu Zostax. Sera were collected at the times indicated after final vaccination and the humoral immune response toward affinity purified glycoproteins of Varizella Zoster Virus (Strain Ellen) were measured by ELISA.

    [0327] For clarity please note that FIGS. 8B, 9 and 10 show data from the same experiments.

    [0328] It is a surprising benefit that the immunisations according to the present invention are also effective in raising/inducing antibody titers, despite the one-shot administration. It is a surprising benefit that the invention is as good as prior art compositions such as Zostavax for the induction of antibody responses.

    Example 4: Prime-Boost Study

    [0329] We demonstrate immunogenicity after prime-boost vaccination against VZV.

    [0330] We refer to FIG. 11A.

    [0331] 8 wk.sup.+ old female Balb/c mice were vaccinated intramuscularly with ChAdOX1-VZV-gE—group 1. 1.00E+07 iu ChAdOX1-VZV-gE then four weeks later boosted with 1.00E+07 iu ChAdOX1-VZV-gE ChAdOX2-VZV-gE—group 2. 1.00E+07 iu ChAdOX2-VZV-gE then four weeks later boosted with 1.00E+07 iu ChAdOX2-VZV-gE.

    [0332] Zostavax—group 3. 1.29E+03 VZV Zostavax then four weeks later boosted with 1.29E+03 VZV Zostavax. Sera was taken at the indicated timepoints and assayed for anti-VZV-gpE specific antibodies.

    [0333] Referring to FIG. 11B & FIG. 11C, groups of Balb/c mice (n=5, aged 8-10 weeks unless otherwise indicated) were vaccinated intramuscularly with 1×10.sup.7 IU of ChAdOx1-VZVgpE and either not boosted (no boost) or boosted after 1 OR 4 weeks with 1×10.sup.7 IU of ChAdOx1-VZVgpE (homologous boost) or 1×10.sup.7 IU of ChAdOx2-VZVgpE (heterologous boost) a. Splenocytes were collected 2 weeks after final vaccination and the cellular immune response against peptides spanning the whole glycoprotein-E were measured by ELISpot analysis. b. Sera were collected 2 weeks after final vaccination and the humoral immune response toward affinity purified glycoproteins of Varizella Zoster Virus (Strain Ellen) were measured by ELISA.

    [0334] These data show that the single-shot or single-administration embodiments of the invention provide as good a response as a prime-boost regime. Thus it is an advantage of the invention that only a single shot or single dose (single administration) is needed.

    Example 5: Comparative Study

    [0335] The inventors compare the composition of the invention to prior art Shingrix™ across 3 doses and after one shot.

    [0336] Humoral immunity after one-shot vaccination against VZV was tested. Groups of CD1 mice (n=7/8) were vaccinated intramuscularly with either ChAdOx1-VZVgpE or Shingrix™, at doses indicated (3 doses). Sera were collected at 4 weeks indicated after vaccination and the humoral immune response toward affinity purified glycoproteins of Varizella Zoster Virus (Strain Ellen) were measured by ELISA. We refer to FIG. 12. Mean with s.e.m. depicted.

    TABLE-US-00003 Vaccine Description Group Shingrix ™ low dose 1 0.2 μg/mouse Shingrix ™ mid dose 2 1 μg/mouse Shingrix ™ high dose 3 5 μg/mouse ChAdOx1-VZVgpE low 4 1*10{circumflex over ( )}6/mouse ChAdOx1-VZVgpE mid 5 1*10{circumflex over ( )}7/mouse ChAdOx1-VZVgpE high 6 1*10{circumflex over ( )}8/mouse

    [0337] Cellular immunogenicity after one-shot vaccination against VZV was tested. Groups of CD1 mice (n=7/8) were vaccinated intramuscularly with either ChAdOx1-VZVgpE or Shingrix™, at doses indicated (3 doses). Splenocytes were collected 4 weeks after final vaccination and the cellular immune response against peptides spanning the whole glycoprotein-E were measured by ELISpot analysis. We refer to FIG. 13. Mean with s.e.m. depicted.

    TABLE-US-00004 Vaccine Description Group Shingrix ™ low dose 1 0.2 μg/mouse Shingrix ™ mid dose 2 1 μg/mouse Shingrix ™ high dose 3 5 μg/mouse ChAdOx1-VZVgpE low 4 1*10{circumflex over ( )}6/mouse ChAdOx1-VZVgpE mid 5 1*10{circumflex over ( )}7/mouse ChAdOx1-VZVgpE high 6 1*10{circumflex over ( )}8/mouse

    Example 6: Comparative Study

    [0338] Groups of outbred CD-1 mice (n=8) were vaccinated intramuscularly with [0339] Group 1; 1 ug of Shringrix with ASO1B adjuvant and four weeks later the animals were boosted with 1 ug of Shringrix with ASO1B adjuvant or [0340] Group 2; no prime and four weeks later the animals were vaccinated with 1.3×10.sup.3 pfu Zostavax or [0341] Group 3; 1.3×10.sup.3 pfu Zostavax and four weeks later animals were boosted with 1×10.sup.7 IU of ChAdOx1-VZVgpE or [0342] Group 4; no prime and four weeks later the animals were vaccinated 1×10.sup.7 IU of ChAdOx1-VZVgpE or [0343] Group 5; naïve animals.

    [0344] We refer to FIG. 14. The mean and standard error of the mean are depicted.

    [0345] Serum was collected approximately three weeks after final vaccination and analysed for anti-VZVgpE antibodies.

    [0346] Kruskal-Wallis analysis with Dunn's multiple comparison test demonstrates that Group 1; two shots of protein with adjuvant induces a significantly higher antibody titre when compared to Group 2; one shot of Zostavax or Group 4; one shot of ChAdOx1-VZVgpE, this result is as expected. However, there was no difference in the level of antibodies measured between Group 1 and Group 3. This is not expected, as ChAdOx1 after Zostavax would not be predicted to increase the humoral immune response to a comparable level of two shots of adjuvanted protein. This is an advantage, as currently UK adults aged 70 or over have been recommended to receive Zostavax vaccination, here we demonstrate that a boost vaccination of ChAdOx1-VZV-gpE can augment the antibody titres to those levels measured after two protein and adjuvant vaccinations, a regimen that is associated with efficacy of 91% or higher.

    TABLE-US-00005 Dunn's multiple Adjusted P comparisons test Significant? Summary Value Shingrix 1 ug/mouse x2 vs. No ns >0.9999 Zostavax-ChAdOx1-gE Shingrix 1 ug/mouse x2 vs. Yes * 0.0172 ChAdOx1-gE x1 Shingrix 1 ug/mouse x2 vs. Yes ** 0.0019 Zostavax x1

    Example 7: Comparative Study

    [0347] Groups of C57BL6 mice (n=5) were vaccinated intramuscularly with

    [0348] Group 1; 1 ug of Shringrix with ASO1B adjuvant and four weeks later the animals were boosted with 1 ug of Shringrix with ASO1B adjuvant or

    [0349] Group 2; no prime and four weeks later the animals were vaccinated with 1.3×10.sup.3 pfu Zostavax or

    [0350] Group 3; 1.3×10.sup.3 pfu Zostavax and four weeks later animals were boosted with 1×10.sup.7 IU of ChAdOx1-VZVgpE or

    [0351] Group 4; no prime and four weeks later the animals were vaccinated 1×10.sup.7 IU of ChAdOx1-VZVgpE.

    [0352] We refer to FIG. 15. The mean and standard error of the mean are depicted.

    [0353] Splenocytes were collected approximately four weeks after final vaccination and analysed for NK maturity and secretion of cytokines. Kruskal-Wallis analysis with Dunn's multiple comparison test demonstrates that NK cells after a prime-boost vaccination of 1.3×10.sup.3 pfu Zostax followed by 1×10.sup.7 IU of ChAdOx1-VZVgpE secrete more IFN-g (Group 3) when compared to the Shringix vaccination (Group 1). This is not expected and offers an advantage, NK cell activation has previously been demonstrated to augment the adaptive immune response and this strong induction of the innate immune response by ChAdOx1-VZVgpE after a Zostavax prime is not expected. Additionally, NK cells have been demonstrated to be critically important in mediating immunity against VZV infection (PMID; 2543925, 30565241).

    TABLE-US-00006 Table of sequences SEQ ID NO: 1 wild type VZV GlyE amino acid sequence SEQ ID NO: 2 exemplary VZV GlyE amino acid sequence SEQ ID NO: 3 wild type nucleotide sequence encoding VZV GlyE (Genbank accession number AY253715.1; this is the nucleotide sequence encoding the amino acid sequence of accession number AAP32865.1 - SEQ ID NO: 1: (AAP32865.1 glycoprotein E [Human alphaherpesvirus 3])) SEQ ID NO: 4 exemplary nucleotide sequence encoding VZV GlyE codon-optimised for humans SEQ ID NO: 5 ChAdOx2: Viral vector based on Chimpanzee adenovirus C68 SEQ ID NO: 6 bgh polyadenylation signal SEQ ID NO: 7 exemplary sequence of long CMV promoter Please note that ‘Gly E’ means glycoprotein E, and is sometimes referred to as ‘gE’.

    [0354] In one embodiment Gly E sequence having similarity to antigen insert SEQ ID NO: 1 of 50% or less may be used. In one embodiment Gly E sequence having similarity to antigen insert SEQ ID NO: 1 of 50% or more may be used, suitably 60% or more, suitably 70% or more, suitably 80% or more, suitably 90% or more, suitably 95% or more.

    TABLE-US-00007 SEQUENCE LISTING  SEQ ID NO: 1: exemplary Gly E sequence-GenBank accession number AAP32865.1-  (>A7P32865.1 glycoprotein E [Human alphaherpesvirus 3])(also  known as the amino acid sequence encoded by GenBank nucleotide  accession number AY253715.1): MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYEPYYHSDHAESSWVNRGESSRKAYDHN SPYIWPRNDYDGFLENAHEHHGVYNQGRGIDSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGD VFKGDLNPKPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTTCFQDVVVDV DCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTY ATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPM RLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDGGTTLKFVDT PESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVNPGTSPLLRYAAWTGGLA AVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEEFGNAIGGSHGGSSYTVYIDKTR SEQ ID NO: 2 exemplary VZV GlyE cassette amino acid sequence  (sometimes referred to as “Insert-protein”): MGTVNKPVVGVLMGFGIITGTLRITNPVRASVLRYDDFHIDEDKLDTNSVYEPYYHSDHA ESSWVNRGESSRKAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGIDSGERLMQPTQM SAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNPKPQGQRLIEVSVEENH PFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTTCFQDVVVDVDCAENT KEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYI WNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLA MHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHL AQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDGGTTLKFVDTPESLSGLYVFVV YFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVNPGTSPLLRYAA WTGGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEE EFGNAIGGSHGGSSYTVYIDKTR  SEQ ID NO: 3-wild type nucleotide sequence encoding VZV GlyE (Genbank accession  number AY253715.1;  this is the nucleotide sequence encoding the amino acid sequence  of accession number AAP32865.1-SEQ ID NO: 1:  (AAP32865.1 glycoprotein E [Human alphaherpesvirus 3])): ATGGGGACAGTTAATAAACCTGTGGTGGGGGTATTGATGGGGTTCGGAATTATCACGGGAACGTTGCGTATAACGAAT CCGGTCAGAGCATCCGTCTTGCGATACGATGATTTTCACATCGATGAAGACAAACTGGATACAAACTCCGTATATGAG CCTTACTACCATTCAGATCATGCGGAGTCTTCATGGGTAAATCGGGGAGAGTCTTCGCGAAAAGCGTACGATCATAAC TCACCTTATATATGGCCACGTAATGATTATGATGGATTTTTAGAGAACGCACACGAACACCATGGGGTGTATAATCAG GGCCGTGGTATCGATAGCGGGGAACGGTTAATGCAACCCACACAAATGTCTGCACAGGAGGATCTTGGGGACGATACG GGCATCCACGTTATCCCTACGTTAAACGGCGATGACAGACATAAAATTGTAAATGTGGACCAACGTCAATACGGTGAC GTGTTTAAAGGAGATCTTAATCCAAAACCCCAAGGCCAAAGACTCATTGAGGTGTCAGTGGAAGAAAATCACCCGTTT ACTTTACGCGCACCGATTCAGCGGATTTATGGAGTCCGGTACACCGAGACTTGGAGCTTTTTGCCGTCATTAACCTGT ACGGGAGACGCAGCGCCCGCCATCCAGCATATATGTTTAAAACATACAACATGCTTTCAAGACGTGGTGGTGGATGTG GATTGCGCGGAAAATACTAAAGAGGATCAGTTGGCCGAAATCAGTTACCGTTTTCAAGGTAAGAAGGAAGCGGACCAA CCGTGGATTGTTGTAAACACGAGCACACTGTTTGATGAACTCGAATTAGACCCCCCCGAGATTGAACCGGGTGTCTTG AAAGTACTTCGGACAGAAAAACAATACTTGGGTGTGTACATTTGGAACATGCGCGGCTCCGATGGTACGTCTACCTAC GCCACGTTTTTGGTCACCTGGAAAGGGGATGAAAAAACAAGAAACCCTACGCCCGCAGTAACTCCTCAACCAAGAGGG GCTGAGTTTCATATGTGGAATTACCACTCGCATGTATTTTCAGTTGGTGATACGTTTAGCTTGGCAATGCATCTTCAG TATAAGATACATGAAGCGCCATTTGATTTGCTGTTAGAGTGGTTGTATGTCCCCATCGATCCTACATGTCAACCAATG CGGTTATATTCTACGTGTTTGTATCATCCCAACGCACCCCAATGCCTCTCTCATATGAATTCCGGTTGTACATTTACC TCGCCACATTTAGCCCAGCGTGTTGCAAGCACAGTGTATCAAAATTGTGAACATGCAGATAACTACACCGCATATTGT CTGGGAATATCTCATATGGAGCCTAGCTTTGGTCTAATCTTACACGACGGGGGCACCACGTTAAAGTTTGTAGATACA CCCGAGAGTTTGTCGGGATTATACGTTTTTGTGGTGTATTTTAACGGGCATGTTGAAGCCGTAGCATACACTGTTGTA TCCACAGTAGATCATTTTGTAAACGCAATTGAAGAGCGTGGATTTCCGCCAACGGCCGGTCAGCCACCGGCGACTACT AAACCCAAGGAAATTACCCCCGTAAACCCCGGAACGTCACCACTTCTACGATATGCCGCATGGACCGGAGGGCTTGCA GCAGTAGTACTTTTATGTCTCGTAATATTTTTAATCTGTACGGCTAAACGAATGAGGGTTAAAGCCTATAGGGTAGAC AAGTCCCCGTATAACCAAAGCATGTATTACGCTGGCCTTCCAGTGGACGATTTCGAGGACTCGGAATCTACGGATACG GAAGAAGAGTTTGGTAACGCGATTGGAGGGAGTCACGGGGGTTCGAGTTACACGGTGTATATAGATAAGACCCGGTGA SEQ ID NO: 4-exemplary nucleotide sequence encoding VZV GlyE antigen  cassette/expression cassette  (sometimes referred to as “>Insert-Vaccine”) ATGGGCACCGTGAACAAGCCCGTCGTGGGCGTGCTGATGGGCTTCGGCATCATCACCGGCACCCTGCGGATCACCAAT CCTGTGCGGGCCAGCGTGCTGAGATACGACGACTTCCACATCGACGAGGACAAGCTGGACACCAACAGCGTGTACGAG CCCTACTACCACAGCGACCACGCCGAGAGCAGCTGGGTCAACAGAGGCGAGTCCAGCCGGAAGGCCTACGACCACAAC AGCCCCTACATCTGGCCCCGGAACGACTACGACGGCTTCCTGGAAAATGCCCACGAGCACCACGGCGTGTACAACCAG GGCAGAGGCATCGACAGCGGCGAGAGACTGATGCAGCCCACCCAGATGAGCGCCCAGGAAGATCTGGGCGACGACACC GGCATCCACGTGATCCCTACCCTGAACGGCGACGACCGGCACAAGATCGTGAACGTGGACCAGCGGCAGTACGGCGAC GTGTTCAAGGGCGACCTGAACCCCAAGCCCCAGGGACAGCGGCTGATTGAGGTGTCCGTGGAAGAGAACCACCCCTTC ACCCTGAGAGCCCCCATCCAGAGAATCTACGGCGTGCGCTATACCGAGACTTGGAGCTTCCTGCCCAGCCTGACCTGT ACTGGCGACGCCGCTCCTGCCATCCAGCACATCTGCCTGAAGCACACCACCTGTTTCCAGGACGTGGTGGTGGACGTG GACTGCGCCGAGAACACCAAAGAGGACCAGCTGGCCGAGATCAGCTACCGGTTCCAGGGCAAGAAAGAGGCCGACCAG CCCTGGATCGTCGTGAACACCAGCACCCTGTTCGACGAGCTGGAACTGGACCCCCCCGAGATTGAACCCGGGGTGCTG AAGGTGCTGCGGACCGAGAAGCAGTACCTGGGAGTGTACATCTGGAACATGCGGGGCAGCGACGGCACCTCTACCTAC GCCACCTTCCTCGTGACCTGGAAGGGCGACGAGAAAACCCGGAACCCTACCCCTGCCGTGACCCCTCAGCCTAGAGGC GCCGAGTTTCACATGTGGAATTACCACAGCCACGTGTTCAGCGTGGGCGACACCTTCTCCCTGGCCATGCATCTGCAG TACAAGATCCACGAGGCCCCCTTCGACCTGCTGCTGGAATGGCTGTACGTGCCCATCGACCCTACCTGCCAGCCCATG CGGCTGTACTCCACCTGTCTGTACCACCCCAACGCCCCCCAGTGCCTGAGCCACATGAATAGCGGCTGCACCTTCACC AGCCCCCACCTGGCTCAGAGGGTGGCCAGCACCGTGTACCAGAATTGCGAGCACGCCGACAACTACACCGCCTACTGC CTGGGCATCAGCCACATGGAACCTAGCTTCGGCCTGATCCTGCACGACGGCGGCACCACCCTGAAGTTCGTGGATACC CCAGAGAGCCTGAGCGGCCTGTACGTGTTCGTGGTGTACTTCAACGGCCACGTGGAAGCCGTGGCCTACACCGTGGTG TCCACCGTGGACCACTTCGTGAACGCCATCGAGGAACGGGGCTTCCCTCCAACTGCTGGACAGCCTCCTGCCACCACC AAGCCCAAAGAAATCACCCCCGTGAACCCCGGCACCAGCCCTCTGCTGCGCTATGCTGCTTGGACAGGCGGACTGGCT GCTGTGGTGCTGCTGTGCCTCGTGATTTTCCTGATCTGCACCGCCAAGCGGATGAGAGTGAAGGCCTATCGGGTGGAC AAGTCCCCCTACAACCAGAGCATGTACTACGCCGGCCTGCCCGTGGACGATTTCGAGGATAGCGAGAGCACCGACACC GAGGAAGAGTTCGGCAACGCCATTGGCGGCTCTCACGGCGGCAGCAGCTATACCGTGTACATCGACAAGACCCGCTGA SEQ ID NO: 5  ChAd0x2: Viral vector based on Chimpanzee adenovirus C68  ccatcttcaa taatatacct caaacttttt gtgcgcgtta atatgcaaat gaggcgtttg 60  aatttgggga ggaagggcgg tgattggtcg agggatgagc gaccgttagg ggcggggcga 120  gtgacgtttt gatgacgtgg ttgcgaggag gagccagttt gcaagttctc gtgggaaaag 180  tgacgtcaaa cgaggtgtgg tttgaacacg gaaatactca attttcccgc gctctctgac 240  aggaaatgag gtgtttctgg gcggatgcaa gtgaaaacgg gccattttcg cgcgaaaact 300  gaatgaggaa gtgaaaatct gagtaatttc gcgtttatgg cagggaggag tatttgccga 360  gggccgagta gactttgacc gattacgtgg gggtttcgat taccgtgttt ttcacctaaa 420  tttccgcgta cggtgtcaaa gtccggtgtt tttacgcgat cgctagcgac atcgatcaca 480  agtttgtaca aaaaagctga acgagaaacg taaaatgata taaatatcaa tatattaaat 540  tagattttgc ataaaaaaca gactacataa tactgtaaaa cacaacatat ccagtcacta 600  tggcggccgc cgatttattc aacaaagcca cgttgtgtct caaaatctct gatgttacat 660  tgcacaagat aaaaatatat catcatgaac aataaaactg tctgcttaca taaacagtaa 720  tacaaggggt gttatgagcc atattcaacg ggaaacgtct tgctcgaggc cgcgattaaa 780  ttccaacatg gatgctgatt tatatgggta taaatgggct cgtgataatg tcgggcaatc 840  aggtgcgaca atctatcgat tgtatgggaa gcccgatgcg ccagagttgt ttctgaaaca 900  tggcaaaggt agcgttgcca atgatgttac agatgagatg gtcagactaa actggctgac 960  ggaatttatg cctcttccga ccatcaagca ttttatccgt actcctgatg atgcatggtt 1020  actcaccact gcgatccccg ggaaaacagc attccaggta ttagaagaat atcctgattc 1080  aggtgaaaat attgttgatg cgctggcagt gttcctgcgc cggttgcatt cgattcctgt 1140  ttgtaattgt ccttttaaca gcgatcgcgt atttcgtctc gctcaggcgc aatcacgaat 1200  gaataacggt ttggttgatg cgagtgattt tgatgacgag cgtaatggct ggcctgttga 1260  acaagtctgg aaagaaatgc ataagctttt gccattctca ccggattcag tcgtcactca 1320  tggtgatttc tcacttgata accttatttt tgacgagggg aaattaatag gttgtattga 1380  tgttggacga gtcggaatcg cagaccgata ccaggatctt gccatcctat ggaactgcct 1440  cggtgagttt tctccttcat tacagaaacg gctttttcaa aaatatggta ttgataatcc 1500  tgatatgaat aaattgcagt ttcatttgat gctcgatgag tttttctaat cagaattggt 1560  taattggttg taacactggc acgcgtggat ccggcttact aaaagccaga taacagtatg 1620  cgtatttgcg cgctgatttt tgcggtataa gaatatatac tgatatgtat acccgaagta 1680  tgtcaaaaag aggtatgcta tgaagcagcg tattacagtg acagttgaca gcgacagcta 1740  tcagttgctc aaggcatata tgatgtcaat atctccggtc tggtaagcac aaccatgcag 1800  aatgaagccc gtcgtctgcg tgccgaacgc tggaaagcgg aaaatcagga agggatggct 1860  gaggtcgccc ggtttattga aatgaacggc tcttttgctg acgagaacag gggctggtga 1920  aatgcagttt aaggtttaca cctataaaag agagagccgt tatcgtctgt ttgtggatgt 1980  acagagtgat attattgaca cgcccgggcg acggatggtg atccccctgg ccagtgcacg 2040  tctgctgtca gataaagtct cccgtgaact ttacccggtg gtgcatatcg gggatgaaag 2100  ctggcgcatg atgaccaccg atatggccag tgtgccggtc tccgttatcg gggaagaagt 2160  ggctgatctc agccaccgcg aaaatgacat caaaaacgcc attaacctga tgttctgggg 2220  aatataaatg tcaggctccc ttatacacag ccagtctgca ggtcgaccat agtgactgga 2280  tatgttgtgt tttacagtat tatgtagtct gttttttatg caaaatctaa tttaatatat 2340  tgatatttat atcattttac gtttctcgtt cagctttctt gtacaaagtg gtgatcgatt 2400  cgacagatcg cgatcgcaag tgagtagtgt tctggggcgg gggaggacct gcatgagggc 2460  cagaataact gaaatctgtg cttttctgtg tgttgcagca gcatgagcgg aagcggctcc 2520  tttgagggag gggtattcag cccttatctg acggggcgtc tcccctcctg ggcgggagtg 2580  cgtcagaatg tgatgggatc cacggtggac ggccggcccg tgcagcccgc gaactcttca 2640  accctgacct atgcaaccct gagctcttcg tcgttggacg cagctgccgc cgcagctgct 2700  gcatctgccg ccagcgccgt gcgcggaatg gccatgggcg ccggctacta cggcactctg 2760  gtggccaact cgagttccac caataatccc gccagcctga acgaggagaa gctgttgctg 2820  ctgatggccc agctcgaggc cttgacccag cgcctgggcg agctgaccca gcaggtggct 2880  cagctgcagg agcagacgcg ggccgcggtt gccacggtga aatccaaata aaaaatgaat 2940  caataaataa acggagacgg ttgttgattt taacacagag tctgaatctt tatttgattt 3000  ttcgcgcgcg gtaggccctg gaccaccggt ctcgatcatt gagcacccgg tggatctttt 3060  ccaggacccg gtagaggtgg gcttggatgt tgaggtacat gggcatgagc ccgtcccggg 3120  ggtggaggta gctccattgc agggcctcgt gctcgggggt ggtgttgtaa atcacccagt 3180  catagcaggg gcgcagggca tggtgttgca caatatcttt gaggaggaga ctgatggcca 3240  cgggcagccc tttggtgtag gtgtttacaa atctgttgag ctgggaggga tgcatgcggg 3300  gggagatgag gtgcatcttg gcctggatct tgagattggc gatgttaccg cccagatccc 3360  gcctggggtt catgttgtgc aggaccacca gcacggtgta tccggtgcac ttggggaatt 3420  tatcatgcaa cttggaaggg aaggcgtgaa agaatttggc gacgcctttg tgcccgccca 3480  ggttttccat gcactcatcc atgatgatgg cgatgggccc gtgggcggcg gcctgggcaa 3540  agacgtttcg ggggtcggac acatcatagt tgtggtcctg ggtgaggtca tcataggcca 3600  ttttaatgaa tttggggcgg agggtgccgg actgggggac aaaggtaccc tcgatcccgg 3660  gggcgtagtt cccctcacag atctgcatct cccaggcttt gagctcggag ggggggatca 3720  tgtccacctg cggggcgata aagaacacgg tttccggggc gggggagatg agctgggccg 3780  aaagcaagtt ccggagcagc tgggacttgc cgcagccggt ggggccgtag atgaccccga 3840  tgaccggctg caggtggtag ttgagggaga gacagctgcc gtcctcccgg aggagggggg 3900  ccacctcgtt catcatctcg cgcacgtgca tgttctcgcg caccagttcc gccaggaggc 3960  gctctccccc cagggatagg agctcctgga gcgaggcgaa gtttttcagc ggcttgagtc 4020  cgtcggccat gggcattttg gagagggttt gttgcaagag ttccaggcgg tcccagagct 4080  cggtgatgtg ctctacggca tctcgatcca gcagacctcc tcgtttcgcg ggttgggacg 4140  gctgcgggag tagggcacca gacgatgggc gtccagcgca gccagggtcc ggtccttcca 4200  gggtcgcagc gtccgcgtca gggtggtctc cgtcacggtg aaggggtgcg cgccgggctg 4260  ggcgcttgcg agggtgcgct tcaggctcat ccggctggtc gaaaaccgct cccgatcggc 4320  gccctgcgcg tcggccaggt agcaattgac catgagttcg tagttgagcg cctcggccgc 4380  gtggcctttg gcgcggagct tacctttgga agtctgcccg caggcgggac agaggaggga 4440  cttgagggcg tagagcttgg gggcgaggaa gacggactcg ggggcgtagg cgtccgcgcc 4500  gcagtgggcg cagacggtct cgcactccac gagccaggtg aggtcgggct ggtcggggtc 4560  aaaaaccagt ttcccgccgt tctttttgat gcgtttctta cctttggtct ccatgagctc 4620  gtgtccccgc tgggtgacaa agaggctgtc cgtgtccccg tagaccgact ttatgggccg 4680  gtcctcgagc ggtgtgccgc ggtcctcctc gtagaggaac cccgcccact ccgagacgaa 4740  agcccgggtc caggccagca cgaaggaggc cacgtgggac gggtagcggt cgttgtccac 4800  cagcgggtcc accttttcca gggtatgcaa acacatgtcc ccctcgtcca catccaggaa 4860  ggtgattggc ttgtaagtgt aggccacgtg accgggggtc ccggccgggg gggtataaaa 4920  gggtgcgggt ccctgctcgt cctcactgtc ttccggatcg ctgtccagga gcgccagctg 4980  ttggggtagg tattccctct cgaaggcggg catgacctcg gcactcaggt tgtcagtttc 5040  tagaaacgag gaggatttga tattgacggt gccggcggag atgcctttca agagcccctc 5100  gtccatctgg tcagaaaaga cgatcttttt gttgtcgagc ttggtggcga aggagccgta 5160  gagggcgttg gagaggagct tggcgatgga gcgcatggtc tggttttttt ccttgtcggc 5220  gcgctccttg gcggcgatgt tgagctgcac gtactcgcgc gccacgcact tccattcggg 5280  gaagacggtg gtcagctcgt cgggcacgat tctgacctgc cagccccgat tatgcagggt 5340  gatgaggtcc acactggtgg ccacctcgcc gcgcaggggc tcattagtcc agcagaggcg 5400  tccgcccttg cgcgagcaga aggggggcag ggggtccagc atgacctcgt cgggggggtc 5460  ggcatcgatg gtgaagatgc cgggcaggag gtcggggtca aagtagctga tggaagtggc 5520  cagatcgtcc agggcagctt gccattcgcg cacggccagc gcgcgctcgt agggactgag 5580  gggcgtgccc cagggcatgg gatgggtaag cgcggaggcg tacatgccgc agatgtcgta 5640  gacgtagagg ggctcctcga ggatgccgat gtaggtgggg tagcagcgcc ccccgcggat 5700  gctggcgcgc acgtagtcat acagctcgtg cgagggggcg aggagccccg ggcccaggtt 5760  ggtgcgactg ggcttttcgg cgcggtagac gatctggcgg aaaatggcat gcgagttgga 5820  ggagatggtg ggcctttgga agatgttgaa gtgggcgtgg ggcagtccga ccgagtcgcg 5880  gatgaagtgg gcgtaggagt cttgcagctt ggcgacgagc tcggcggtga ctaggacgtc 5940  cagagcgcag tagtcgaggg tctcctggat gatgtcatac ttgagctgtc ccttttgttt 6000  ccacagctcg cggttgagaa ggaactcttc gcggtccttc cagtactctt cgagggggaa 6060  cccgtcctga tctgcacggt aagagcctag catgtagaac tggttgacgg ccttgtaggc 6120  gcagcagccc ttctccacgg ggagggcgta ggcctgggcg gccttgcgca gggaggtgtg 6180  cgtgagggcg aaagtgtccc tgaccatgac cttgaggaac tggtgcttga agtcgatatc 6240  gtcgcagccc ccctgctccc agagctggaa gtccgtgcgc ttcttgtagg cggggttggg 6300  caaagcgaaa gtaacatcgt tgaagaggat cttgcccgcg cggggcataa agttgcgagt 6360  gatgcggaaa ggttggggca cctcggcccg gttgttgatg acctgggcgg cgagcacgat 6420  ctcgtcgaag ccgttgatgt tgtggcccac gatgtagagt tccacgaatc gcggacggcc 6480  cttgacgtgg ggcagtttct tgagctcctc gtaggtgagc tcgtcggggt cgctgagccc 6540  gtgctgctcg agcgcccagt cggcgagatg ggggttggcg cggaggaagg aagtccagag 6600  atccacggcc agggcggttt gcagacggtc ccggtactga cggaactgct gcccgacggc 6660  cattttttcg ggggtgacgc agtagaaggt gcgggggtcc ccgtgccagc gatcccattt 6720  gagctggagg gcgagatcga gggcgagctc gacgagccgg tcgtccccgg agagtttcat 6780  gaccagcatg aaggggacga gctgcttgcc gaaggacccc atccaggtgt aggtttccac 6840  atcgtaggtg aggaagagcc tttcggtgcg aggatgcgag ccgatgggga agaactggat 6900  ctcctgccac caattggagg aatggctgtt gatgtgatgg aagtagaaat gccgacggcg 6960  cgccgaacac tcgtgcttgt gtttatacaa gcggccacag tgctcgcaac gctgcacggg 7020  atgcacgtgc tgcacgagct gtacctgagt tcctttgacg aggaatttca gtgggaagtg 7080  gagtcgtggc gcctgcatct cgtgctgtac tacgtcgtgg tggtcggcct ggccctcttc 7140  tgcctcgatg gtggtcatgc tgacgagccc gcgcgggagg caggtccaga cctcggcgcg 7200  agcgggtcgg agagcgagga cgagggcgcg caggccggag ctgtccaggg tcctgagacg 7260  ctgcggagtc aggtcagtgg gcagcggcgg cgcgcggttg acttgcagga gtttttccag 7320  ggcgcgcggg aggtccagat ggtacttgat ctccaccgcg ccattggtgg cgacgtcgat 7380  ggcttgcagg gtcccgtgcc cctggggtgt gaccaccgtc ccccgtttct tcttgggcgg 7440  ctggggcgac gggggcggtg cctcttccat ggttagaagc ggcggcgagg acgcgcgccg 7500  ggcggcaggg gcggctcggg gcccggaggc aggggcggca ggggcacgtc ggcgccgcgc 7560  gcgggtaggt tctggtactg cgcccggaga agactggcgt gagcgacgac gcgacggttg 7620  acgtcctgga tctgacgcct ctgggtgaag gccacgggac ccgtgagttt gaacctgaaa 7680  gagagttcga cagaatcaat ctcggtatcg ttgacggcgg cctgccgcag gatctcttgc 7740  acgtcgcccg agttgtcctg gtaggcgatc tcggtcatga actgctcgat ctcctcctct 7800  tgaaggtctc cgcggccggc gcgctccacg gtggccgcga ggtcgttgga gatgcggccc 7860  atgagctgcg agaaggcgtt catgcccgcc tcgttccaga cgcggctgta gaccacgacg 7920  ccctcgggat cgccggcgcg catgaccacc tgggcgaggt tgagctccac gtggcgcgtg 7980  aagaccgcgt agttgcagag gcgctggtag aggtagttga gcgtggtggc gatgtgctcg 8040  gtgacgaaga aatacatgat ccagcggcgg agcggcatct cgctgacgtc gcccagcgcc 8100  tccaaacgtt ccatggcctc gtaaaagtcc acggcgaagt tgaaaaactg ggagttgcgc 8160  gccgagacgg tcaactcctc ctccagaaga cggatgagct cggcgatggt ggcgcgcacc 8220  tcgcgctcga aggcccccgg gagttcctcc acttcctctt cttcctcctc cactaacatc 8280  tcttctactt cctcctcagg cggcagtggt ggcgggggag ggggcctgcg tcgccggcgg 8340  cgcacgggca gacggtcgat gaagcgctcg atggtctcgc cgcgccggcg tcgcatggtc 8400  tcggtgacgg cgcgcccgtc ctcgcggggc cgcagcgtga agacgccgcc gcgcatctcc 8460  aggtggccgg gggggtcccc gttgggcagg gagagggcgc tgacgatgca tcttatcaat 8520  tgccccgtag ggactccgcg caaggacctg agcgtctcga gatccacggg atctgaaaac 8580  cgctgaacga aggcttcgag ccagtcgcag tcgcaaggta ggctgagcac ggtttcttct 8640  ggcgggtcat gttggttggg agcggggcgg gcgatgctgc tggtgatgaa gttgaaatag 8700  gcggttctga gacggcggat ggtggcgagg agcaccaggt ctttgggccc ggcttgctgg 8760  atgcgcagac ggtcggccat gccccaggcg tggtcctgac acctggccag gtccttgtag 8820  tagtcctgca tgagccgctc cacgggcacc tcctcctcgc ccgcgcggcc gtgcatgcgc 8880  gtgagcccga agccgcgctg gggctggacg agcgccaggt cggcgacgac gcgctcggcg 8940  aggatggctt gctggatctg ggtgagggtg gtctggaagt catcaaagtc gacgaagcgg 9000  tggtaggctc cggtgttgat ggtgtaggag cagttggcca tgacggacca gttgacggtc 9060  tggtggcccg gacgcacgag ctcgtggtac ttgaggcgcg agtaggcgcg cgtgtcgaag 9120  atgtagtcgt tgcaggtgcg caccaggtac tggtagccga tgaggaagtg cggcggcggc 9180  tggcggtaga gcggccatcg ctcggtggcg ggggcgccgg gcgcgaggtc ctcgagcatg 9240  gtgcggtggt agccgtagat gtacctggac atccaggtga tgccggcggc ggtggtggag 9300  gcgcgcggga actcgcggac gcggttccag atgttgcgca gcggcaggaa gtagttcatg 9360  gtgggcacgg tctggcccgt gaggcgcgcg cagtcgtgga tgctctatac gggcaaaaac 9420  gaaagcggtc agcggctcga ctccgtggcc tggaggctaa gcgaacgggt tgggctgcgc 9480  gtgtaccccg gttcgaatct cgaatcaggc tggagccgca gctaacgtgg tattggcact 9540  cccgtctcga cccaagcctg caccaaccct ccaggatacg gaggcgggtc gttttgcaac 9600  ttttttttgg aggccggatg agactagtaa gcgcggaaag cggccgaccg cgatggctcg 9660  ctgccgtagt ctggagaaga atcgccaggg ttgcgttgcg gtgtgccccg gttcgaggcc 9720  ggccggattc cgcggctaac gagggcgtgg ctgccccgtc gtttccaaga ccccatagcc 9780  agccgacttc tccagttacg gagcgagccc ctcttttgtt ttgtttgttt ttgccagatg 9840  catcccgtac tgcggcagat gcgcccccac caccctccac cgcaacaaca gccccctcca 9900  cagccggcgc ttctgccccc gccccagcag caacttccag ccacgaccgc cgcggccgcc 9960  gtgagcgggg ctggacagag ttatgatcac cagctggcct tggaagaggg cgaggggctg 10020  gcgcgcctgg gggcgtcgtc gccggagcgg cacccgcgcg tgcagatgaa aagggacgct 10080  cgcgaggcct acgtgcccaa gcagaacctg ttcagagaca ggagcggcga ggagcccgag 10140  gagatgcgcg cggcccggtt ccacgcgggg cgggagctgc ggcgcggcct ggaccgaaag 10200  agggtgctga gggacgagga tttcgaggcg gacgagctga cggggatcag ccccgcgcgc 10260  gcgcacgtgg ccgcggccaa cctggtcacg gcgtacgagc agaccgtgaa ggaggagagc 10320  aacttccaaa aatccttcaa caaccacgtg cgcaccctga tcgcgcgcga ggaggtgacc 10380  ctgggcctga tgcacctgtg ggacctgctg gaggccatcg tgcagaaccc caccagcaag 10440  ccgctgacgg cgcagctgtt cctggtggtg cagcatagtc gggacaacga agcgttcagg 10500  gaggcgctgc tgaatatcac cgagcccgag ggccgctggc tcctggacct ggtgaacatt 10560  ctgcagagca tcgtggtgca ggagcgcggg ctgccgctgt ccgagaagct ggcggccatc 10620  aacttctcgg tgctgagttt gggcaagtac tacgctagga agatctacaa gaccccgtac 10680  gtgcccatag acaaggaggt gaagatcgac gggttttaca tgcgcatgac cctgaaagtg 10740  ctgaccctga gcgacgatct gggggtgtac cgcaacgaca ggatgcaccg tgcggtgagc 10800  gccagcaggc ggcgcgagct gagcgaccag gagctgatgc atagtctgca gcgggccctg 10860  accggggccg ggaccgaggg ggagagctac tttgacatgg gcgcggacct gcactggcag 10920  cccagccgcc gggccttgga ggcggcggca ggaccctacg tagaagaggt ggacgatgag 10980  gtggacgagg agggcgagta cctggaagac tgatggcgcg accgtatttt tgctagatgc 11040  aacaacaaca gccacctcct gatcccgcga tgcgggcggc gctgcagagc cagccgtccg 11100  gcattaactc ctcggacgat tggacccagg ccatgcaacg catcatggcg ctgacgaccc 11160  gcaaccccga agcctttaga cagcagcccc aggccaaccg gctctcggcc atcctggagg 11220  ccgtggtgcc ctcgcgctcc aaccccacgc acgagaaggt cctggccatc gtgaacgcgc 11280  tggtggagaa caaggccatc cgcggcgacg aggccggcct ggtgtacaac gcgctgctgg 11340  agcgcgtggc ccgctacaac agcaccaacg tgcagaccaa cctggaccgc atggtgaccg 11400  acgtgcgcga ggccgtggcc cagcgcgagc ggttccaccg cgagtccaac ctgggatcca 11460  tggtggcgct gaacgccttc ctcagcaccc agcccgccaa cgtgccccgg ggccaggagg 11520  actacaccaa cttcatcagc gccctgcgcc tgatggtgac cgaggtgccc cagagcgagg 11580  tgtaccagtc cgggccggac tacttcttcc agaccagtcg ccagggcttg cagaccgtga 11640  acctgagcca ggctttcaag aacttgcagg gcctgtgggg cgtgcaggcc ccggtcgggg 11700  accgcgcgac ggtgtcgagc ctgctgacgc cgaactcgcg cctgctgctg ctgctggtgg 11760  cccccttcac ggacagcggc agcatcaacc gcaactcgta cctgggctac ctgattaacc 11820  tgtaccgcga ggccatcggc caggcgcacg tggacgagca gacctaccag gagatcaccc 11880  acgtgagccg cgccctgggc caggacgacc cgggcaacct ggaagccacc ctgaactttt 11940  tgctgaccaa ccggtcgcag aagatcccgc cccagtacgc gctcagcacc gaggaggagc 12000  gcatcctgcg ttacgtgcag cagagcgtgg gcctgttcct gatgcaggag ggggccaccc 12060  ccagcgccgc gctcgacatg accgcgcgca acatggagcc cagcatgtac gccagcaacc 12120  gcccgttcat caataaactg atggactact tgcatcgggc ggccgccatg aactctgact 12180  atttcaccaa cgccatcctg aatccccact ggctcccgcc gccggggttc tacacgggcg 12240  agtacgacat gcccgacccc aatgacgggt tcctgtggga cgatgtggac agcagcgtgt 12300  tctccccccg accgggtgct aacgagcgcc ccttgtggaa gaaggaaggc agcgaccgac 12360  gcccgtcctc ggcgctgtcc ggccgcgagg gtgctgccgc ggcggtgccc gaggccgcca 12420  gtcctttccc gagcttgccc ttctcgctga acagtatccg cagcagcgag ctgggcagga 12480  tcacgcgccc gcgcttgctg ggcgaagagg agtacttgaa tgactcgctg ttgagacccg 12540  agcgggagaa gaacttcccc aataacggga tagaaagcct ggtggacaag atgagccgct 12600  ggaagacgta tgcgcaggag cacagggacg atccccgggc gtcgcagggg gccacgagcc 12660  ggggcagcgc cgcccgtaaa cgccggtggc acgacaggca gcggggacag atgtgggacg 12720  atgaggactc cgccgacgac agcagcgtgt tggacttggg tgggagtggt aacccgttcg 12780  ctcacctgcg cccccgtatc gggcgcatga tgtaagagaa accgaaaata aatgatactc 12840  accaaggcca tggcgaccag cgtgcgttcg tttcttctct gttgttgttg tatctagtat 12900  gatgaggcgt gcgtacccgg agggtcctcc tccctcgtac gagagcgtga tgcagcaggc 12960  gatggcggcg gcggcgatgc agcccccgct ggaggctcct tacgtgcccc cgcggtacct 13020  ggcgcctacg gaggggcgga acagcattcg ttactcggag ctggcaccct tgtacgatac 13080  cacccggttg tacctggtgg acaacaagtc ggcggacatc gcctcgctga actaccagaa 13140  cgaccacagc aacttcctga ccaccgtggt gcagaacaat gacttcaccc ccacggaggc 13200  cagcacccag accatcaact ttgacgagcg ctcgcggtgg ggcggccagc tgaaaaccat 13260  catgcacacc aacatgccca acgtgaacga gttcatgtac agcaacaagt tcaaggcgcg 13320  ggtgatggtc tcccgcaaga cccccaatgg ggtgacagtg acagaggatt atgatggtag 13380  tcaggatgag ctgaagtatg aatgggtgga atttgagctg cccgaaggca acttctcggt 13440  gaccatgacc atcgacctga tgaacaacgc catcatcgac aattacttgg cggtggggcg 13500  gcagaacggg gtgctggaga gcgacatcgg cgtgaagttc gacactagga acttcaggct 13560  gggctgggac cccgtgaccg agctggtcat gcccggggtg tacaccaacg aggctttcca 13620  tcccgatatt gtcttgctgc ccggctgcgg ggtggacttc accgagagcc gcctcagcaa 13680  cctgctgggc attcgcaaga ggcagccctt ccaggaaggc ttccagatca tgtacgagga 13740  tctggagggg ggcaacatcc ccgcgctcct ggatgtcgac gcctatgaga aaagcaagga 13800  ggatgcagca gctgaagcaa ctgcagccgt agctaccgcc tctaccgagg tcaggggcga 13860  taattttgca agcgccgcag cagtggcagc ggccgaggcg gctgaaaccg aaagtaagat 13920  agtcattcag ccggtggaga aggatagcaa gaacaggagc tacaacgtac taccggacaa 13980  gataaacacc gcctaccgca gctggtacct agcctacaac tatggcgacc ccgagaaggg 14040  cgtgcgctcc tggacgctgc tcaccacctc ggacgtcacc tgcggcgtgg agcaagtcta 14100  ctggtcgctg cccgacatga tgcaagaccc ggtcaccttc cgctccacgc gtcaagttag 14160  caactacccg gtggtgggcg ccgagctcct gcccgtctac tccaagagct tcttcaacga 14220  gcaggccgtc tactcgcagc agctgcgcgc cttcacctcg cttacgcacg tcttcaaccg 14280  cttccccgag aaccagatcc tcgtccgccc gcccgcgccc accattacca ccgtcagtga 14340  aaacgttcct gctctcacag atcacgggac cctgccgctg cgcagcagta tccggggagt 14400  ccagcgcgtg accgttactg acgccagacg ccgcacctgc ccctacgtct acaaggccct 14460  gggcatagtc gcgccgcgcg tcctctcgag ccgcaccttc taaatgtcca ttctcatctc 14520  gcccagtaat aacaccggtt ggggcctgcg cgcgcccagc aagatgtacg gaggcgctcg 14580  ccaacgctcc acgcaacacc ccgtgcgcgt gcgcgggcac ttccgcgctc cctggggcgc 14640  cctcaagggc cgcgtgcggt cgcgcaccac cgtcgacgac gtgatcgacc aggtggtggc 14700  cgacgcgcgc aactacaccc ccgccgccgc gcccgtctcc accgtggacg ccgtcatcga 14760  cagcgtggtg gcggacgcgc gccggtacgc ccgcgccaag agccggcggc ggcgcatcgc 14820  ccggcggcac cggagcaccc ccgccatgcg cgcggcgcga gccttgctgc gcagggccag 14880  gcgcacggga cgcagggcca tgctcagggc ggccagacgc gcggcttcag gcgccagcgc 14940  cggcaggacc cggagacgcg cggccacggc ggcggcagcg gccatcgcca gcatgtcccg 15000  cccgcggcga gggaacgtgt actgggtgcg cgacgccgcc accggtgtgc gcgtgcccgt 15060  gcgcacccgc ccccctcgca cttgaagatg ttcacttcgc gatgttgatg tgtcccagcg 15120  gcgaggagga tgtccaagcg caaattcaag gaagagatgc tccaggtcat cgcgcctgag 15180  atctacggcc ctgcggtggt gaaggaggaa agaaagcccc gcaaaatcaa gcgggtcaaa 15240  aaggacaaaa aggaagaaga aagtgatgtg gacggattgg tggagtttgt gcgcgagttc 15300  gccccccggc ggcgcgtgca gtggcgcggg cggaaggtgc aaccggtgct gagacccggc 15360  accaccgtgg tcttcacgcc cggcgagcgc tccggcaccg cttccaagcg ctcctacgac 15420  gaggtgtacg gggatgatga tattctggag caggcggccg agcgcctggg cgagtttgct 15480  tacggcaagc gcagccgttc cgcaccgaag gaagaggcgg tgtccatccc gctggaccac 15540  ggcaacccca cgccgagcct caagcccgtg accttgcagc aggtgctgcc gaccgcggcg 15600  ccgcgccggg ggttcaagcg cgagggcgag gatctgtacc ccaccatgca gctgatggtg 15660  cccaagcgcc agaagctgga agacgtgctg gagaccatga aggtggaccc ggacgtgcag 15720  cccgaggtca aggtgcggcc catcaagcag gtggccccgg gcctgggcgt gcagaccgtg 15780  gacatcaaga ttcccacgga gcccatggaa acgcagaccg agcccatgat caagcccagc 15840  accagcacca tggaggtgca gacggatccc tggatgccat cggctcctag tcgaagaccc 15900  cggcgcaagt acggcgcggc cagcctgctg atgcccaact acgcgctgca tccttccatc 15960  atccccacgc cgggctaccg cggcacgcgc ttctaccgcg gtcataccag cagccgccgc 16020  cgcaagacca ccactcgccg ccgccgtcgc cgcaccgccg ctgcaaccac ccctgccgcc 16080  ctggtgcgga gagtgtaccg ccgcggccgc gcacctctga ccctgccgcg cgcgcgctac 16140  cacccgagca tcgccattta aactttcgcc agctttgcag atcaatggcc ctcacatgcc 16200  gccttcgcgt tcccattacg ggctaccgag gaagaaaacc gcgccgtaga aggctggcgg 16260  ggaacgggat gcgtcgccac caccaccggc ggcggcgcgc catcagcaag cggttggggg 16320  gaggcttcct gcccgcgctg atccccatca tcgccgcggc gatcggggcg atccccggca 16380  ttgcttccgt ggcggtgcag gcctctcagc gccactgaga cacacttgga aacatcttgt 16440  aataaaccca tggactctga cgctcctggt cctgtgatgt gttttcgtag acagatggaa 16500  gacatcaatt tttcgtccct ggctccgcga cacggcacgc ggccgttcat gggcacctgg 16560  agcgacatcg gcaccagcca actgaacggg ggcgccttca attggagcag tctctggagc 16620  gggcttaaga atttcgggtc cacgcttaaa acctatggca gcaaggcgtg gaacagcacc 16680  acagggcagg cgctgaggga taagctgaaa gagcagaact tccagcagaa ggtggtcgat 16740  gggctcgcct cgggcatcaa cggggtggtg gacctggcca accaggccgt gcagcggcag 16800  atcaacagcc gcctggaccc ggtgccgccc gccggctccg tggagatgcc gcaggtggag 16860  gaggagctgc ctcccctgga caagcggggc gagaagcgac cccgccccga tgcggaggag 16920  acgctgctga cgcacacgga cgagccgccc ccgtacgagg aggcggtgaa actgggtctg 16980  cccaccacgc ggcccatcgc gcccctggcc accggggtgc tgaaacccga aaagcccgcg 17040  accctggact tgcctcctcc ccagccttcc cgcccctcta cagtggctaa gcccctgccg 17100  ccggtggccg tggcccgcgc gcgacccggg ggcaccgccc gccctcatgc gaactggcag 17160  agcactctga acagcatcgt gggtctggga gtgcagagtg tgaagcgccg ccgctgctat 17220  taaacctacc gtagcgctta acttgcttgt ctgtgtgtgt atgtattatg tcgccgccgc 17280  cgctgtccac cagaaggagg agtgaagagg cgcgtcgccg agttgcaaga tggccacccc 17340  atcgatgctg ccccagtggg cgtacatgca catcgccgga caggacgctt cggagtacct 17400  gagtccgggt ctggtgcagt ttgcccgcgc cacagacacc tacttcagtc tggggaacaa 17460  gtttaggaac cccacggtgg cgcccacgca cgatgtgacc accgaccgca gccagcggct 17520  gacgctgcgc ttcgtgcccg tggaccgcga ggacaacacc tactcgtaca aagtgcgcta 17580  cacgctggcc gtgggcgaca accgcgtgct ggacatggcc agcacctact ttgacatccg 17640  cggcgtgctg gatcggggcc ctagcttcaa accctactcc ggcaccgcct acaacagtct 17700  ggcccccaag ggagcaccca acacttgtca gtggacatat aaagccgatg gtgaaactgc 17760  cacagaaaaa acctatacat atggaaatgc acccgtgcag ggcattaaca tcacaaaaga 17820  tggtattcaa cttggaactg acaccgatga tcagccaatc tacgcagata aaacctatca 17880  gcctgaacct caagtgggtg atgctgaatg gcatgacatc actggtactg atgaaaagta 17940  tggaggcaga gctcttaagc ctgataccaa aatgaagcct tgttatggtt cttttgccaa 18000  gcctactaat aaagaaggag gtcaggcaaa tgtgaaaaca ggaacaggca ctactaaaga 18060  atatgacata gacatggctt tctttgacaa cagaagtgcg gctgctgctg gcctagctcc 18120  agaaattgtt ttgtatactg aaaatgtgga tttggaaact ccagataccc atattgtata 18180  caaagcaggc acagatgaca gcagctcttc tattaatttg ggtcagcaag ccatgcccaa 18240  cagacctaac tacattggtt tcagagacaa ctttatcggg ctcatgtact acaacagcac 18300  tggcaatatg ggggtgctgg ccggtcaggc ttctcagctg aatgctgtgg ttgacttgca 18360  agacagaaac accgagctgt cctaccagct cttgcttgac tctctgggtg acagaacccg 18420  gtatttcagt atgtggaatc aggcggtgga cagctatgat cctgatgtgc gcattattga 18480  aaatcatggt gtggaggatg aacttcccaa ctattgtttc cctctggatg ctgttggcag 18540  aacagatact tatcagggaa ttaaggctaa tggaactgat caaaccacat ggaccaaaga 18600  tgacagtgtc aatgatgcta atgagatagg caagggtaat ccattcgcca tggaaatcaa 18660  catccaagcc aacctgtgga ggaacttcct ctacgccaac gtggccctgt acctgcccga 18720  ctcttacaag tacacgccgg ccaatgttac cctgcccacc aacaccaaca cctacgatta 18780  catgaacggc cgggtggtgg cgccctcgct ggtggactcc tacatcaaca tcggggcgcg 18840  ctggtcgctg gatcccatgg acaacgtgaa ccccttcaac caccaccgca atgcggggct 18900  gcgctaccgc tccatgctcc tgggcaacgg gcgctacgtg cccttccaca tccaggtgcc 18960  ccagaaattt ttcgccatca agagcctcct gctcctgccc gggtcctaca cctacgagtg 19020  gaacttccgc aaggacgtca acatgatcct gcagagctcc ctcggcaacg acctgcgcac 19080  ggacggggcc tccatctcct tcaccagcat caacctctac gccaccttct tccccatggc 19140  gcacaacacg gcctccacgc tcgaggccat gctgcgcaac gacaccaacg accagtcctt 19200  caacgactac ctctcggcgg ccaacatgct ctaccccatc ccggccaacg ccaccaacgt 19260  gcccatctcc atcccctcgc gcaactgggc cgccttccgc ggctggtcct tcacgcgtct 19320  caagaccaag gagacgccct cgctgggctc cgggttcgac ccctacttcg tctactcggg 19380  ctccatcccc tacctcgacg gcaccttcta cctcaaccac accttcaaga aggtctccat 19440  caccttcgac tcctccgtca gctggcccgg caacgaccgg ctcctgacgc ccaacgagtt 19500  cgaaatcaag cgcaccgtcg acggcgaggg ctacaacgtg gcccagtgca acatgaccaa 19560  ggactggttc ctggtccaga tgctggccca ctacaacatc ggctaccagg gcttctacgt 19620  gcccgagggc tacaaggacc gcatgtactc cttcttccgc aacttccagc ccatgagccg 19680  ccaggtggtg gacgaggtca actacaagga ctaccaggcc gtcaccctgg cctaccagca 19740  caacaactcg ggcttcgtcg gctacctcgc gcccaccatg cgccagggcc agccctaccc 19800  cgccaactac ccctacccgc tcatcggcaa gagcgccgtc accagcgtca cccagaaaaa 19860  gttcctctgc gacagggtca tgtggcgcat ccccttctcc agcaacttca tgtccatggg 19920  cgcgctcacc gacctcggcc agaacatgct ctatgccaac tccgcccacg cgctagacat 19980  gaatttcgaa gtcgacccca tggatgagtc cacccttctc tatgttgtct tcgaagtctt 20040  cgacgtcgtc cgagtgcacc agccccaccg cggcgtcatc gaggccgtct acctgcgcac 20100  ccccttctcg gccggtaacg ccaccaccta agctcttgct tcttgcaagc catggccgcg 20160  ggctccggcg agcaggagct cagggccatc atccgcgacc tgggctgcgg gccctacttc 20220  ctgggcacct tcgataagcg cttcccggga ttcatggccc cgcacaagct ggcctgcgcc 20280  atcgtcaaca cggccggccg cgagaccggg ggcgagcact ggctggcctt cgcctggaac 20340  ccgcgctcga acacctgcta cctcttcgac cccttcgggt tctcggacga gcgcctcaag 20400  cagatctacc agttcgagta cgagggcctg ctgcgccgca gcgccctggc caccgaggac 20460  cgctgcgtca ccctggaaaa gtccacccag accgtgcagg gtccgcgctc ggccgcctgc 20520  gggctcttct gctgcatgtt cctgcacgcc ttcgtgcact ggcccgaccg ccccatggac 20580  aagaacccca ccatgaactt gctgacgggg gtgcccaacg gcatgctcca gtcgccccag 20640  gtggaaccca ccctgcgccg caaccaggag gcgctctacc gcttcctcaa ctcccactcc 20700  gcctactttc gctcccaccg cgcgcgcatc gagaaggcca ccgccttcga ccgcatgaat 20760  caagacatgt aaaccgtgtg tgtatgttaa atgtctttaa taaacagcac tttcatgtta 20820  cacatgcatc tgagatgatt tatttagaaa tcgaaagggt tctgccgggt ctcggcatgg 20880  cccgcgggca gggacacgtt gcggaactgg tacttggcca gccacttgaa ctcggggatc 20940  agcagtttgg gcagcggggt gtcggggaag gagtcggtcc acagcttccg cgtcagttgc 21000  agggcgccca gcaggtcggg cgcggagatc ttgaaatcgc agttgggacc cgcgttctgc 21060  gcgcgggagt tgcggtacac ggggttgcag cactggaaca ccatcagggc cgggtgcttc 21120  acgctcgcca gcaccgtcgc gtcggtgatg ctctccacgt cgaggtcctc ggcgttggcc 21180  atcccgaagg gggtcatctt gcaggtctgc cttcccatgg tgggcacgca cccgggcttg 21240  tggttgcaat cgcagtgcag ggggatcagc atcatctggg cctggtcggc gttcatcccc 21300  gggtacatgg ccttcatgaa agcctccaat tgcctgaacg cctgctgggc cttggctccc 21360  tcggtgaaga agaccccgca ggacttgcta gagaactggt tggtggcgca cccggcgtcg 21420  tgcacgcagc agcgcgcgtc gttgttggcc agctgcacca cgctgcgccc ccagcggttc 21480  tgggtgatct tggcccggtc ggggttctcc ttcagcgcgc gctgcccgtt ctcgctcgcc 21540  acatccatct cgatcatgtg ctccttctgg atcatggtgg tcccgtgcag gcaccgcagc 21600  ttgccctcgg cctcggtgca cccgtgcagc cacagcgcgc acccggtgca ctcccagttc 21660  ttgtgggcga tctgggaatg cgcgtgcacg aagccctgca ggaagcggcc catcatggtg 21720  gtcagggtct tgttgctagt gaaggtcagc ggaatgccgc ggtgctcctc gttgatgtac 21780  aggtggcaga tgcggcggta cacctcgccc tgctcgggca tcagctggaa gttggctttc 21840  aggtcggtct ccacgcggta gcggtccatc agcatagtca tgatttccat acccttctcc 21900  caggccgaga cgatgggcag gctcataggg ttcttcacca tcatcttagc gctagcagcc 21960  gcggccaggg ggtcgctctc gtccagggtc tcaaagctcc gcttgccgtc cttctcggtg 22020  atccgcaccg gggggtagct gaagcccacg gccgccagct cctcctcggc ctgtctttcg 22080  tcctcgctgt cctggctgac gtcctgcagg accacatgct tggtcttgcg gggtttcttc 22140  ttgggcggca gcggcggcgg agatgttgga gatggcgagg gggagcgcga gttctcgctc 22200  accactacta tctcttcctc ttcttggtcc gaggccacgc ggcggtaggt atgtctcttc 22260  gggggcagag gcggaggcga cgggctctcg ccgccgcgac ttggcggatg gctggcagag 22320  ccccttccgc gttcgggggt gcgctcccgg cggcgctctg actgacttcc tccgcggccg 22380  gccattgtgt tctcctaggg aggaacaaca agcatggaga ctcagccatc gccaacctcg 22440  ccatctgccc ccaccgccga cgagaagcag cagcagcaga atgaaagctt aaccgccccg 22500  ccgcccagcc ccgccacctc cgacgcggcc gtcccagaca tgcaagagat ggaggaatcc 22560  atcgagattg acctgggcta tgtgacgccc gcggagcacg aggaggagct ggcagtgcgc 22620  ttttcacaag aagagataca ccaagaacag ccagagcagg aagcagagaa tgagcagagt 22680  caggctgggc tcgagcatga cggcgactac ctccacctga gcggggggga ggacgcgctc 22740  atcaagcatc tggcccggca ggccaccatc gtcaaggatg cgctgctcga ccgcaccgag 22800  gtgcccctca gcgtggagga gctcagccgc gcctacgagt tgaacctctt ctcgccgcgc 22860  gtgcccccca agcgccagcc caatggcacc tgcgagccca acccgcgcct caacttctac 22920  ccggtcttcg cggtgcccga ggccctggcc acctaccaca tctttttcaa gaaccaaaag 22980  atccccgtct cctgccgcgc caaccgcacc cgcgccgacg cccttttcaa cctgggtccc 23040  ggcgcccgcc tacctgatat cgcctccttg gaagaggttc ccaagatctt cgagggtctg 23100  ggcagcgacg agactcgggc cgcgaacgct ctgcaaggag aaggaggaga gcatgagcac 23160  cacagcgccc tggtcgagtt ggaaggcgac aacgcgcggc tggcggtgct caaacgcacg 23220  gtcgagctga cccatttcgc ctacccggct ctgaacctgc cccccaaagt catgagcgcg 23280  gtcatggacc aggtgctcat caagcgcgcg tcgcccatct ccgaggacga gggcatgcaa 23340  gactccgagg agggcaagcc cgtggtcagc gacgagcagc tggcccggtg gctgggtcct 23400  aatgctagtc cccagagttt ggaagagcgg cgcaaactca tgatggccgt ggtcctggtg 23460  accgtggagc tggagtgcct gcgccgcttc ttcgccgacg cggagaccct gcgcaaggtc 23520  gaggagaacc tgcactacct cttcaggcac gggttcgtgc gccaggcctg caagatctcc 23580  aacgtggagc tgaccaacct ggtctcctac atgggcatct tgcacgagaa ccgcctgggg 23640  cagaacgtgc tgcacaccac cctgcgcggg gaggcccggc gcgactacat ccgcgactgc 23700  gtctacctct acctctgcca cacctggcag acgggcatgg gcgtgtggca gcagtgtctg 23760  gaggagcaga acctgaaaga gctctgcaag ctcctgcaga agaacctcaa gggtctgtgg 23820  accgggttcg acgagcgcac caccgcctcg gacctggccg acctcatttt ccccgagcgc 23880  ctcaggctga cgctgcgcaa cggcctgccc gactttatga gccaaagcat gttgcaaaac 23940  tttcgctctt tcatcctcga acgctccgga atcctgcccg ccacctgctc cgcgctgccc 24000  tcggacttcg tgccgctgac cttccgcgag tgccccccgc cgctgtggag ccactgctac 24060  ctgctgcgcc tggccaacta cctggcctac cactcggacg tgatcgagga cgtcagcggc 24120  gagggcctgc tcgagtgcca ctgccgctgc aacctctgca cgccgcaccg ctccctggcc 24180  tgcaaccccc agctgctgag cgagacccag atcatcggca ccttcgagtt gcaagggccc 24240  agcgaaggcg agggttcagc cgccaagggg ggtctgaaac tcaccccggg gctgtggacc 24300  tcggcctact tgcgcaagtt cgtgcccgag gactaccatc ccttcgagat caggttctac 24360  gaggaccaat cccatccgcc caaggccgag ctgtcggcct gcgtcatcac ccagggggcg 24420  atcctggccc aattgcaagc catccagaaa tcccgccaag aattcttgct gaaaaagggc 24480  cgcggggtct acctcgaccc ccagaccggt gaggagctca accccggctt cccccaggat 24540  gccccgagga aacaagaagc tgaaagtgga gctgccgccc gtggaggatt tggaggaaga 24600  ctgggagaac agcagtcagg cagaggagga ggagatggag gaagactggg acagcactca 24660  ggcagaggag gacagcctgc aagacagtct ggaggaagac gaggaggagg cagaggagga 24720  ggtggaagaa gcagccgccg ccagaccgtc gtcctcggcg ggggagaaag caagcagcac 24780  ggataccatc tccgctccgg gtcggggtcc cgctcgacca cacagtagat gggacgagac 24840  cggacgattc ccgaacccca ccacccagac cggtaagaag gagcggcagg gatacaagtc 24900  ctggcggggg cacaaaaacg ccatcgtctc ctgcttgcag gcctgcgggg gcaacatctc 24960  cttcacccgg cgctacctgc tcttccaccg cggggtgaac tttccccgca acatcttgca 25020  ttactaccgt cacctccaca gcccctacta cttccaagaa gaggcagcag cagcagaaaa 25080  agaccagcag aaaaccagca gctagaaaat ccacagcggc ggcagcaggt ggactgagga 25140  tcgcggcgaa cgagccggcg caaacccggg agctgaggaa ccggatcttt cccaccctct 25200  atgccatctt ccagcagagt cgggggcagg agcaggaact gaaagtcaag aaccgttctc 25260  tgcgctcgct cacccgcagt tgtctgtatc acaagagcga agaccaactt cagcgcactc 25320  tcgaggacgc cgaggctctc ttcaacaagt actgcgcgct cactcttaaa gagtagcccg 25380  cgcccgccca gtcgcagaaa aaggcgggaa ttacgtcacc tgtgcccttc gccctagccg 25440  cctccaccca tcatcatgag caaagagatt cccacgcctt acatgtggag ctaccagccc 25500  cagatgggcc tggccgccgg tgccgcccag gactactcca cccgcatgaa ttggctcagc 25560  gccgggcccg cgatgatctc acgggtgaat gacatccgcg cccaccgaaa ccagatactc 25620  ctagaacagt cagcgctcac cgccacgccc cgcaatcacc tcaatccgcg taattggccc 25680  gccgccctgg tgtaccagga aattccccag cccacgaccg tactacttcc gcgagacgcc 25740  caggccgaag tccagctgac taactcaggt gtccagctgg cgggcggcgc caccctgtgt 25800  cgtcaccgcc ccgctcaggg tataaagcgg ctggtgatcc ggggcagagg cacacagctc 25860  aacgacgagg tggtgagctc ttcgctgggt ctgcgacctg acggagtctt ccaactcgcc 25920  ggatcgggga gatcttcctt cacgcctcgt caggccgtcc tgactttgga gagttcgtcc 25980  tcgcagcccc gctcgggtgg catcggcact ctccagttcg tggaggagtt cactccctcg 26040  gtctacttca accccttctc cggctccccc ggccactacc cggacgagtt catcccgaac 26100  ttcgacgcca tcagcgagtc ggtggacggc tacgattgag tttaaactca cccccttatc 26160  cagtgaaata aagatcatat tgatgatgat tttacagaaa taaaaaataa tcatttgatt 26220  tgaaataaag atacaatcat attgatgatt tgagtttaac aaaaaaataa agaatcactt 26280  acttgaaatc tgataccagg tctctgtcca tgttttctgc caacaccact tcactcccct 26340  cttcccagct ctggtactgc aggccccggc gggctgcaaa cttcctccac acgctgaagg 26400  ggatgtcaaa ttcctcctgt ccctcaatct tcattttatc ttctatcaga tgtccaaaaa 26460  gcgcgtccgg gtggatgatg acttcgaccc cgtctacccc tacgatgcag acaacgcacc 26520  gaccgtgccc ttcatcaacc cccccttcgt ctcttcagat ggattccaag agaagcccct 26580  gggggtgttg tccctgcgac tggccgaccc cgtcaccacc aagaacgggg aaatcaccct 26640  caagctggga gagggggtgg acctcgattc ctcgggaaaa ctcatctcca acacggccac 26700  caaggccgcc gcccctctca gtttttccaa caacaccatt tcccttaaca tggatcaccc 26760  cttttacact aaagatggaa aattatcctt acaagtttct ccaccattaa atatactgag 26820  aacaagcatt ctaaacacac tagctttagg ttttggatca ggtttaggac tccgtggctc 26880  tgccttggca gtacagttag tctctccact tacatttgat actgatggaa acataaagct 26940  taccttagac agaggtttgc atgttacaac aggagatgca attgaaagca acataagctg 27000  ggctaaaggt ttaaaatttg aagatggagc catagcaacc aacattggaa atgggttaga 27060  gtttggaagc agtagtacag aaacaggtgt tgatgatgct tacccaatcc aagttaaact 27120  tggatctggc cttagctttg acagtacagg agccataatg gctggtaaca aagaagacga 27180  taaactcact ttgtggacaa cacctgatcc atcaccaaac tgtcaaatac tcgcagaaaa 27240  tgatgcaaaa ctaacacttt gcttgactaa atgtggtagt caaatactgg ccactgtgtc 27300  agtcttagtt gtaggaagtg gaaacctaaa ccccattact ggcaccgtaa gcagtgctca 27360  ggtgtttcta cgttttgatg caaacggtgt tcttttaaca gaacattcta cactaaaaaa 27420  atactggggg tataggcagg gagatagcat agatggcact ccatatacca atgctgtagg 27480  attcatgccc aatttaaaag cttatccaaa gtcacaaagt tctactacta aaaataatat 27540  agtagggcaa gtatacatga atggagatgt ttcaaaacct atgcttctca ctataaccct 27600  caatggtact gatgacagca acagtacata ttcaatgtca ttttcataca cctggactaa 27660  tggaagctat gttggagcaa catttggggc taactcttat accttctcat acatcgccca 27720  agaatgaaca ctgtatccca ccctgcatgc caacccttcc caccccactc tgtggaacaa 27780  actctgaaac acaaaataaa ataaagttca agtgttttat tgattcaaca gtttcacaga 27840  accctagtat tcaacctgcc acctccctcc caacacacag agtacacagt cctttctccc 27900  cggctggcct taaaaagcat catatcatgg gtaacagaca tattcttagg tgttatattc 27960  cacacggttt cctgtcgagc caaacgctca tcagtgatat taataaactc cccgggcagc 28020  tcacttaagt tcatgtcgct gtccagctgc tgagccacag gctgctgtcc aacttgcggt 28080  tgcttaacgg gcggcgaagg agaagtccac gcctacatgg gggtagagtc ataatcgtgc 28140  atcaggatag ggcggtggtg ctgcagcagc gcgcgaataa actgctgccg ccgccgctcc 28200  gtcctgcagg aatacaacat ggcagtggtc tcctcagcga tgattcgcac cgcccgcagc 28260  ataaggcgcc ttgtcctccg ggcacagcag cgcaccctga tctcacttaa atcagcacag 28320  taactgcagc acagcaccac aatattgttc aaaatcccac agtgcaaggc gctgtatcca 28380  aagctcatgg cggggaccac agaacccacg tggccatcat accacaagcg caggtagatt 28440  aagtggcgac ccctcataaa cacgctggac ataaacatta cctcttttgg catgttgtaa 28500  ttcaccacct cccggtacca tataaacctc tgattaaaca tggcgccatc caccaccatc 28560  ctaaaccagc tggccaaaac ctgcccgccg gctatacact gcagggaacc gggactggaa 28620  caatgacagt ggagagccca ggactcgtaa ccatggatca tcatgctcgt catgatatca 28680  atgttggcac aacacaggca cacgtgcata cacttcctca ggattacaag ctcctcccgc 28740  gttagaacca tatcccaggg aacaacccat tcctgaatca gcgtaaatcc cacactgcag 28800  ggaagacctc gcacgtaact cacgttgtgc attgtcaaag tgttacattc gggcagcagc 28860  ggatgatcct ccagtatggt agcgcgggtt tctgtctcaa aaggaggtag acgatcccta 28920  ctgtacggag tgcgccgaga caaccgagat cgtgttggtc gtagtgtcat gccaaatgga 28980  acgccggacg tagtcatatt tcctgaagca aaaccaggtg cgggcgtgac aaacagatct 29040  gcgtctccgg tctcgccgct tagatcgctc tgtgtagtag ttgtagtata tccactctct 29100  caaagcatcc aggcgccccc tggcttcggg ttctatgtaa actccttcat gcgccgctgc 29160  cctgataaca tccaccaccg cagaataagc cacacccagc caacctacac attcgttctg 29220  cgagtcacac acgggaggag cgggaagagc tggaagaacc atgattaact ttattccaaa 29280  cggtctcgga gcacttcaaa atgcaggtcc cggaggtggc acctctcgcc cccactgtgt 29340  tggtggaaaa taacagccag gtcaaaggtg acacggttct cgagatgttc cacggtggct 29400  tccagcaaag cctccacgcg cacatccaga aacaagagga cagcgaaagc gggagcgttt 29460  tctaattcct caatcatcat attacactcc tgcaccatcc ccagataatt ttcatttttc 29520  cagccttgaa tgattcgtat tagttcctga ggtaaatcca agccagccat gataaaaagc 29580  tcgcgcagag cgccctccac cggcattctt aagcacaccc tcataattcc aagagattct 29640  gctcctggtt cacctgcagc agattaacaa tgggaatatc aaaatctctg ccgcgatccc 29700  taagctcctc cctcaacaat aactgtatgt aatctttcat atcatctccg aaatttttag 29760  ccatagggcc gccaggaata agagcagggc aagccacatt acagataaag cgaagtcctc 29820  cccagtgwgc attgccaaat gtaagattga aataagcatg ctggctagac cctgtgatat 29880  cttccagata actggacaga aaatcaggca agcaattttt aagaaaatca acaaaagaaa 29940  agtcgtccag gtgcaggttt agagcctcag gaacaacgat ggaataagtg caaggagtgc 30000  gttccagcat ggttagtgtt tttttggtga tctgtagaac aaaaaataaa catgcaatat 30060  taaaccatgc tagcctggcg aacaggtggg taaatcactc tttccagcac caggcaggct 30120  acggggtctc cggcgcgacc ctcgtagaag ctgtcgccat gattgaaaag catcaccgag 30180  agaccttccc ggtggccggc atggatgatt cgagaagaag catacactcc gggaacattg 30240  gcatccgtga gtgaaaaaaa gcgacctata aagcctcggg gcactacaat gctcaatctc 30300  aattccagca aagccacccc atgcggatgg agcacaaaat tggcaggtgc gtaaaaaatg 30360  taattactcc cctcctgcac aggcagcaaa gcccccgctc cctccagaaa cacatacaaa 30420  gcctcagcgt ccatagctta ccgagcacgg caggcgcaag agtcagagaa aaggctgagc 30480  tctaacctga ctgcccgctc ctgtgctcaa tatatagccc taacctacac tgacgtaaag 30540  gccaaagtct aaaaataccc gccaaataat cacacacgcc cagcacacgc ccagaaaccg 30600  gtgacacact caaaaaaata cgcgcacttc ctcaaacgcc caaaactgcc gtcatttccg 30660  ggttcccacg ctacgtcatc aaaacacgac tttcaaattc cgtcgaccgt taaaaacgtc 30720  acccgccccg cccctaacgg tcgcccgtct ctcagccaat cagcgccccg catccccaaa 30780  ttcaaacacc tcatttgcat attaacgcgc acaaaaagtt tgaggtatat tattgatgat 30840  gg 30842 SEQ ID NO: 6-bgh polyadenylation signal  ctgtgccttctagttgccagccatctgttgtttgcccctcccccgtgccttccttgaccctggaaggtgcc  actcccactgtcctttcctaataaaatgaggaaattgcatcgcattgtctgagtaggtgtcattctattct  ggggggtggggtggggcaggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcgg tgggctctatgg SEQ ID NO: 7: long CMV promoter  ATCGCCATTTTTCCAAAAGTGATTTTTGGGCATACGCGATATCTGGCGATAGCGCTTA  TATCGTTTACGGGGGATGGCGATAGACGATTTGGTGACTTGGGCGATTCTGTGTGT  CGCAAATATCGCATTTCGATATAGGTGACAGACGATATGAGGCTATATCGCCGATA  GAGGCGACATCAAGCTGGCACATGGCCAATGCATATCGATCTATACATTGAATCAATA  TTGGCCATTAGCCATATTATTCATTGGTTATATAGCATAAATCAATATTGGCTATTGG  CCATTGCATACGTTGTATCCATATCATAATATGTACATTTATATTGGCTCATGTCCAAC  ATTACCGCCATGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGG  TCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCC  CGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCC  CATAGTAACGCCAATAGGGACTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAA  ACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACG  TCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTT  TCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTT  TGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTC  CACCCCATTGACGTCAATGGGAGTTTGTTTGGCACCAAAATCAACGGGATTTCCAA  AATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGG  AGGTCTATATAAGCAGAGCTCTCCCTATCAGTGATAGAGATCTCCCTATCAGTGATAG  AGATCGTCGACGAGCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACG  CTGTTTGACCTCCATAGAAGACACCGGGACCGATCCAGCCTCCGCGGCCGGGAACG  GTGCATTGGAACGCGGATTCCCCGTGCCAAGAGTGACGTAAGTACCGCCTATAGAGT  CTATAGGCCCACCCCCTTGGCTTCTTATGCATGCTATACTGTTTTTGGCTTGGGGTCT  ATACACCCCCGCTTCCTCATGTTATAGGTGATGGTATAGCTTAGCCTATAGGTGTGGG  TTATTGACCATTATTGACCACTCCCCTATTGGTGACGATACTTTCCATTACTAATCCAT  AACATGGCTTTGCCACAACTCTTTATTGGCTATATGCCAATACACTGTCCTTCAG  AGACTGACACGGACTCTGTATTTTTACAGGATGGGGTCTCATTATTATTTACAAATT  CACATATACAACACCACCGTCCCCAGTGCCCGCAGTTTTTATTAAACATAACGTGGGA  TCTCCACGCGAATCTCGGGTACGTGTTCCGGACATGGGCTCTTCTCCGGTAGCGGCG  GAGCTTCTACATCCGAGCCCTGCTCCCATGCCTCCAGCGACTCATGGTCGCTCGGCAG  CTCCTTGCTCCTAACAGTGGAGGCCAGACTTAGGCACAGCACGATGCCCACCACCACC  AGTGTGCCGCACAAGGCCGTGGCGGTAGGGTATGTGTCTGAAAATGAGCTCGGGGA  GCGGGCTTGCACCGCTGACGCATTTGGAAGACTTAAGGCAGCGGCAGAAGAAGATGC  AGGCAGCTGAGTTGTTGTGTTCTGATAAGAGTCAGAGGTAACTCCCGTTGCGGTGCT  GTTAACGGTGGAGGGCAGTGTAGTCTGAGCAGTACTCGTTGCTGCCGCGCGCGCCAC  CAGACATAATAGCTGACAGACTAACAGACTGTTCCTTTCCATGGGTCTTTTCTGCA