ANTIMICROBIAL PROTEIN AND RELATIVE USE
20230242921 · 2023-08-03
Assignee
Inventors
- Alessandro PAPARELLA (Marcon (VE), IT)
- Marco CAPPELLARO (Pontecchio Polesine (RO), IT)
- Enrico FIORE (Vigonza (PD), IT)
Cpc classification
A01N65/00
HUMAN NECESSITIES
C12N15/8279
CHEMISTRY; METALLURGY
C07K2319/035
CHEMISTRY; METALLURGY
International classification
C12N15/82
CHEMISTRY; METALLURGY
Abstract
The invention relates to a synthetic fusion protein having high antimicrobial activity. In particular, the invention relates to the use of said protein to eliminate pathogenic microorganisms from environments and surfaces. In particular, the synthetic fusion protein object of the present invention can be used in the preparation of disinfectant solutions that can be used in the outpatient, hospital and domestic field, in high traffic environments, in filters of air inlet and extraction systems or air conditioners or air treatment unit ATU, in environments used for food preparation. In general, in all those areas where it is necessary to adopt antimicrobial prophylaxis directed against gram+bacteria, viruses, mycoplasma and fungi.
Claims
1. Nucleic acid encoding a synthetic fusion protein and comprising at least one of: a sequence of SEQ ID no 3, a sequence having at least 90% sequence identity with SEQ ID no. 3 or a sequence having at least 95% identity with SEQ ID no. 3.
2. A vector, comprising the nucleic acid according to claim 1.
3. The vector according to claim 2 wherein the nucleic acid is operably linked to a promoter sequence.
4. A synthetic fusion protein having Camino acid sequence of SEQ ID 4.
5. A synthetic fusion protein having amino acid sequence with at least 90% sequence identity with SEQ ID no.4.
6. Antimicrobial composition comprising the protein according to claim 4.
7. The antimicrobial composition according to claim 6 further comprising at least one of, salt buffer, PBS, protease inhibitor, MgCl.sub.2, excipients, carriers, thickeners, gelling agents, methyl orixane, calcium alginate, sodium alginate, carriers, adjuvants, cellulose or methylcellulose.
8. Composition comprising the protein according to claim 4 and a lysate of bacterial or fungal cells.
9. The antimicrobial composition according to claim 6 formulated in spray, semi-liquid, semi-solid, solid, suspension, or gel form.
10. Protein according to claim 4 for use as at least one of: a disinfectant or antimicrobial agent in, outpatient, hospital or home settings, in the disinfection of surgical instruments, in high traffic environments, on surfaces and handles, in filters of air inlet and extraction systems, in air conditioners, in air treatment units, in environments used for food preparation, or in the agricultural field.
11. Protein according to claim 4 for use in skin disinfection.
12. Protein according to claim 4 for use in the control and elimination of; viruses, gram positive bacteria, mycoplasma, phytoplasma, microscopic, spore fungi or oospore fungi.
13. Use of the protein according to claim 4 in a biological method to counteract the attack and proliferation of; viruses, gram positive bacteria, mycoplasmas, phytoplasmas, microscopic spore fungi or oospore fungi.
14. Method for the control or elimination of; viruses, gram positive bacteria, mycoplasma, phytoplasmas, microscopic spore fungi or oospore fungi from environments or surfaces wherein the method comprises application on the surface, or on parts thereof, of at least one of, a lysate of microorganisms, expressing the protein having SEQ ID no 4 or a protein having 90% identity of sequence with SEQ ID no.4; a protein according to claim 4; or an antimicrobial composition comprising said protein.
15. Process for the production of a protein according to claim 4 comprising the following basic steps: I. inserting in an expression vector, comprising a selection marker, a nucleic acid comprising at least one of: a sequence of SEQ ID no 3, a sequence having at least 90% sequence identity with the SEQ ID no. 3 or a sequence having at least 95% identity with SEQ ID no. 3; II. using said vector for the transformation of competent cells suitable for the use of said vector; III. selecting the competent cells transformed with said vector and multiplying the competent cells in culture; IV. performing a lysis of the competent cells of step III; and V. selecting and purifying the protein according to claim 4 from the lysate obtained in step IV.
16. The process according to claim 15, further comprising a step of encapsulating the protein obtained at step V in lipids.
17. The process according to claim 15, further comprising a freeze-drying step.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0042]
[0043]
[0044]
[0045] Panel B: immuno-trans blotting anti his-tag to highlight the presence and levels of the correctly cloned fusion protein. The highlighted band indicates the presence of the histidine tail bound to the PGIP+GTF1 fusion complex detected by immuno-blotting technique.
[0046] For both panels: 1 maker-2 control+albumin-3 run buffer negative control-4 sonicated cell pellet-5 Test sample purified with his tag column-6 markers
[0047]
[0048] Panel A View under optical microscope of the absence of S. aureus bacteria after 48 h contact with fusion protein, peroxide bubbles released upon contact with the protein and biological structures
[0049] Panel B View under optical microscope of biological structures lysed at 72 h from the Biological recognition effect and H2O2 release
[0050] Panel C Optical microscope view of the S. aureus culture at time 0
[0051]
[0052] Panel A without protease inhibitor,
[0053] Panel B with protease inhibitor.
[0054] For both panels: M Marker-1 Spike Sars Cov2 Protein-2 buffer-3 16 μl SEQ Protein Id 4-4 10 μl SEQ PGIP/GTF1 Protein Id 4-5 buffer-6 Spike Sars-Cov2 Protein-7 Spike Protein Sars-Cov2+PGIP/GTF1 Protein from SEQ Id 4-8 Spike Sars-Cov2 Protein-9 Spike Sars-Cov2 Protein+PGIP/GTF1 SEQ Protein Id. 4, 10 Spike Sars-Cov2 Protein 11 Spike Sars-Cov2 Protein+Protein PGIP/GTF1 SEQ Id 4
[0055]
[0056] Panel A: time 0
[0057] Panel B: 10 hours from contact
[0058] Panel C: 24 hours from contact
[0059] Panel D: 48 hours from contact with
[0060]
[0061]
[0062]
[0063]
[0064]
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0065] The present invention relates to a synthetic fusion protein, called PGIP+GTF1 or PGIP/GTF1, encoded by the sequence having SEQ ID no 3 and having an amino acid sequence of SEQ. ID no. 4 carried out using coding gene sequences: [0066] for the polygalacturonase inhibitor derived from Vitis vinifera and [0067] for an active subunit of glycosyl transferase (gtf1 reductase) from Nelumbo nucifera 5E9U_A which was surprisingly able to enhance the reducing effect by producing a phenomenon of adhesiveness on bacterial/viral glycosidic surfaces thanks to its enzymatic activity.
[0068] The object of the present invention is therefore a biological method for counteracting the attack and proliferation of viruses, gram+bacteria, mycoplasma and microscopic spore and oospore fungi. The gene sequences were selected after several pairing studies, compared and chosen for their intrinsic characteristics; in particular the PGIP sequence was selected according to what described in WO2019/077477 and the gtf1 subunit was selected by the inventors for its high enzymatic activity.
[0069] The literature shows that the selected sub-unit of the GTF1 glycosyl-transferase (reductase) according to the invention is able to recognize also the bacterial proteins belonging to the secA complex, secretory complex of Gram positive bacteria (Current Topics in microbiology and Immunology chapt.Protein and Sugar Export and Assembly in Grampositive Bacteria ed. Springer pag 45-67), and its presence increases the efficiency of the whole fusion protein complex thanks to the action of recognition and to bind this secA complex and by carrying out its lytic action, on the aforementioned glycoprotein complex to which it adheres.
[0070] The sequence listing titled “Sequence_Listing.txt,” which was created Mar. 2, 2023, and had a file size of 10 KB, is incorporated herein as if fully set forth.
TABLE-US-00001 SEQ ID NO 1: sequence of PGIP, polygalacturanase inhibiting protein from vitis vinifera. GAGTCTGGTGGAGAATTCGAATTCGAATTCATGGAGACTTCAAAACTTT TTCTTCTCTCCTCCTCTCTCCTCCTAGTCTTACTCGCCACTCGTCCATG TCCTTCTCTCTCTGAACGTTGCAACCCAAAAGACAAAAAAGTTCTCCTT CAAATCAAAAAAGCCCTAGACAATCCCTACATTCTAGCTTCGTGGAATC CCAACACCGATTGCTGCGGATGGTACTGCGTCGAATGTGACCTCACCAC CCACCGCATCAACTCGCTCACCATCTTCTCCGGCCAGCTATCCGGCCAG ATTCCCGACGCTGTTGGTGACCTTCCGTTCCTCGAGACCCTCATCTTCC GCAAGCTCTCTAACCTCACCGGTCAGATCCCGCCGGCGATTGCCAAACT CAAGCACCTAAAAATGGTTCGCCTTAGCTGGACCAACCTCTCCGGTCCC GTGCCGGCGTTCTTCAGCGAGCTTAAGAACCTCACGTACCTCGACCTCT CCTTCAATAACCTATCTGGACCCATTCCCGGCAGCCTCTCTCTCCTCCC CAACCTCGGCGCACTCCATCTCGACCGGAACCACCTCACAGGCCCAATC CCTGACTCCTTCGGAAAATTCGCCGGCTCTACCCCAGGTCTACACCTCT CACACAACCAACTTTCCGGGAAAATCCCATATTCTTTCAGAGGATTCGA CCCCAATGTCATGGACTTATCGCGTAACAAGCTTGAGGGTGACCTGTCA ATATTCTTCAATGCCAATAAGTCAACACAGATCGTTGACTTCTCACGGA ACTTGTTCCAGTTTGATCTTTCGAGAGTGGAATTCCCGAAGAGTTTGAC GTCGTTGGACCTTTCGCATAACAAGATCGCCGGGAGCCTGCCGGAGATG ATGACTTCTCTGGATTTACAGTTCCTGAACGTGAGTTACAATCGTTTGT GTGGTAAGATTCCGGTGGGTGGGAAGTTGCAGAGCTTCGATTACGACTC CTACTTTCACAATCGGTGCTTGTGTGGTGCTCCACTCCAGAGCTGCAAG GGTGGTGGTGGTTCTGGTGGTGGTGGTTCTGGTGGTGGTGGTTCTGAGT CTGGTGGAAGTTCTTTTGATTTTATGGATGGTTATGATAAGCCTGTGAA AGGGAGAAAAATCAATTGGATGAAAGCCGGCATATTAGAATCAGACAGG. SEQ ID NO 2: sequence of gtf1 from granule-bound starch synthase from Nelumbo nucifera AAGTTCTTTTGATTTTATTGATGGTTATGATAAGCCTGTGAAAGGGAGA AAAATCAATTGGATGAAAGCCGGCATATTAGAATCAGACAGGGTGTTAA CTGTCAGTCCATACTATGCAGAAGAACTTGCTTCAGGCATAGAAAAAGG TGTGGAACTAGATAACATAATTCGGAAGACTGGCATTACTGGTATTGTG AATGGCACAGATGTTCAGGAGTGGAACCCAACCACAGACAAATATATCA GTGTTAAATATGATGCTACAACTGTTATGGATGCAAAGCCTCTTCTAAA GGAAGCACTTCAATCTGAAGTTGGGTTGCCTGTGGACCGAAATATCCCT GTAATAGGCTTTATTGGTAGACTCGAAGAGCAGAAAGGTTCAGATATTC TTGCAGCATCAATTCCCAAATTCATTGGAGAGAATGTTCAGATAATTGT CCTCGGGACCGGTAAAAAGGCCTTTGAGAAGCAACTTGAGCAACTAGAG ATCAAATATCCTGACAAAGCCAGAGGAGTTGCAAAATTCAATGTTCCTC TTGCCCATATGATCATAGCTGGAGCTGACTTTCTGCTGATCCCAAGTAG ATTTGAACCATGTGGTCTTATTCAGTTACA. SEQ ID no. 3: nucleotide sequence of the PGIP + GTF1 fusion protein according to the invention GAGTCTGGTGGAGAATTCGAATTCGAATTCATGGAGACTTCAAAACTTT TTCTTCTCTCCTCCTCTCTCCTCCTAGTCTTACTCGCCACTCGTCCATG TCCTTCTCTCTCTGAACGTTGCAACCCAAAAGACAAAAAAGTTCTCCTT CAAATCAAAAAAGCCCTAGACAATCCCTACATTCTAGCTTCGTGGAATC CCAACACCGATTGCTGCGGATGGTACTGCGTCGAATGTGACCTCACCAC CCACCGCATCAACTCGCTCACCATCTTCTCCGGCCAGCTATCCGGCCAG ATTCCCGACGCTGTTGGTGACCTTCCGTTCCTCGAGACCCTCATCTTCC GCAAGCTCTCTAACCTCACCGGTCAGATCCCGCCGGCGATTGCCAAACT CAAGCACCTAAAAATGGTTCGCCTTAGCTGGACCAACCTCTCCGGTCCC GTGCCGGCGTTCTTCAGCGAGCTTAAGAACCTCACGTACCTCGACCTCT CCTTCAATAACCTATCTGGACCCATTCCCGGCAGCCTCTCTCTCCTCCC CAACCTCGGCGCACTCCATCTCGACCGGAACCACCTCACAGGCCCAATC CCTGACTCCTTCGGAAAATTCGCCGGCTCTACCCCAGGTCTACACCTCT CACACAACCAACTTTCCGGGAAAATCCCATATTCTTTCAGAGGATTCGA CCCCAATGTCATGGACTTATCGCGTAACAAGCTTGAGGGTGACCTGTCA ATATTCTTCAATGCCAATAAGTCAACACAGATCGTTGACTTCTCACGGA ACTTGTTCCAGTTTGATCTTTCGAGAGTGGAATTCCCGAAGAGTTTGAC GTCGTTGGACCTTTCGCATAACAAGATCGCCGGGAGCCTGCCGGAGATG ATGACTTCTCTGGATTTACAGTTCCTGAACGTGAGTTACAATCGTTTGT GTGGTAAGATTCCGGTGGGTGGGAAGTTGCAGAGCTTCGATTACGACTC CTACTTTCACAATCGGTGCTTGTGTGGTGCTCCACTCCAGAGCTGCAAG GGTGGTGGTGGTTCTGGTGGTGGTGGTTCTGGTGGTGGTGGTTCTGAGT CTGGTGGAAGTTCTTTTGATTTTATGGATGGTTATGATAAGCCTGTGAA AGGGAGAAAAATCAATTGGATGAAAGCCGGCATATTAGAATCAGACAGG GTGTTAACTGTCAGTCCATACTATGCAGAAGAACTTGTTTCAGGCATAG AAAAAGGTGTGGAACTAGATAACGTAATTCGGAAGACTGGCATTACTGG TATTGTGAATGGCACGGATGTTCAGGAGTGGAACCCAACCACAGACAAA TATATCAGTGTTAAATATGATGCTACAACTGTTATGGATGCAAAGCCTC TTCTAAAGGAAGCACTTCAAGCAGAAGTCGGGTTGCCTGTGGACCGAAA TATCCCTGTAATAGGCTTTATTGGTAGACTCGAAGAGCAGAAAGGTTCA GATATTCTCGCAGCATCAATTCCCAAATTCATTGGAGAGAATGTTCAGA TAATTGTCCTCGGGACCGGTAAAAAGGCCTTTGAGAAGCAACTTGAGCA ACTAGAGATCAAATATCCTGACAAAGCCAGAGGAGTTGCAAAATTCAAT GTTCCTCTTGCCCATATGATCATAGCTGGAGCTGACTTTCTGCTGATCC CAAGTAGATTTGAACCATGTGGTCTCATTCAATTACATCACCACCATCA TCATTGATGAGGTACC. SEQ ID NO 4: Amino acid sequence of the fusion protein according to the invention ESGGEFEFEFMETSKLFLLSSSLLLVLLATRPCPSLSERCNPKDKKVLL QIKKALDNPYILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQ IPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGP VPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPI PDSFGKFAGSTPGLHLSHNQLSGKIPYSFRGFDPNVMDLSRNKLEGDLS IFFNANKSTQIVDFSRNLFQFDLSRVEFPKSLTSLDLSHNKIAGSLPEM MTSLDLQFLNVSYNRLCGKIPVGGKLQSFDYDSYFHNRCLCGAPLQSCK GGGGSGGGGSGGGGSESGGSSFDFMDGYDKPVKGRKINWMKAGILESDR VLTVSPYYAEELVSGIEKGVELDNVIRKTGITGIVNGTDVQEWNPTTDK YISVKYDATTVMDAKPLLKEALQAEVGLPVDRNIPVIGFIGRLEEQKGS DILAASIPKFIGENVQIIVLGTGKKAFEKQLEQLEIKYPDKARGVAKFN VPLAHMIIAGADFLLIPSRFEPCGLIQLHHHHHHGT.
[0071] The sequences according to the invention are in any case reported in the attached sequence listing.
[0072] Therefore, the nucleotide sequence of SEQ ID no. 3 and/or a sequence having at least 90% and more preferably 95% sequence identity with SEQ ID no. 3;
[0073] The present invention also relates to a protein having the amino acid sequence of SEQ ID 4 and/or a sequence having 90% and more preferably 95% sequence identity with SEQ ID no.4.
[0074] The present invention also relates to a synthetic fusion protein encoded by the sequence having SEQ ID no 3 and having an amino acid sequence of SEQ ID no 4.
[0075] The present invention also relates to a process for the production and purification of the synthetic fusion protein according to the invention.
[0076] Said process includes the following basic steps:
I. In an expression vector, comprising a selection marker, insert a nucleic acid comprising at least one of: a sequence of SEQ ID no 3, a sequence having at least 90% sequence identity with SEQ ID no. 3 and a sequence having at least 95% identity with SEQ ID no. 3;
II. using said vector for the transformation of competent cells suitable for the use of said vector;
III. select the competent cells transformed with said vector and multiply them in culture;
IV. perform a lysis of the competent cells of point III;
V. select and purify the protein according to the invention from the lysate obtained at point IV.
[0077] In one embodiment, in order to obtain expression and to be able to purify the protein according to the invention, the sequence having SEQ ID No. 3 was cloned into a vector for expression in bacteria or yeasts.
[0078] The vectors suitable for use according to the invention are known to those skilled in the art, in a preferred embodiment pBE-s DNA are preferably used, and secondly the vector pGAPZa-A (respectively sold by Takara and Thermofisher).
[0079] Various promoters known to the skilled in the art can be used to promote the transcription of the sequence according to the invention. In a preferred embodiment, the B. subtilis Secretory Protein Expression System (TAKARA) is used.
[0080] The protein according to the invention can be produced in various bacteria and yeasts suitable for the purpose and known to the skilled in the art, in a preferred embodiment the protein 701.1907 according to the invention is produced in Bacillus subtilis or Pichia Pastoris (Cregg et al., 1985; Cregg et al., 1989, Clare et al., 1991a; Clare et al., 1991b; Romanos et al., 1991) and during the transcription of the protein, glycosylation of the same leads to its natural form or hyperglycosylation it increases its metabolic capacity. In Pichia Pastoris the protein is post-translation hyper-glycosylated in 5 points, its molecular weight varies from 62 KDa to 200 KDa. In Bacillus subtilis, hyper-glycosylation brings the weight of the protein to 120 KDa. This hyper-glycosylation can be removed during purification procedures. In one embodiment, for example using the B. subtilis Secretory Protein Expression System (takara), in order to facilitate its purification, a tag sequence of 6 histidine residues (His-Tag). Other types of tags known to those skilled in the art are however suitable for the purpose according to the invention. To obtain the protein according to the invention, the method applied was the following:
1) RNA extraction from Vitis vinifera and Nelumbo nucifera
2) RT-PCR for the amplification of the gene portions of SEQ ID no 1 and 2, preferably performed using modified primers comprising sequences recognized by restriction enzymes (Gibson method) so as to provide the amplified with the desired sequence for subsequent digestion;
3) Following amplification, the PCR products are subjected to purification, first digestion in order to ligate the two fragments and subsequently to a ligase reaction aimed at obtaining a fragment comprising the sequence Id no 3.
4) Following the product of ligase obtained in point 3) is purified and subjected to a second digestion by insertion in a vector, preferably pBE-s DNA, and secondly in the vector pGAPZa-A, expressly selected for its ability to hyper-expression exclusively in bacteria and yeasts with non-protease.
5) The vectors comprising the sequence of SEQ Id no 3 are used to transform competent cells suitable for the purpose. Competent cells are preferably Pichia Pastoris or Bacillus subtilis. The transformation takes place preferably by electroporation since chemical transformation is not excluded.
6) The transformed cells are selected, preferably with antibiotics, and multiplied in a suitable medium known to the skilled in the art. LB/YPD is preferably used for Bacillus subtilis and Pichia Pastoris respectively.
7) After an adequate culture time selected on the basis of the microorganism, preferably 24 h-48 h, the cells are lysed to extract the total proteins and to proceed with the purification of the protein of interest preferably on an affinity column.
[0081] Optionally, the product obtained from the purification step is subjected to encapsulation in lipids, preferably phospholipids in order to facilitate its diffusion and protection from self-oxidation, thus extending the time of residence on the surfaces, and favoring the affinity with microbial structures.
[0082] Optionally, the product obtained from the purification step or from the encapsulation step is subjected to freeze-drying. In the context of the present invention, by raw or crude extract is meant the cellular lysate subjected to centrifugation and sonication but not to purification on an affinity column.
[0083] In one embodiment, the engineering of Pichia Pastoris and Bacillus subtilis was achieved by electroporation or by transformation of the bacteria competent to receive the plasmid (chemical method).
[0084] In one embodiment, said coding sequence for PGIP+GTF1 is cloned in 5′-3′ “IN FRAME” with the expression structure of the plasmids according to the invention.
[0085] In an alternative embodiment the ligated product obtained at point 3) is inserted in a vector suitable for use in A. Tumefaciens and subsequently in this electroporate; preferably the vector is the vector pRI-201AN (takara) which possesses two multiple Boning sites which therefore provides the vector with the ability to double express PGIP-GTF1, and the vector after purification is electroporated in the non-tumorigenic bacterium A. tumefaciens LB 4404 (takara). In order to verify the correct production of the protein according to the invention, the competent bacteria transformed with the vectors comprising the expression cassette of SEQ ID no. 3 capable of producing the protein according to the invention and labeled with 6 histidine tags, were lysed after the adequate culture time. Following the mechanical lysis which took place by sonication of 5 min′ at a frequency>20kH, on ice, the lysate was passed into the imidazole gradient purification column up to 100 mM to detach, after a first elution, the protein complex.
[0086] Different samples were run on SD-PAGE gels. In
[0087] This experiment demonstrates that the fusion protein exists, is well characterized and is usable from now on. In order to verify the efficacy of the protein according to the invention in counteracting or destroying the above-mentioned microorganisms, various experiments were set up, in which the protein, in various purified and non-purified conditions, was placed in contact with representative bacteria, fungi, phytoplasmas. and with the spike protein produced by Sars Cov-2.
[0088] S. aureus.
[0089]
[0090] The purpose of this experiment is to observe possible antibacterial effects. As can be seen from the photos represented in
[0091] It can be seen that the concentration of microorganisms has decreased by 80% and an increase in gas bubbles generated by the lysis reaction is observed. The surface of the plate therefore has a total absence or very little presence of gram+bacteria thanks to the reducing effect given by PGIP+GTF1.
[0092] Aspergillus
[0093]
[0094] Sars-Cov2
[0095] In order to verify the effectiveness of the protein according to the invention in fighting viruses, an experiment was set up (
[0096] The protein according to the invention was purified, extracted with or without PMSF and E-64 protease inhibitors (respectively serine-protease and cysteine-protease); both extracts with the addition of 10 mM of MgCl2, as magnesium acts as a co-enzymatic activator, were placed in contact with a mixture of sars-Cov2 spike proteins (abcam) in a ratio of 5:1; the protein according to the invention is present at the final concentration in 1 μg/μl.
[0097] The result of this contact was observed after 1, 24, 48 hours, with relevant effects.
[0098] In
[0099] In lanes 6 to 11 it is possible to observe the progression of the experiments at different contact times. In
[0100] The arrows indicate the decrease in the intensity of the band already at 1 h, 24 h and 48 h. This experiment demonstrates that the purified protein in its 62 kDa non-glycosylated form possesses marked antiviral properties.
[0101] The result of this experiment demonstrates a mild effect of the initiation of protein lysis against the spikes of covid-19 already at 1 h attesting the virucidal activity of the protein already at the concentration of 1 μg/μl.
[0102] Cytotoxicity Experiments
[0103] To understand if a biological use of this fusion protein was possible without causing damage to human cells, a biocompatibility test was carried out to verify a possible cytotoxicity of the protein according to the invention and to understand the optimal concentrations of use.
[0104] Two cell lines were used to do this: human ovarian cancer cell line A2780 and lung mesothelioma cell line MSTO-211 H. The cells in the respective culture media are kept in an incubator in a humidified atmosphere at 37° C. and manipulated using a sterile laminar flow hood and incubating the cells at 48 and 72 hours in plates.
[0105] The cytotoxicity of two solutions was evaluated:
a) a solution containing the fusion protein at different scalar concentrations (concentration of the stock solution equal to 1.9 nM) and
b) a solution containing only the buffer of the fusion protein solution. 25,000-30,000 cells per well (for 72 h assays) or 50,000 cells per well (for 48 h assays) were placed in contact with 5 different protein concentrations from 1 nM up to 20 nM in order to obtain a Gaussian distribution of the data. It was decided to use immortalized cell lines because they are more stable and therefore more responsive and not subjected to the cell decay to which cell lines derived from the skin are subject.
[0106] If non-immortalized cell lines had been adopted in this experiment, normal cell decay would have led to a false count, which would have had to be compensated for by an inverse logarithmic factor and this would have led to an incorrect calculation, compared to a stable cell line.
[0107] Since the purified protein used in this experiment resulted from a purification process on an IMAC purification column, in an imidazole gradient from 10 to 100 mM, and from a subsequent denaturation step in guanidium isothiocyanate, to characterize its nature, the protein has been subjected to a purification process by means of a dialysis cassette with a purification buffer at two different osmotic pressures, generated by two different internal/external osmolarities, this internal/external concentration difference causes the salts to be extracted from the site of the fusion protein by purifying it. This solution is also used as a control to obtain the results of the test which takes into account the dialysis pad. The results obtained, calculated as a percentage of viability with respect to the control condition (for the 20 nM condition the viability values were also calculated with respect to the control condition+buffer and indicated with *) are shown in the following tables:
TABLE-US-00002 TABLE 1 A2780 (human % viability at 48 h (mean of two viability at 72 h (mean of two ovarian carcinoma) duplicate experiments) duplicate experiments) Control 100% 100% Control + buffer 49% 100% 50% 100% Protein sol. 1 nM 88% 82% Protein sol. 2.5 nM 90% 83% Protein sol. 5 nM 94% 86% Protein sol. 10 nM 95% 103% Protein sol. 20 nM 45% *91% 50% *100% *Value calculated with respect to the control + buffer condition, considered 100%
TABLE-US-00003 TABLE 2 MSTO-21 IH (human viability at 72 h biphasic (mean of two mesothelioma) % viability at 48 h duplicate experiments) Control 100% 100% Control + buffer 38% 100% 64% 100% Protein sol. 1 nM 89% 89% Protein sol. 2.5 nM 97% 83% Protein sol. 5 nM 119% 100% Protein sol. 10 nM 119% 100% Protein sol. 20 nM 29% *16% 56% *89% *Value calculated with respect to the control + buffer condition, considered 100%
[0108] The results of these experiments are also represented in
[0109] As regards the results obtained in table 1 (A2780), the experiment considers a cut-off of 50% calculated on the two different immortalized cell lines. It has been shown that net of the cut off caused by the buffer, the mean survival of the A2780 cell line shows that at the protein concentration of 5 nM the mean cell survival has only a difference of 8% between 48 and 72 h. While at a concentration of 10 nM the average survival increases by 8%. Demonstrating that the toxicity of the protein net of the cut-off is compatible with cells at concentrations between 5 nM and 10 NM.
[0110] In the MSTO211 H cell line it is noted that at the concentration of 5 and 10 nM there is a trend reversal where at 48 h the survival increases by 19%, while at 72 h it normalizes. In this case the two protein concentrations on this cell line are not toxic, see table 2 (MSTO211 H).
[0111] The maximum toxicity is demonstrated in tables 1,2, they are compensated by comparing them with the cut-off of 50% at the maximum concentration of 20 nM, where a mortality rate of 11% is noted, in table 2, compensated by the cut-off of the 50% which maintains cell survival at 89%.
[0112] In table 1 the same, at the concentration of 20 nM there is a decrease of the same of 11%, this data is always compensated with reference to the cut-off of the control cells control+buffer.
[0113] It is therefore possible to conclude that the fusion protein according to the invention does not exhibit relevant cytotoxic effects on human cell cultures in vitro.
[0114] Agroadhesion and effect on mycoplasma/phytoplasmas and parasitic fungi
[0115] Mycoplasma are a class of microorganisms completely devoid of cell walls. Thanks to this characteristic they are completely immune to penicillins and to all those antibiotics that act on the cell wall biosynthesis process (such as cephalosporins). Their cell membrane has also evolved in order to compensate for the lack of the peptidoglycan wall: in fact its composition is very particular and different from that of other microorganisms; it is rich above all in sterols (unique case among bacterial species) and this allows them to keep their cell volume constant and resist water stress. Mycoplasma can be pathogenic to humans, animals and plants; the pathogenic mycoplasmas of plants are commonly divided by botanists and agrarians into two large classes, regardless of the species: Spiroplasmas (spiral-shaped and cultivable in vitro) and Phytoplasmas (which have variable shape, are completely obligate parasites and are not cultivable in vitro); both the ones and the others are in any case always Mollicutes and therefore have all the characteristics listed above, as well as a few other typical ones.
[0116] In order to verify the effectiveness of the PIGP+gtf1 protein in countering mycoplasma infection or infestation, a mixture of raw Pichia Pastoris extract as defined above and containing the PGIP+1GTF1 protein with a non-ionic tackifier was used directly on the leaves. (poly-1-pmenthene, glycolic extracts, ethoxylated isodecyl alcohol) at the concentration 0.005%-0.0025%. Specifically, heptamethyltrisiloxane modified polyalkylene oxide was used with a dilution of 0.005%; said vehicle has proved to be surprisingly effective here for anchoring the propagated molecule on plant surfaces, placed in a vertical position.
[0117] The photos shown in
[0118] In
[0119] This experiment demonstrates how phytoplasmas (microorganisms completely similar to mycoplasma) are effectively blocked after a few hours of contact.
[0120] The protein according to the invention therefore has proven antimicrobial efficacy, that is, it is capable of inhibiting the growth of bacteria, fungi, viruses and mycoplasma and phytoplasmas.
[0121] In another embodiment, the method of agroinfiltration of a suspension of Agrobacterium tumefaciens in the intercellular spaces of the leaves was used by spraying or by using a syringe without a needle; in fact it has been shown that good levels of transient gene expression are obtained with this method (Santos-Rosa et al. 2008; Zottini et al., 2008; Bertazzon et al. 2011.). In particular, the fragment of SEQ ID no 3 according to the invention is inserted in a vector suitable for use in A. Tumefaciens and subsequently in this electroporate; preferably the vector is the vector pRI-201AN (takara) which possesses two multiple Boning sites which therefore provides the vector with the ability to double express PGIP-GTF1, and the vector after purification is electroporated in the non-tumorigenic bacterium A. tumefaciens LB 4404 (takara). The A. Tumefaciens thus obtained are subsequently used directly on the leaf tissue, preferably a suspension of diluted product (400 μg) is made together with the non-ionic glue solution at a concentration of 0.0005%, and sprayed on the leaf. In
[0122] The object of the present invention is therefore a composition comprising A. Tumefaciens transformed with an expression vector, comprising a nucleic acid having a sequence of SEQ ID no 3 or a sequence with at least 90% sequence identity with SEQ ID no. 3 or a sequence with at least 95% identity with SEQ ID no. 3 and at least one non-ionic tackifier or glue, preferably at 0.0005%.
[0123] Therefore, the protein according to the present invention can be defined as an antibacterial, antifungal, antiviral and disinfectant agent.
[0124] More specifically, the invention therefore relates to the use of the protein according to the invention for antimicrobial preparations for use in various fields.
[0125] Setting Medical and Veterinary
[0126] In particular, having regard to its safety demonstrated in the cytotoxicity experiments, it is object of the present invention a protein having amino acid sequence of SEQ ID No. 4 and/or a protein having 90% and more preferably 95% of identity sequence with SEQ ID no.4 for use in the medical field. Another object of the present invention is said protein for use as a medicinal product defined by its antimicrobial function, ie antiviral, antibacterial, antifungal, antifungal. The protein according to the invention can be used in compositions formulated in liquid form, as a cream or lotion or as a gel or spray for topical applications on animals and humans. Topical applications include applications on the skin and mucous membranes. The carriers can be all those used in the pharmaceutical and cosmetic fields. The adjuvants and carriers are those cosmetically and pharmaceutically acceptable, as well as the adjuvants and carriers used in the phytopharmaceutical field.
[0127] Carriers include lipid carriers, preferably single and multi-lamellar liposomes; in a preferred embodiment, the protein according to the invention is in fact packaged or encapsulated in said structures to allow more effective delivery to the treatment site, better diffusion and protection from self-oxidation, thus extending the time of residence on the surfaces, and promoting affinity with microbial structures.
[0128] The protein according to the invention is preferably administered topically, cutaneously and/or oropharyngeal-nasal and can be formulated in sprays, aerosols for inhalation, gels, creams and lotions. The object of the present invention is therefore a composition comprising the protein having SEQ ID no 4 and/or a protein having 90% and more preferably 95% sequence identity with SEQ ID no.4; optionally said composition comprises at least one of saline buffer, preferably PBS, protease inhibitor, MgCl.sub.2, pharmaceutically acceptable excipients, carriers, thickeners and gelling agents. In a preferred embodiment, the composition according to the invention further comprises cellulose, preferably methylcellulose. The composition comprising the protein according to the invention can also be formulated in spray, semi-liquid, creamy, semi solid or solid forms, creams, suspensions, milks or soaps.
[0129] The composition according to the invention can also be composed of a lysate of microorganisms expressing the protein having SEQ ID no 4 and/or a protein having 90% and more preferably 95% sequence identity with SEQ ID no.4;
[0130] Environmental Disinfectant
[0131] The results of the in vitro experimentation shown in the figures have shown a remarkable antimicrobial activity of the protein according to the invention against various microorganisms, in particular Gram positive bacteria, fungi, mycoplasma and viruses.
[0132] The protein having amino acid sequence of SEQ ID 4 and/or amino acid sequence having 90% and more preferably 95% sequence identity with SEQ ID no.4 is therefore usable as an environmental disinfectant and antimicrobial, both in human, animal and vegetable fields. The protein according to the invention can be used alone or included in a composition further comprising vectors known to the skilled in the art and can be applied by spraying, formulated in gel or applied in solution. A composition comprising the protein according to the invention can therefore be formulated in spray, semi-liquid, semi-solid, solid, suspension, or gel form to be applied on the surfaces to be treated. The application can also be a spray. This composition can also be used as an antimicrobial functional base in the field of disinfection in various areas, for example in the clinic, hospital and domestic field, in high traffic environments, in filters of air inlet and extraction systems or air conditioners or of ATU treatment units, in environments used for food preparation. In general, in all those areas where it is necessary to adopt antimicrobial prophylaxis. By way of non-limiting example, compositions comprising the protein according to the invention can be used in household hygiene products as a disinfectant; in skin disinfectants, in soaps etc. ex. in the disinfection of the intact skin, for example in the disinfection of the hands in the preoperative phase; in hospital wards, against the transmission of nosocomial cross-infections; in disinfectants or community hygiene products (e.g. hotels, airports, schools, doctors' offices or dental offices); in the disinfection of surgical instruments.
[0133] The composition comprising the protein according to the invention can further comprise at least one of saline buffer, preferably PBS, protease inhibitor, MgCl.sub.2, cellulose and methyl cellulose, gelling agents, preferably methyl orixane or alginates such as calcium or sodium alginate. The object of the present invention is therefore a method for the control or elimination of viruses, gram+bacteria, mycoplasmas, phytoplasmas, microscopic spore and oospore fungi, preferably S. aureus and Sars-CoV-2 from environments or surfaces where this method comprises the application on the surface or on parts thereof of at least one of—a lysate of microorganisms, Pichia Pastoris or Bacillus subtilis, expressing the protein having SEQ ID no 4 and/or a protein having 90% and more preferably the 95% sequence identity with SEQ ID no.4 [0134] a protein having SEQ ID no 4 and/or a protein having 90% and more preferably 95% sequence identity with SEQ ID no.4—compositions comprising called protein. From the tests carried out, the protein according to the invention resists 48-72 h on surfaces at ambient T.
[0135] Agritech
[0136] The results of the in vitro experimentation shown in the figures have shown a remarkable antimicrobial activity of the protein according to the invention towards various microorganisms, in particular Gram positive bacteria, fungi, mycoplasma and viruses. In particular, a considerable activity of the protein according to the invention has been found in contrasting pathogenic microorganisms of plants. Therefore, the subject of the present invention is the synthetic fusion protein having amino acid sequence of SEQ ID 4 and/or amino acid sequence having 90% and more preferably 95% sequence identity with SEQ ID no. 4 for the treatment of infections in plant species, preferably in the agricultural and phytopharmaceutical fields; the protein according to the invention can be used for the same purpose both used as such and by means of the agroinfiltration technique.
[0137] The protein can be used in compositions formulated in liquid form, or in lyophilized form.
[0138] The application can be performed with compositions comprising the carriers typically used for applications on plants.
[0139] In one embodiment, the use of a non-ionic glue is preferred, which has the function of impregnating the leaf plant tissue to allow certain pesticides to penetrate, in this case it has been used to make root both the raw Pichia pastoris extract expressing both the PGIP+GTF1 protein and the protein itself. The adjuvants and carriers are pharmaceutically acceptable, as are the adjuvants and carriers used in the phytopharmaceutical field.
[0140] Carriers include uni and multilamellar liposomes. The composition comprising the protein according to the invention can also be formulated in liquid, semi-liquid or gel form to be applied on the plants to be treated. The application can also be a spray. In one embodiment the protein according to the invention is comprised in a composition further comprising a non-ionic tackifier at concentrations ranging from 0.0005% to 0.00025%. Among the non-ionic tackifiers, poly-1-pmenthene, glycolic extracts, isodecyl alcohol ethoxylate are preferred, even more preferred is heptamethyltrisiloxane modified polyalkylene oxide preferably at a concentration of 0.0005%.
[0141] The composition comprising the protein according to the invention can further comprise at least one of saline buffer, preferably PBS, protease inhibitor, MgCl.sub.2, cellulose and methyl cellulose, gelling agents, preferably methyl orixane or alginates such as calcium or sodium alginate. The composition according to the invention can also be composed of a lysate of microorganisms expressing the protein having SEQ ID no 4 and/or a protein having 90% and more preferably 95% sequence identity with SEQ ID no.4 A composition comprising the protein according to the invention can therefore be used with an antimicrobial function in the agricultural field and for the treatment of diseases of plants in culture or in ornamental plants. The object of the present invention is therefore a method for treating plant pathogens, where said method comprises the application on the plant or on parts of it of at least one of—a lysate of microorganisms, Pichia Pastoris or Bacillus subtilis, expressing the protein having SEQ ID no 4 and/or a protein having 90% and more preferably 95% sequence identity with SEQ ID no 4—a protein having SEQ ID no 4 and/or a protein having 90% and more preferably 95% sequence identity with SEQ ID no.4—compositions comprising said protein. From the tests carried out, the protein according to the invention resists 48-72 h on surfaces at ambient T. In an alternative embodiment, the protein according to the invention can be used in infection techniques with A. Tumefaciens. The object of the present invention is therefore a method for treating plant pathogens where said method comprises introducing in said plants an expression vector comprising a nucleotide sequence of SEQ ID no. 3 and/or a sequence having at least 90% and more preferably 95% sequence identity with SEQ ID no. 3 by agroinfiltration with A. Tumefaciens. The following examples are provided for the sole purpose of illustrating the invention and are in no way to be considered as limiting its scope.
PROTOCOLS AND EXAMPLES
[0142] Cloning of pBE-s DNA and pGAPZ ALPHA A Pr1 201-AN vectors:
1) Gently mix fresh competent cells and transfer 100 μl to a polypropylene tube.
2) Add to the 100 μl of pR101-AN cells in quantities 510 ng.
3) Incubate in an ice bath for 30′.
4) Incubate at +42° C. for 43″.
[0143] 5) Return to the ice bath for 1-2′.
6) Add the SOC medium, pre-incubated at +37° C. up to a final volume of 1 ml.
7) Incubate by shaking at 160-225 rpm for 1 hour at +37° C.
9) Plate on selective media, typically less than 100 μl for each 9 cm diameter plate.
10) Incubate overnight at +37° C.
11) Selection of the colonies and amplification of the same by incubation overnight at +37° C. in LB plate with the selective antibiotic for which the plasmid has the specific resistance kanamycin/ampicillin.
[0144] PURIFICATION of plasmids after cloning, primary and secondary after centrifugation of the liquid, 250 μl of resuspension solution are added to the cell pellet after 250 μl of Lysis solution and 350 μl of neutralization solution are mixed, then centrifuged at 14,000 RPM for 5 min. Subsequently, the content is placed in a purification column and centrifuged at 14,000 RPM for 1 min. Once the eluate has been discarded, 500 μl of “wash solution” are added twice.
[0145] Once the eluate has been discarded, place 50μl of the “elution buffer” in the column and the concentration of the purity of the plasmid is calculated on the spectrophotometer, which is preserved at 20° C.
[0146] Enzymatic cutting of pBE-s plasmids DNA pGAPZ ALPHA A
[0147] Multiple reaction of enzymatic digestion and linearization.
[0148] In a final volume of 20 μl, mix:
Buffer 10PGIP+GTF1 2 μL pBE-s DNA/pGAPZ ALPHA A Da in a quantity ranging from 0.2 to
1 μg Restriction enzymes as follows:
1 μL KpNI
1 μL XBAI
Nuclease Free Water Qb
[0149] The reaction proceeds according to the protocol known to the expert in the field.
Enzymatic cutting and linearization IN PR 201-AN
Multiple reaction of enzymatic digestion and linearization.in a final volume of 20 μl:
MixBuffer 10PGIP+GTF1 2 μL DNA Pr pBE-s DNA/pGAPZ ALPHA A Da in a quantity ranging
from 0.2 to 1 μg Restriction enzymes as follows:
1 μL XBAI
1 μL NDEI
[0150] Nuclease free water qb
[0151] Ligation of the Products
[0152] In a final volume of 20 μl the following are mixed: DNA of the PGIP+GTF1 complex gene linearized as above Insert DNA from 10 to 100 ng, molar excess 3:1 compared to the DNAdeI Vector in use and the everything is left at room temperature for an hour.
[0153] Alternative method: 15 μL of daligare products are inserted using “IN FUSION HD CLONING” (takara) Master Mix, PGIP+GTF1+carrier in use, always in a proportion 3:1 and in a total of 20 μL of volume+Nuclease free water to taste All kept at +50° C. for 15′ min. The whole is inserted into E. coli STELLAR 0 DH5a cells for re-cloning.
[0154] Plasmid Purification
1) add 250NL resupension solution (Jet Plasmid Thermofisher gene) to the cell pellet.
2) 250 μl of Lysis solution
3) 350 μl of neutalization solution,
4) centrifuge at 14.000 RPM for 5′ min
5) recover the supernatant and insert 500 μl in the purification column
6) centrifuge at 14.000 RPM for 5′ min
7) 500 μl of Washing buffer to wash column centrifuge at 14.000 RPM for 1′ min repeating twice
8) add 50 μl of resuspension solution and centrifuge at 14.000 RPM for 2′ min. The purified plasmid is stored at −20° C.
[0155] Electroporation in Bacillus subtilis/Pichia Pastoris A. Tumefaciens
1. Place 1.5 ml tubes containing PIGP+GTF1 competent cells and electro-competent b. subtilis/Pichia Pastoris on ice. For Pichia Pastoris, after electroporation, the plamsmide pGapz alpha A is linearized with Avrll at +37° C. 15 min in 20 μl.
2. Add 6 μl (1 ng) of binary vector plasmid DNA to 20 μl of competent cells of PICHIA PASTORIS BACILLUS SUBTILIS and A. TUMEFACIENS mix gently.
3. Place the 0.1 cm electroporation cuvette on ice.
4. set the Gene Pulser II to 25 μF, 200 0 and 2-2.5 kV.*1
[0156] 5. Transfer the cells and DNA prepared in step 2 to the electroporation and electroporation cuvette.
6. Remove the cuvette from the porator, add 1 mL of SOC*2 media and transfer to a 14 mL round bottom tube.
7. Incubate for 1 hour at 30° C., shaking at 100 rpm.
8. Plate 50-100 μl of cells on LB agar plates with 50 μg/ml kanamycin/10 μg zeocin (depending on vector)*3 and incubate for up to 48 hours at 30° C.
9. Amplify the colony in liquid LB with Kanamycin/10 μg zeocin at +30° C./+37° C. (depending on the vector).
[0157] Immunoblot
[0158] In order to verify the production of the pgip+gtf1 protein and its production site, the cell pellets of the modified bacteria were sonicated after purification on his-tag affinity column demonstrating that the presence of the protein is intra-cellular, measuring its spectro-photometrically concentration, during elution in the purification process amounting to 1 μg/μl. A HIS-TAG positive control such as albumin and a negative control in well 3, consisting of 10 μl of loading buffer and running buffer, are inserted in well n.2 10ul. A raw extract was placed in well n.4 The concentration of the purified protein in well n.5 was evaluated in 1 μg/μl. subsequently, characterization was carried out by electrophoresis
[0159] After washing with 0.1X PBS and 0.1% Tween 20 (Sigma). The resulting membrane after the blotting run was incubated in a solution containing 5 ml of anti-HISTAG mouse monoclonal primary antibody (Ab-Cam) diluted in PBS 1:5000 at room temperature for 1 hour. It is then washed again washed with 5 ml of PBS-Tween 20 solution, six times for 5′ min. and incubated with a further 5 ml of 1:10,000 diluted secondary antibody (rabbit anti-mouse conjugated with peroxidase, Sigma) at room temperature for 1 hour. After 6 washes with PBS-Tween 20 the proteins recognized by the antibody with the ECL method (Amersham) were visualized, following the instructions of the supplier company. The experiment confirms the presence of a purified protein in well 5 at about 62 Kda of molecular weight at a concentration of 1 μg/μl. While in well 4 the same hyper glycosylated protein at 200 Kda of weight is identified.
[0160] Plate contact with S. aureus and the raw extract and any other bacteria after 2 min sonication. at a frequency>20kH, on ice, the bacterial lysate is centrifuged for 30″ sec. in a 1.5 ml eppendorf type tube and centrifuged at 14,000 rpm for 10″ sec. The reading of the concentration of the raw extract reported a spectrometric reading at 595 nm, according to the Bradford method, obtaining the concentration of 400 μg. Subsequently 100 μl of supernatant after centrifugation of 1.5 ml at 1400 rpm for 2 minutes are placed in a Petri dish and allowed to react with a strain previously cultivated on selective medium for S. aureus coagulase positive calculating a final concentration of the raw extract of 100 μg. The contact between PGIP+GTF1 and s.aureus is left for 48 h
[0161] Contact test with spike proteins and relative immunoblot
[0162] Spike proteins, ready to use (ab-cam) are left to react with the purified and isolated protein after being purified in a 10-200 mM imidazole gradient on an IMAC His-tag column. The reading of the purified protein concentration reported a spectrometric reading at 595 nm, according to the Bradford method, obtaining the concentration of 1 μg/μl. The experiment using the protein characterized in
[0163] Biocompatibility Experiments
[0164] Material Used:
[0165] A2780 cells (human ovarian cancer) are cultured in RPMI-1640 medium (Sigma Aldrich R6504) supplemented with 10% fetal bovine serum (Gibco). MSTO-211H (biphasic human mesothelioma) cells are cultured in RPMI-1640 medium (Sigma Aldrich R6504) supplemented with 2.38 g/L Hepes, 0.11 g/L Na-pyruvate, 2.5 g/L glucose and 10% fetal bovine serum.
[0166] The cells are kept in an incubator in a humidified atmosphere at 37° C. and handled using a sterile laminar flow hood. The cytotoxicity of two solutions was evaluated:
a) a protein solution (concentration of the stock solution equal to 1.9 micromolar) and
b) a solution containing only the buffer of the above protein solution.
[0167] Experimental Protocol:
For the treatment, the cells were seeded in complete medium in P24 breast plates under the following experimental conditions:
>25-30 thousand cells/well for the assays at 72 h
>50 thousand cells/well for the assays at 48 h.
[0168] After 24 hours from sowing the exhausted medium was removed and the cells were treated, in duplicate, according to the following scheme:
[0169] control (containing complete medium) control+buffer (containing complete medium added with the maximum volume of buffer used for the treatment and corresponding to the condition of maximum concentration of the protein, 20 nM) sol. 1 nM protein (complete medium containing the protein solution at 1 nM concentration) sol. 2.5 nM protein (complete medium containing the protein solution at 2.5 nM concentration) sol. 5 nM protein (complete medium containing the protein solution at 5 nM concentration) sol. 10 nM protein (complete medium containing the protein solution at 10 nM concentration) sol. 20 nM protein (complete medium containing the protein solution at 20 nM concentration) After 48 hours and 72 hours from the treatment the medium was removed, the cells were detached using a solution containing 10 mM trypsin and 0.3 mM EDTA in phosphate buffer and immediately counted under a light microscope using the vital trypan blue dye (0.1% (w/v) solution in phosphate buffer). The results obtained were calculated as a percentage of viability with respect to the control condition (for the 20 nM condition the viability values were also calculated with respect to the control condition+buffer.
[0170] Agro-adhesion/adhesion with plasmid and A. Tumefaciens
[0171] (Santos -Rosa et al. 2008; Zottini et al., 2008; Bertazzon et al. 2011). The coding sequence for the enzymes of interest PGIP+GTF1 was cloned into a pRI 201 AN (TAKARA) expression vector with which it is Agrobacterium tumefaciens was engineered by means of enzymatic cloning and electroporation techniques according to traditional methods. In a preferred embodiment, the hypervirulent, non-tumorigenic strain GV3101 of Agrobacterium in particular LB 4404 (takara) was chosen. occurs with more efficiency, as the vector pR 201-AN expresses the PGIP-GTF1 gene in double measure without the formation of galls, in a very short time span. Use of heptamethyltrisiloxane, modified polyalkylene oxide, (silwet velonex) impregnates the leaves very quickly and the addition of agrobacterium tumenfaciens increases its effectiveness; the effect of the adhesive in fact consolidates the lesion and makes the modified rhizome penetrate very quickly, allowing the immediate action of the construct, which begins to block the pathology.
BIBLIOGRAPHY
[0172] Ausubel, F M, Brent, R., Kingston, R E, Moore, D D, Seidman, J G, Smith, J A, and Struhl, K. (1994) Current Protocols in Molecular Biology, Greene Publishing Associates and Wiley-Interscience, New York [0173] Baron, M., Reynes, J P, Stassi, D., and Tiraby, G. (1992) A Selectable Bifunctional b-Galactosidase: Phleomycinresistance Fusion Protein as a Potential Marker for Eukaryotic Cells. Gene 114, 239-243 [0174] Brake, A J, Merryweather, J P, Colt, D G, Heberlein, U A, Masiarz, G R, Mullenbach, G T, Urdea, M S, Valenzuela, P., and Barr, P J (1984) a-Factor-Directed Synthesis and Secretion of Mature Foreign Proteins in Saccharomyces cerevisiae. Proc. Natl. Acad. Sci. USA 81, 4642-4646 [0175] Calmels, T., Parriche, M., Burand, H., and Tiraby, G. (1991) High Efficiency Transformation of Tolypocladium geodes Conidiospores to Phleomycin Resistance. Curr. Genet. 20, 309-314 [0176] Cregg, J M, Barringer, K J, and Hessler, A Y (1985) Pichia Pastoris as a Host System for Transformations. Mol. Cell. Biol. 5, 3376-3385 [0177] Cregg, J M, Madden, K R, Barringer, K J, Thill, G., and Stillman, C A (1989) Functional Characterization of the Two Alcohol Oxidase Genes from the Yeast, Pichia Pastoris. Mol. Cell. Biol. 9, 1316-1323 [0178] Drocourt, D., Calmels, T P G, Reynes, J P, Baron, M., and Tiraby, G. (1990) Cassettes of the Streptoalloteichus hindustanus ble Gene for Transformation of Lower and Higher Eukaryotes to Phleomycin Resistance. Nucleic Acids Res. 18, 4009 [0179] Evan, G I, Lewis, G K, Ramsay, G., and Bishop, V M (1985) Isolation of Monoclonal Antibodies Specific for c-myc Proto-oncogene Product. Mol. Cell. Biol. 5, 3610-3616 [0180] Gatignol, A., Durand, H., and Tiraby, G. (1988) Bleomycin Resistance Conferred by a Drug-binding Protein. FEB Letters 230, 171-175 [0181] Gietz, R D, and Schiestl, R H (1996) in Methods in Molecular and Cellular Biology, in press [0182] Henikoff, S., and Cohen, E H (1984) Sequences Responsible for Transcription Termination on a Gene Segment in Saccharomyces cerevisiae. Mol. Cell. Biol. 4, 1515-1520 [0183] Imiger, S., Egli, C M, and Braus, G H (1991) Different Classes of Polyadenylation Sites in the Yeast Saccharomyces cerevisiae. Mol. Cell. Bio. 11, 3060-3069 [0184] Kozak, M. (1987) An Analysis of 5AL-Noncoding Sequences from 699 Vertebrate Messenger RNAs. Nucleic Acids Res. 15, 8125-8148 [0185] Kozak, M. (1990) Downstream Secondary Structure Facilitates Recognition of Initiator Codons by Eukaryotic Ribosomes. Proc. Natl. Acad. Sci. USA 87, 8301-8305 [0186] Kozak, M. (1991) An Analysis of Vertebrate mRNA Sequences: Intimations of Translational Control. J. Cell Biology 115, 887-903 [0187] Mulsant, P., Tiraby, G., Kallerhoff, J., and Perret, J. (1988) Phleomycin Resistance as a Dominant Selectable Marker in CHO Cells. Somat. Cell Mol. Genet. 14, 243-252 [0188] Perez, P., Tiraby, G., Kallerhoff, J., and Perret, J. (1989) Phleomycin Resistance as a Dominant Selectable Marker for Plant Cell Transformation. Plant Mol. Biol. 13, 365-373 [0189] Sambrook, J., Fritsch, E F, and Maniatis, T. (1989) Molecular Cloning: A Laboratory Manual, Second Ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y. Scorer, C A, Buckholz, R G, Clare, J J, and Romanos, M A (1993) The Intracellular Production and Secretion of HIV-1 Envelope Protein in the Methylotrophic Yeast Pichia Pastoris. Gene 136, 111-119 [0190] Waterham, H R, Digan, M E, Koutz, P J, Lair, S V, and Cregg, J M (1997) Isolation of the Pichia Pastoris Glyceraldehyde-3-Phosphate Dehydrogenase Gene and Regulation and Use of its Promoter. Gene 186, 37-44 [0191] Zaret, K S, and Sherman, F. (1984) Mutationally Altered 3AL Ends of Yeast CYC1 mRNA Affect Transcript Stabilityand Translational Efficiency. J. Mol. Biol. 177, 107-136 Thi Lan Than Bien et al. J.Gen. Appi. Microb.175-182 (2014)