Anti-TIM-3 antibodies and uses thereof
11214615 · 2022-01-04
Assignee
Inventors
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
Abstract
Anti-TIM-3 antibodies and antigen-binding fragments thereof are described. Also described are nucleic acids encoding the antibodies, compositions comprising the antibodies, and methods of producing the antibodies and using the antibodies for treating or preventing diseases such as cancer, an inflammatory disease, an autoimmune disease, a metabolic disease, and/or infectious diseases.
Claims
1. An isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequences of: (1) SEQ ID NOs:43, 44, 169, 106, 107, and 170, respectively; (2) SEQ ID NOs:55, 56, 57, 118, 119, and 120, respectively; (3) SEQ ID NOs:58, 59, 60, 121, 122, and 123, respectively; (4) SEQ ID NOs:61, 62, 63, 124, 125, and 126, respectively; (5) SEQ ID NOs:64, 65, 66, 127, 128, and 129, respectively; (6) SEQ ID NOs:67, 68, 69, 130, 131, and 132, respectively; (7) SEQ ID NOs:70, 71, 72, 133, 134, and 135, respectively; (8) SEQ ID NOs:73, 74, 75, 136, 137, and 138, respectively; (9) SEQ ID NOs:76, 77, 78, 139, 140, and 141, respectively; (10) SEQ ID NOs:79, 80, 81, 142, 143, and 144, respectively; (11) SEQ ID NOs:82, 83, 84, 145, 146, and 147, respectively; (12) SEQ ID NOs:85, 86, 87, 148, 149, and 150, respectively; (13) SEQ ID NOs:88, 89, 90, 151, 152, and 153, respectively; (14) SEQ ID NOs:91, 92, 93, 154, 155, and 156, respectively; (15) SEQ ID NOs:94, 95, 96, 157, 158, and 159, respectively; (16) SEQ ID NOs:97, 98, 99, 160, 161, and 162, respectively; (17) SEQ ID NOs:100, 101, 102, 163, 164, and 165, respectively; or (18) SEQ ID NOs:103, 104, 105, 166, 167, and 168, respectively; wherein the antibody or antigen-binding fragment thereof specifically binds TIM-3.
2. The isolated monoclonal antibody or antigen-binding fragment of claim 1, comprising a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 171, 172, 173, or 174, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 175, or 176.
3. The isolated monoclonal antibody or antigen-binding fragment of claim 1, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:1, and a light chain variable region having the polypeptide sequence of SEQ ID NO:2; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:3, and a light chain variable region having the polypeptide sequence of SEQ ID NO:4; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:5, and a light chain variable region having the polypeptide sequence of SEQ ID NO:6; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:7, and a light chain variable region having the polypeptide sequence of SEQ ID NO:8; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:9, and a light chain variable region having the polypeptide sequence of SEQ ID NO:10; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:11, and a light chain variable region having the polypeptide sequence of SEQ ID NO:12; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:13, and a light chain variable region having the polypeptide sequence of SEQ ID NO:14; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:15, and a light chain variable region having the polypeptide sequence of SEQ ID NO:16; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:17, and a light chain variable region having the polypeptide sequence of SEQ ID NO:18; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:19, and a light chain variable region having the polypeptide sequence of SEQ ID NO:20; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:21, and a light chain variable region having the polypeptide sequence of SEQ ID NO:22; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:23, and a light chain variable region having the polypeptide sequence of SEQ ID NO:24; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:25, and a light chain variable region having the polypeptide sequence of SEQ ID NO:26; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:27, and a light chain variable region having the polypeptide sequence of SEQ ID NO:28; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:29, and a light chain variable region having the polypeptide sequence of SEQ ID NO:30; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:31, and a light chain variable region having the polypeptide sequence of SEQ ID NO:32; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:33, and a light chain variable region having the polypeptide sequence of SEQ ID NO:34; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:35, and a light chain variable region having the polypeptide sequence of SEQ ID NO:36; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:37, and a light chain variable region having the polypeptide sequence of SEQ ID NO:38; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:39, and a light chain variable region having the polypeptide sequence of SEQ ID NO:40; u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:41, and a light chain variable region having the polypeptide sequence of SEQ ID NO:42; v. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:171, and a light chain variable region having the polypeptide sequence of SEQ ID NO:175; w. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:172, and a light chain variable region having the polypeptide sequence of SEQ ID NO:175; x. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:173, and a light chain variable region having the polypeptide sequence of SEQ ID NO:176; or y. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:174, and a light chain variable region having the polypeptide sequence of SEQ ID NO:176.
4. The isolated monoclonal antibody or antigen-binding fragment of claim 1, wherein the antibody or antigen-binding fragment thereof is chimeric and/or humanized.
5. The isolated monoclonal antibody or antigen-binding fragment of claim 1, wherein the antibody or antigen-binding fragment thereof is capable of blocking binding of TIM-3 to phosphatidylserine (PtdSer).
6. An isolated nucleic acid encoding the monoclonal antibody or antigen-binding fragment of claim 1.
7. A vector comprising the isolated nucleic acid of claim 6.
8. A host cell comprising the vector of claim 7.
9. A pharmaceutical composition, comprising the isolated monoclonal antibody or antigen-binding fragment of claim 1 and a pharmaceutically acceptable carrier.
10. A method of blocking binding of TIM-3 to phosphatidylserine (PtdSer) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of claim 9.
11. A method of treating a disease or condition selected from the group consisting of a cancer and an infectious disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of claim 9.
12. A method of producing the monoclonal antibody or antigen-binding fragment of claim 1, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment under conditions to produce the monoclonal antibody or antigen-binding fragment, and recovering the antibody or antigen-binding fragment from the cell or culture.
13. A method of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment of claim 1, comprising combining the monoclonal antibody or antigen-binding fragment with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
14. A method of determining a level of TIM-3 in a subject, comprising (a) obtaining a sample from the subject; (b) contacting the sample with a monoclonal antibody or antigen-binding fragment thereof of claim 1; and (c) determining the level of TIM-3 in the subject.
15. The method of claim 14, wherein the sample is a tissue sample or blood sample.
16. The method of claim 15, wherein the tissue sample is a cancer tissue sample.
17. A bispecific antibody comprising the monoclonal antibody or antigen-binding fragment thereof of claim 1.
18. The monoclonal antibody or antigen-binding fragment thereof of claim 1, wherein the monoclonal antibody or antigen-binding fragment thereof specifically binds human TIM-3.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The foregoing summary, as well as the following detailed description of preferred embodiments of the present application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the application is not limited to the precise embodiments shown in the drawings.
(2)
(3)
(4)
DETAILED DESCRIPTION OF THE INVENTION
(5) Various publications, articles and patents are cited or described in the background and throughout the specification; each of these references is herein incorporated by reference in its entirety. Discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is for the purpose of providing context for the invention. Such discussion is not an admission that any or all of these matters form part of the prior art with respect to any inventions disclosed or claimed.
(6) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention pertains. Otherwise, certain terms used herein have the meanings as set forth in the specification.
(7) It must be noted that as used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural reference unless the context clearly dictates otherwise.
(8) Unless otherwise stated, any numerical values, such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term “about.” Thus, a numerical value typically includes ±10% of the recited value. For example, a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL. Likewise, a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v). As used herein, the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
(9) Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the invention.
(10) As used herein, the terms “comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended. For example, a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus. Further, unless expressly stated to the contrary, “or” refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).
(11) As used herein, the conjunctive term “and/or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and/or,” a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”
(12) As used herein, the term “consists of,” or variations such as “consist of” or “consisting of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, but that no additional integer or group of integers can be added to the specified method, structure, or composition.
(13) As used herein, the term “consists essentially of,” or variations such as “consist essentially of” or “consisting essentially of,” as used throughout the specification and claims, indicate the inclusion of any recited integer or group of integers, and the optional inclusion of any recited integer or group of integers that do not materially change the basic or novel properties of the specified method, structure or composition. See M.P.E.P. § 2111.03.
(14) As used herein, “subject” means any animal, preferably a mammal, most preferably a human. The term “mammal” as used herein, encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
(15) The words “right,” “left,” “lower,” and “upper” designate directions in the drawings to which reference is made.
(16) It should also be understood that the terms “about,” “approximately,” “generally,” “substantially” and like terms, used herein when referring to a dimension or characteristic of a component of the preferred invention, indicate that the described dimension/characteristic is not a strict boundary or parameter and does not exclude minor variations therefrom that are functionally the same or similar, as would be understood by one having ordinary skill in the art. At a minimum, such references that include a numerical parameter would include variations that, using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.), would not vary the least significant digit.
(17) The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences (e.g., anti-TIM-3 antibodies, TIM-3 polypeptides, and polynucleotides that encode them), refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
(18) For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
(19) Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally, Current Protocols in Molecular Biology, F. M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).
(20) Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
(21) Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=−4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
(22) In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
(23) A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.
(24) Antibodies
(25) The invention generally relates to isolated anti-TIM-3 antibodies, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. Methods of making the antibodies, and methods of using the antibodies to treat diseases including cancer, inflammatory diseases, autoimmune diseases, metabolic diseases, and/or infectious diseases are also provided. The antibodies of the invention possess one or more desirable functional properties, including but not limited to high-affinity binding to TIM-3, high specificity to TIM-3, the ability to block the binding of TIM-3 to phosphatidylserine (PtdSer), the ability to block the binding of TIM-3 to galectin-9, the ability to block the binding of TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), the ability to block the binding of TIM-3 to high mobility group protein B1 (HMGB1), the ability to stimulate the production of cytokines such as, but not limited to, IL-2 and IFN-γ, and the ability to inhibit tumor growth in animal models and subjects when administered alone or in combination with other anti-cancer therapies.
(26) In a general aspect, the invention relates to isolated monoclonal antibodies or antigen-binding fragments thereof that bind TIM-3.
(27) As used herein, the term “antibody” is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgA1, IgA2, IgG1, IgG2, IgG3 and IgG4. Accordingly, the antibodies of the invention can be of any of the five major classes or corresponding sub-classes. Preferably, the antibodies of the invention are IgG1, IgG2, IgG3 or IgG4. Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains. Accordingly, the antibodies of the invention can contain a kappa or lambda light chain constant domain. According to particular embodiments, the antibodies of the invention include heavy and/or light chain constant regions from rat or human antibodies. In addition to the heavy and light constant domains, antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; CDR1, CDR2, and CDR3). The light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCRD3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCRD2, and HCDR3.
(28) As used herein, the term an “isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to TIM-3 is substantially free of antibodies that do not bind to TIM-3). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.
(29) As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. The monoclonal antibodies of the invention can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods. For example, the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
(30) As used herein, the term “antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab′, a F(ab′)2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv).sub.2, a bispecific dsFv (dsFv-dsFv′), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdab) an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment binds. According to particular embodiments, the antigen-binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment of the heavy chain. According to other particular embodiments, the antigen-binding fragment comprises Fab and F(ab'). As used herein, the term “single-chain antibody” refers to a conventional single-chain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids. As used herein, the term “single domain antibody” refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.
(31) As used herein, the term “human antibody” refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.
(32) As used herein, the term “humanized antibody” refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.
(33) As used herein, the term “chimeric antibody” refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species. The variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.
(34) As used herein, the term “multispecific antibody” refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on the same antigen, e.g. the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment, the first and second epitopes do not overlap or do not substantially overlap. In an embodiment, the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment, a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain. In an embodiment, a multispecific antibody is a bispecific antibody molecule, a trispecific antibody, or a tetraspecific antibody molecule.
(35) As used herein, the term “bispecifc antibody” refers to a multispecific antibody that binds no more than two epitopes or two antigens. A bispecific antibody is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope. In an embodiment, the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein). In an embodiment a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope. In an embodiment, a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope. In an embodiment, the first epitope is located on TIM-3 and the second epitope is located on PD-1, PD-L1, LAG-3, CTLA-4, EGFR, HER-2, CD19, CD20, CD33, DLL-3, CD73, apelin, CD3, CD47, TIP-1, CLDN18.2, FOLR1 and/or other tumor associated immune suppressors or surface antigens.
(36) As used herein, the term “TIM-3” refers to the T-cell immunoglobulin and mucin-domain containing molecule 3 protein, a receptor expressed on myeloid cells, including dendritic cells (DCs), macrophages and natural killer (NK) cells, and a subset of lymphoid cells, such as T cells. TIM-3 is capable of binding to phosphatidylserine (PtdSer), which is the principal signal for the phagocytosis of apoptotic bodies or cells. When the binding of PtdSer and TIM-3 is blocked with specific antibodies, apoptotic bodies are not removed, which can induce immunological abnormalities, such as the generation of autoantibodies (reviewed in Ocana-Guzman et al., “TIM-3 regulates distinct functions in macrophages,” Frontiers in Immunology Vol. 7, Art. 229 (2016)). TIM-3 can regulate the production and release of cytokines in monocytes and macrophages (reviewed in Ocana-Guzman et al., Id). The term “human TIM-3” refers to a TIM-3 originated from a human. An exemplary amino acid sequence of a human TIM-3 is represented in GenBank Accession No. Q8TDQ0.3 or GenBank Accession No. NP_116171.3 (SEQ ID NO:177).
(37) As used herein, an antibody that “specifically binds to TIM-3” refers to an antibody that binds to a TIM-3, preferably a human TIM-3, with a KD of 1×10.sup.−7 M or less, preferably 1×10.sup.−8M or less, more preferably 5×10.sup.−9 M or less, 1×10.sup.−9 M or less, 5×10.sup.−10 M or less, or 1×10.sup.−10 M or less. The term “KD” refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods in the art in view of the present disclosure. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system.
(38) The smaller the value of the KD of an antibody, the higher affinity that the antibody binds to a target antigen.
(39) According to a particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, a HCDR3, a light chain complementarity determining region 1 (LCDR1), a LCDR2, and a LCDR3, having the polypeptide sequences of:
(40) (1) SEQ ID NOs:43, 44, 169, 106, 107, and 170, respectively;
(41) (2) SEQ ID NOs:55, 56, 57, 118, 119, and 120, respectively;
(42) (3) SEQ ID NOs:58, 59, 60, 121, 122, and 123, respectively;
(43) (4) SEQ ID NOs:61, 62, 63, 124, 125, and 126, respectively;
(44) (5) SEQ ID NOs:64, 65, 66, 127, 128, and 129, respectively;
(45) (6) SEQ ID NOs:67, 68, 69, 130, 131, and 132, respectively;
(46) (7) SEQ ID NOs:70, 71, 72, 133, 134, and 135, respectively;
(47) (8) SEQ ID NOs:73, 74, 75, 136, 137, and 138, respectively;
(48) (9) SEQ ID NOs:76, 77, 78, 139, 140, and 141, respectively;
(49) (10) SEQ ID NOs:79, 80, 81, 142, 143, and 144, respectively;
(50) (11) SEQ ID NOs:82, 83, 84, 145, 146, and 147, respectively;
(51) (12) SEQ ID NOs:85, 86, 87, 148, 149, and 150, respectively;
(52) (13) SEQ ID NOs:88, 89, 90, 151, 152, and 153, respectively;
(53) (14) SEQ ID NOs:91, 92, 93, 154, 155, and 156, respectively;
(54) (15) SEQ ID NOs:94, 95, 96, 157, 158, and 159, respectively;
(55) (16) SEQ ID NOs:97, 98, 99, 160, 161, and 162, respectively;
(56) (17) SEQ ID NOs:100, 101, 102, 163, 164, and 165, respectively; or
(57) (18) SEQ ID NOs:103, 104, 105, 166, 167, and 168, respectively;
(58) wherein the antibody or antigen-binding fragment thereof specifically binds TIM-3, preferably human TIM-3.
(59) SEQ ID NO:169 is represented by the amino acid sequence ARDX.sub.1X.sub.2DY, wherein X.sub.1 is an amino acid selected from the group consisting of A, T, and L, and wherein X.sub.2 is an amino acid selected from M and E.
(60) SEQ ID NO:170 is represented by the amino acid sequence SQX.sub.1X.sub.2HVPX.sub.3T, wherein X.sub.1 is an amino acid selected from the group consisting of N, T, and S, X.sub.2 is an amino acid selected from T and I, and X.sub.3 is an amino acid selected from W and Y.
(61) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to one of SEQ ID NOs:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41, or a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to one of SEQ ID NOs:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42. According to one preferred embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof of the invention comprises a heavy chain variable region having the polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42, respectively.
(62) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:1, and a light chain variable region having the polypeptide sequence of SEQ ID NO:2; b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:3, and a light chain variable region having the polypeptide sequence of SEQ ID NO:4; c. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:5, and a light chain variable region having the polypeptide sequence of SEQ ID NO:6; d. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:7, and a light chain variable region having the polypeptide sequence of SEQ ID NO:8; e. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:9, and a light chain variable region having the polypeptide sequence of SEQ ID NO:10; f. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:11, and a light chain variable region having the polypeptide sequence of SEQ ID NO:12; g. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:13, and a light chain variable region having the polypeptide sequence of SEQ ID NO:14; h. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:15, and a light chain variable region having the polypeptide sequence of SEQ ID NO:16; i. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:17, and a light chain variable region having the polypeptide sequence of SEQ ID NO:18; j. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:19, and a light chain variable region having the polypeptide sequence of SEQ ID NO:20; k. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:21, and a light chain variable region having the polypeptide sequence of SEQ ID NO:22; l. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:23, and a light chain variable region having the polypeptide sequence of SEQ ID NO:24; m. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:25, and a light chain variable region having the polypeptide sequence of SEQ ID NO:26; n. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:27, and a light chain variable region having the polypeptide sequence of SEQ ID NO:28; o. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:29, and a light chain variable region having the polypeptide sequence of SEQ ID NO:30; p. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:31, and a light chain variable region having the polypeptide sequence of SEQ ID NO:32; q. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:33, and a light chain variable region having the polypeptide sequence of SEQ ID NO:34; r. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:35, and a light chain variable region having the polypeptide sequence of SEQ ID NO:36; s. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:37, and a light chain variable region having the polypeptide sequence of SEQ ID NO:38; t. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:39, and a light chain variable region having the polypeptide sequence of SEQ ID NO:40; or u. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:41, and a light chain variable region having the polypeptide sequence of SEQ ID NO:42.
(63) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:43, 44, 45, 106, 107, and 108, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:1, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:2. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:1; and a light chain variable region having the polypeptide sequence of SEQ ID NO:2.
(64) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:46, 47, 48, 109, 110, and 111, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:3, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:4. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:3; and a light chain variable region having the polypeptide sequence of SEQ ID NO:4.
(65) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:49, 50, 51, 112, 113, and 114, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:5, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:6. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:5; and a light chain variable region having the polypeptide sequence of SEQ ID NO:6.
(66) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:52, 53, 54, 115, 116, and 117, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:7, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:8. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:7; and a light chain variable region having the polypeptide sequence of SEQ ID NO:8.
(67) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:55, 56, 57, 118, 119, and 120, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:9, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:10. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:9; and a light chain variable region having the polypeptide sequence of SEQ ID NO:10.
(68) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:58, 59, 60, 121, 122, and 123, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:11, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:12. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:11; and a light chain variable region having the polypeptide sequence of SEQ ID NO:12.
(69) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:61, 62, 63, 124, 125, and 126, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:13, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:14. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:13; and a light chain variable region having the polypeptide sequence of SEQ ID NO:14.
(70) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:64, 65, 66, 127, 128, and 129, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:15, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:16. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:15; and a light chain variable region having the polypeptide sequence of SEQ ID NO:16.
(71) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:67, 68, 69, 130, 131, and 132, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:17, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:18. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:17; and a light chain variable region having the polypeptide sequence of SEQ ID NO:18.
(72) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:70, 71, 72, 133, 134, and 135, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:19, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:20. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:19; and a light chain variable region having the polypeptide sequence of SEQ ID NO:20.
(73) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:73, 74, 75, 136, 137, and 138, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:21, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:22. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:21; and a light chain variable region having the polypeptide sequence of SEQ ID NO:22.
(74) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:76, 77, 78, 139, 140, and 141, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:23, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:24. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:23; and a light chain variable region having the polypeptide sequence of SEQ ID NO:24.
(75) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:79, 80, 81, 142, 143, and 144, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:25, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:26. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:25; and a light chain variable region having the polypeptide sequence of SEQ ID NO:26.
(76) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:82, 83, 84, 145, 146, and 147, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:27, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:28. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:27; and a light chain variable region having the polypeptide sequence of SEQ ID NO:28.
(77) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:85, 86, 87, 148, 149, and 150, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:29, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:30. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:29; and a light chain variable region having the polypeptide sequence of SEQ ID NO:30.
(78) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:88, 89, 90, 151, 152, and 153, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:31, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:32. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:31; and a light chain variable region having the polypeptide sequence of SEQ ID NO:32.
(79) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:91, 92, 93, 154, 155, and 156, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:33, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:34. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:33; and a light chain variable region having the polypeptide sequence of SEQ ID NO:34.
(80) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:94, 95, 96, 157, 158, and 159, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:35, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:36. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:35; and a light chain variable region having the polypeptide sequence of SEQ ID NO:36.
(81) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:97, 98, 99, 160, 161, and 162, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:37, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:38. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:37; and a light chain variable region having the polypeptide sequence of SEQ ID NO:38.
(82) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:100, 101, 102, 163, 164, and 165, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:39, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:40. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:39; and a light chain variable region having the polypeptide sequence of SEQ ID NO:40.
(83) In one embodiment, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:103, 104, 105, 166, 167, and 168, respectively. In another embodiment, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:41, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:42. Preferably, the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:41; and a light chain variable region having the polypeptide sequence of SEQ ID NO:42.
(84) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is chimeric.
(85) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is human or humanized.
(86) According to another particular aspect, the invention relates to an isolated humanized monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the isolated humanized antibody or antigen-binding fragment thereof comprises: (a) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:171, and a light chain variable region having the polypeptide sequence of SEQ ID NO:175; (b) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:172, and a light chain variable region having the polypeptide sequence of SEQ ID NO:175; (c) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:173, and a light chain variable region having the polypeptide sequence of SEQ ID NO:176; or (d) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:174, and a light chain variable region having the polypeptide sequence of SEQ ID NO:176.
(87) According to another particular aspect, the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is capable of blocking binding of TIM-3 to phosphatidylserine (PtdSer), TIM-3 to galectin-9 (Gal-9), TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), and/or TIM-3 to high mobility group protein B1 (HMGB1).
(88) In another general aspect, the invention relates to an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention. It will be appreciated by those skilled in the art that the coding sequence of a protein can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding monoclonal antibodies or antigen-binding fragments thereof of the invention can be altered without changing the amino acid sequences of the proteins.
(89) In another general aspect, the invention relates to a vector comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention. Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector. In some embodiments, the vector is a recombinant expression vector such as a plasmid. The vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication. The promoter can be a constitutive, inducible or repressible promoter. A number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell. Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the invention.
(90) In another general aspect, the invention relates to a host cell comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention. Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of antibodies or antigen-binding fragments thereof of the invention. In some embodiments, the host cells are E. coli TG1 or BL21 cells (for expression of, e.g., an scFv or Fab antibody), CHO-DG44 or CHO-K1 cells or HEK293 cells (for expression of, e.g., a full-length IgG antibody). According to particular embodiments, the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed.
(91) In another general aspect, the invention relates to a method of producing a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment thereof under conditions to produce a monoclonal antibody or antigen-binding fragment thereof of the invention, and recovering the antibody or antigen-binding fragment thereof from the cell or cell culture (e.g., from the supernatant). Expressed antibodies or antigen-binding fragments thereof can be harvested from the cells and purified according to conventional techniques known in the art and as described herein.
(92) Pharmaceutical Compositions
(93) In another general aspect, the invention relates to a pharmaceutical composition, comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier. The term “pharmaceutical composition” as used herein means a product comprising an antibody of the invention together with a pharmaceutically acceptable carrier. Antibodies of the invention and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein.
(94) As used herein, the term “carrier” refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application. As used herein, the term “pharmaceutically acceptable carrier” refers to a non-toxic material that does not interfere with the effectiveness of a composition according to the invention or the biological activity of a composition according to the invention. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used in the invention.
(95) The formulation of pharmaceutically active ingredients with pharmaceutically acceptable carriers is known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g. 21st edition (2005), and any later editions). Non-limiting examples of additional ingredients include: buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents. One or more pharmaceutically acceptable carriers can be used in formulating the pharmaceutical compositions of the invention.
(96) In one embodiment of the invention, the pharmaceutical composition is a liquid formulation. A preferred example of a liquid formulation is an aqueous formulation, i.e., a formulation comprising water. The liquid formulation can comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like. An aqueous formulation typically comprises at least 50% w/w water, or at least 60%, 70%, 75%, 80%, 85%, 90%, or at least 95% w/w of water.
(97) In one embodiment, the pharmaceutical composition can be formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump). The injection can be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example.
(98) In another embodiment, the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which can be used as is, or whereto the physician or the patient adds solvents, and/or diluents prior to use. Solid dosage forms can include tablets, such as compressed tablets, and/or coated tablets, and capsules (e.g., hard or soft gelatin capsules). The pharmaceutical composition can also be in the form of sachets, dragees, powders, granules, lozenges, or powders for reconstitution, for example.
(99) The dosage forms can be immediate release, in which case they can comprise a water-soluble or dispersible carrier, or they can be delayed release, sustained release, or modified release, in which case they can comprise water-insoluble polymers that regulate the rate of dissolution of the dosage form in the gastrointestinal tract or under the skin.
(100) In other embodiments, the pharmaceutical composition can be delivered intranasally, intrabuccally, or sublingually.
(101) The pH in an aqueous formulation can be between pH 3 and pH 10. In one embodiment of the invention, the pH of the formulation is from about 7.0 to about 9.5. In another embodiment of the invention, the pH of the formulation is from about 3.0 to about 7.0.
(102) In another embodiment of the invention, the pharmaceutical composition comprises a buffer. Non-limiting examples of buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and tris(hydroxymethyl)-aminomethane, and mixtures thereof. The buffer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific buffers constitute alternative embodiments of the invention.
(103) In another embodiment of the invention, the pharmaceutical composition comprises a preservative. Non-limiting examples of preservatives include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4-hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2-phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof. The preservative can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific preservatives constitute alternative embodiments of the invention.
(104) In another embodiment of the invention, the pharmaceutical composition comprises an isotonic agent. Non-limiting examples of the embodiment include a salt (such as sodium chloride), an amino acid (such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine), an alditol (such as glycerol, 1,2-propanediol propyleneglycol), 1,3-propanediol, and 1,3-butanediol), polyethyleneglycol (e.g. PEG400), and mixtures thereof. Another example of an isotonic agent includes a sugar. Non-limiting examples of sugars can be mono-, di-, or polysaccharides, or water-soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta-HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethylcellulose. Another example of an isotonic agent is a sugar alcohol, wherein the term “sugar alcohol” is defined as a C(4-8) hydrocarbon having at least one —OH group. Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol. The isotonic agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific isotonic agents constitute alternative embodiments of the invention.
(105) In another embodiment of the invention, the pharmaceutical composition comprises a chelating agent. Non-limiting examples of chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA), and mixtures thereof. The chelating agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific chelating agents constitute alternative embodiments of the invention.
(106) In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer. Non-limiting examples of stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.
(107) In another embodiment of the invention, the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinyl pyrrolidone, salts (such as sodium chloride), sulphur-containing substances such as monothioglycerol), or thioglycolic acid. The stabilizer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific stabilizers constitute alternative embodiments of the invention.
(108) In further embodiments of the invention, the pharmaceutical composition comprises one or more surfactants, preferably a surfactant, at least one surfactant, or two different surfactants. The term “surfactant” refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part. The surfactant can, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants. The surfactant can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific surfactants constitute alternative embodiments of the invention.
(109) In a further embodiment of the invention, the pharmaceutical composition comprises one or more protease inhibitors, such as, e.g., EDTA, and/or benzamidine hydrochloric acid (HCl). The protease inhibitor can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific protease inhibitors constitute alternative embodiments of the invention.
(110) In another general aspect, the invention relates to a method of producing a pharmaceutical composition comprising a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising combining a monoclonal antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
(111) Methods of Use
(112) In another general aspect, the invention relates to a method of blocking the binding of TIM-3 to phosphatidylserine (PtdSer), a method of blocking the binding of TIM-3 to galectin-9, a method of blocking the binding of TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), or a method of blocking the binding of TIM-3 to high mobility group protein B1 (HMGB1), the method comprising administering to the subject a pharmaceutical composition of the invention.
(113) The functional activity of antibodies and antigen-binding fragments thereof that bind TIM-3 can be characterized by methods known in the art and as described herein. Methods for characterizing antibodies and antigen-binding fragments thereof that bind TIM-3 include, but are not limited to, affinity and specificity assays including Biacore, ELISA, and OctetRed analysis; receptor ligand binding assays to detect blocking of the binding of TIM-3 to PtdSer, galectin-9, CEACAM1, and/or HMGB1; the functional effect of inhibition of PtdSer-TIM-3 interaction by an anti-TIM-3 mAb can be detected in a cell-based phagocytosis assay where TIM-3 expressing macrophages are incubated with cells undergoing apoptosis (and thereby expressing PtdSer) and the mAb's blocking of the PtdSer-TIM-3 interaction leads to increased phagocytosis. The functional effect of inhibition of Gal-9-TIM-3 interaction by an anti-TIM-3 mAb can be detected in a cell-based assay where IFN-γ secretion and cell killing are induced as a result of the mAb's blocking of the binding of Gal-9 on AML cells to TIM-3 on NK cells. The functional effect of inhibition of HMGB1-TIM-3 interaction by an anti-TIM-3 mAb can be detected in a cell-based assay where TIM-3 expressing cells are incubated with B-DNA and the mAb's blocking of the HMGB1-TIM-3 interaction leads to increased INF-β1 production. The functional activity of an anti-TIM-3 mAb can also be assessed in a Mixed Lymphocyte Reaction (MLR) assay where dendritic cells and CD4+ cells from different donors are mixed in the presence of the mAb and stimulation of cytokine secretion is measured. According to particular embodiments, the methods for characterizing antibodies and antigen-binding fragments thereof that bind TIM-3 include those described below.
(114) In another general aspect, the invention relates to a method of treating a cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention. The cancer can, for example, be selected from but not limited to, a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors.
(115) In another general aspect, the invention relates to a method of treating an infectious disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
(116) In another general aspect, the invention relates to a method of treating an inflammatory disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
(117) In another general aspect, the invention relates to a method of treating an autoimmune disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
(118) In another general aspect, the invention relates to a method of treating a metabolic disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
(119) According to embodiments of the invention, the pharmaceutical composition comprises a therapeutically effective amount of the anti-TIM-3 antibody or antigen-binding fragment thereof. As used herein, the term “therapeutically effective amount” refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject. A therapeutically effective amount can be determined empirically and in a routine manner, in relation to the stated purpose.
(120) As used herein with reference to anti-TIM-3 antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-TIM-3 antibody or antigen-binding fragment thereof that modulates an immune response in a subject in need thereof. Also as used herein with reference to anti-TIM-3 antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-TIM-3 antibody or antigen-binding fragment thereof that results in treatment of a disease, disorder, or condition; prevents or slows the progression of the disease, disorder, or condition; or reduces or completely alleviates symptoms associated with the disease, disorder, or condition.
(121) According to particular embodiments, the disease, disorder or condition to be treated is cancer, preferably a cancer selected from the group consisting of a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CIVIL), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors. According to other particular embodiments, the disease, disorder or condition to be treated is an infectious disease, an inflammatory disease, an immune disease, an autoimmune disease, and/or a metabolic disease.
(122) According to particular embodiments, a therapeutically effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and/or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy.
(123) The therapeutically effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of administration, the target site, the physiological state of the subject (including, e.g., age, body weight, health), whether the subject is a human or an animal, other medications administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.
(124) According to particular embodiments, the compositions described herein are formulated to be suitable for the intended route of administration to a subject. For example, the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.
(125) As used herein, the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, an infectious disease, disorder or condition, an immune disease, disorder or condition, an autoimmune disease, disorder or condition, an inflammatory disease, disorder or condition, and/or a metabolic disease, disorder or condition, which is not necessarily discernible in the subject, but can be discernible in the subject. The terms “treat,” “treating,” and “treatment,” can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer. In a particular embodiment, “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.
(126) According to particular embodiments, a composition used in the treatment of a cancer, an infectious disease, disorder or condition, an immune disease, disorder or condition, an autoimmune disease, disorder or condition, a metabolic disease, disorder or condition, and/or an inflammatory disease, disorder or condition can be used in combination with another treatment. For cancer treatment, the composition can be used in combination with another treatment including, but not limited to, a chemotherapy, an anti-CD20 mAb, an anti-CTLA-4 antibody, an anti-LAG-3 mAb, an anti-EGFR mAb, an anti-HER-2 mAb, an anti-CD19 mAb, an anti-CD33 mAb, an anti-CD73 mAb, an anti-CD47 mAb, an anti-DLL-3 mAb, an anti-apelin mAb, an anti-TIP-1 mAb, an anti-CLDN18.2 mAb, an anti-FOLR1 mAb, an anti-PD-L1 antibody, an anti-PD-1 antibody, a PD-1/PD-L1 therapy, other immuno-oncology drugs, an antiangiogenic agent, a radiation therapy, an antibody-drug conjugate (ADC), a targeted therapy, or other anticancer drugs.
(127) As used herein, the term “in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy. The use of the term “in combination” does not restrict the order in which therapies are administered to a subject. For example, a first therapy (e.g., a composition described herein) can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy to a subject.
(128) In another general aspect, the invention relates to a method of determining a level of TIM-3 in a subject, comprising (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining the level of TIM-3 in the subject. In certain embodiments, the sample is a tissue or blood sample. The tissue sample can, for example, be a cancer tissue sample. The blood sample can, for example, comprise cancer cells.
(129) As used herein, “sample” refers to a biological sample isolated from a subject and can include, but is not limited to, whole blood, serum, plasma, blood cells, endothelial cells, tissue biopsies (e.g., a cancer tissue, a hepatic tissue, etc.), lymphatic fluid, ascites fluid, interstitial fluid, bone marrow, cerebrospinal fluid, saliva, mucous, sputum, sweat, urine, or any other secretion, excretion, or other bodily fluids. A “blood sample” refers to whole blood or any fraction thereof, including blood cells, serum, and plasma. A “blood sample” can, for example, comprise cancer cells.
(130) In certain embodiments, the level of TIM-3 in the subject can be determined utilizing assays selected from, but not limited to, a Western blot assay, an ELISA assay, a FACS assay, and/or an immunohistochemistry (IHC). Relative protein levels can be determined by utilizing Western blot analysis, FACS assay, and immunohistochemistry (IHC), and absolute protein levels can be determined by utilizing an ELISA assay. When determining the relative levels of TIM-3, the levels of TIM-3 can be determined between at least two samples, e.g., between samples from the same subject at different time points, between samples from different tissues in the same subject, and/or between samples from different subjects. Alternatively, when determining absolute levels of TIM-3, such as by an ELISA assay, the absolute level of TIM-3 in the sample can be determined by creating a standard for the ELISA assay prior to testing the sample. A person skilled in the art would understand which analytical techniques to utilize to determine the level of TIM-3 in a sample from the subject utilizing the antibodies or antigen-binding fragments thereof of the invention.
(131) Utilizing methods of determining a level of TIM-3 in a sample from a subject can lead to the diagnosis of abnormal (elevated, reduced, or insufficient) TIM-3 levels in a disease and making appropriate therapeutic decisions. Such a disease can be selected from, but not limited to, a cancer, preferably a cancer selected from the group consisting of lung cancer, gastric cancer, colon cancer, hepatocellular carcinoma, renal cell carcinoma, bladder urothelial carcinoma, metastatic melanoma, breast cancer, ovarian cancer, cervical cancer, head and neck cancer, pancreatic cancer, glioma, glioblastoma, and other solid tumors, and non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), acute myeloid leukemia (AML), and other liquid tumors, an inflammatory disease, an infectious disease, metabolic diseases, an immune disease, and/or an autoimmune disease.
EMBODIMENTS
(132) The invention provides also the following non-limiting embodiments.
(133) Embodiment 1 is an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDR1), LCDR2, and LCDR3, having the polypeptide sequences of
(134) (1) SEQ ID NOs:43, 44, 169, 106, 107, and 170, respectively;
(135) (2) SEQ ID NOs:55, 56, 57, 118, 119, and 120, respectively;
(136) (3) SEQ ID NOs:58, 59, 60, 121, 122, and 123, respectively;
(137) (4) SEQ ID NOs:61, 62, 63, 124, 125, and 126, respectively;
(138) (5) SEQ ID NOs:64, 65, 66, 127, 128, and 129, respectively;
(139) (6) SEQ ID NOs:67, 68, 69, 130, 131, and 132, respectively;
(140) (7) SEQ ID NOs:70, 71, 72, 133, 134, and 135, respectively;
(141) (8) SEQ ID NOs:73, 74, 75, 136, 137, and 138, respectively;
(142) (9) SEQ ID NOs:76, 77, 78, 139, 140, and 141, respectively;
(143) (10) SEQ ID NOs:79, 80, 81, 142, 143, and 144, respectively;
(144) (11) SEQ ID NOs:82, 83, 84, 145, 146, and 147, respectively;
(145) (12) SEQ ID NOs:85, 86, 87, 148, 149, and 150, respectively;
(146) (13) SEQ ID NOs:88, 89, 90, 151, 152, and 153, respectively;
(147) (14) SEQ ID NOs:91, 92, 93, 154, 155, and 156, respectively;
(148) (15) SEQ ID NOs:94, 95, 96, 157, 158, and 159, respectively;
(149) (16) SEQ ID NOs:97, 98, 99, 160, 161, and 162, respectively;
(150) (17) SEQ ID NOs:100, 101, 102, 163, 164, and 165, respectively; or
(151) (18) SEQ ID NOs:103, 104, 105, 166, 167, and 168, respectively;
(152) wherein the antibody or antigen-binding fragment thereof specifically binds TIM-3, preferably human TIM-3.
(153) Embodiment 2 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 1, comprising a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41 or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42.
(154) Embodiment 3 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 1 or 2, comprising (a) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:1, and a light chain variable region having the polypeptide sequence of SEQ ID NO:2; (b) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:3, and a light chain variable region having the polypeptide sequence of SEQ ID NO:4; (c) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:5, and a light chain variable region having the polypeptide sequence of SEQ ID NO:6; (d) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:7, and a light chain variable region having the polypeptide sequence of SEQ ID NO:8; (e) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:9, and a light chain variable region having the polypeptide sequence of SEQ ID NO:10; (f) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:11, and a light chain variable region having the polypeptide sequence of SEQ ID NO:12; (g) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:13, and a light chain variable region having the polypeptide sequence of SEQ ID NO:14; (h) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:15, and a light chain variable region having the polypeptide sequence of SEQ ID NO:16; (i) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:17, and a light chain variable region having the polypeptide sequence of SEQ ID NO:18; (j) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:19, and a light chain variable region having the polypeptide sequence of SEQ ID NO:20; (k) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:21, and a light chain variable region having the polypeptide sequence of SEQ ID NO:22; (l) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:23, and a light chain variable region having the polypeptide sequence of SEQ ID NO:24; (m) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:25, and a light chain variable region having the polypeptide sequence of SEQ ID NO:26; (n) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:27, and a light chain variable region having the polypeptide sequence of SEQ ID NO:28; (o) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:29, and a light chain variable region having the polypeptide sequence of SEQ ID NO:30; (p) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:31, and a light chain variable region having the polypeptide sequence of SEQ ID NO:32; (q) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:33, and a light chain variable region having the polypeptide sequence of SEQ ID NO:34; (r) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:35, and a light chain variable region having the polypeptide sequence of SEQ ID NO:36; (s) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:37, and a light chain variable region having the polypeptide sequence of SEQ ID NO:38; (t) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:39, and a light chain variable region having the polypeptide sequence of SEQ ID NO:40; or (u) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:41, and a light chain variable region having the polypeptide sequence of SEQ ID NO:42.
(155) Embodiment 4 is the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 3, wherein the antibody or antigen-binding fragment thereof is chimeric.
(156) Embodiment 5 is the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 4, wherein the antibody or antigen-binding fragment thereof is human or humanized.
(157) Embodiment 6 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 5, wherein the antibody or antigen-binding fragment thereof comprises: (a) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:171, and a light chain variable region having the polypeptide sequence of SEQ ID NO:175; (b) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:172, and a light chain variable region having the polypeptide sequence of SEQ ID NO:175; (c) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:173, and a light chain variable region having the polypeptide sequence of SEQ ID NO:176; or (d) a heavy chain variable region having the polypeptide sequence of SEQ ID NO:174, and a light chain variable region having the polypeptide sequence of SEQ ID NO:176.
(158) Embodiment 7 is the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 6, wherein the antibody or antigen-binding fragment thereof is capable of blocking binding of TIM-3 to phosphatidylserine (PtdSer), TIM-3 to galectin-9 (Gal-9), TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), and/or TIM-3 to high mobility group protein B1 (HMGB1).
(159) Embodiment 8 is an isolated nucleic acid encoding the monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7.
(160) Embodiment 9 is a vector comprising the isolated nucleic acid of embodiment 8.
(161) Embodiment 10 is a host cell comprising the vector of embodiment 9.
(162) Embodiment 11 is a pharmaceutical composition, comprising the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7 and a pharmaceutically acceptable carrier.
(163) Embodiment 12 is a method of blocking binding of TIM-3 to phosphatidylserine (PtdSer) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(164) Embodiment 13 is a method of blocking binding of TIM-3 to galectin-9 (Gal-9) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(165) Embodiment 14 is a method of blocking binding of TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(166) Embodiment 15 is a method of blocking binding of TIM-3 to high mobility group protein B1 (HMGB1) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(167) Embodiment 16 is a method of treating cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(168) Embodiment 17 is a method of treating an infectious disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(169) Embodiment 18 is a method of treating an inflammatory disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(170) Embodiment 19 is a method of treating an autoimmune disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(171) Embodiment 20 is a method of treating a metabolic disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
(172) Embodiment 21 is a method of producing the monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment under conditions to produce the monoclonal antibody or antigen-binding fragment, and recovering the antibody or antigen-binding fragment from the cell or culture.
(173) Embodiment 22 is a method of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7, comprising combining the monoclonal antibody or antigen-binding fragment with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
(174) Embodiment 23 is a method of determining a level of TIM-3 in a subject, comprising (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining the level of TIM-3 in the subject.
(175) Embodiment 24 is the method of embodiment 23, wherein the sample is a tissue sample.
(176) Embodiment 25 is the method of embodiment 24, wherein the tissue sample is a cancer tissue sample.
(177) Embodiment 26 is the method of embodiment 23, wherein the sample is a blood sample.
EXAMPLES
Example 1
Identification of Anti-TIM-3 Monoclonal Antibodies
(178) Mice were immunized with Fc-tagged human and cynomolgus TIM-3 extracellular domain (ECD) proteins and adjuvant. Plasma titer was determined by enzyme linked immunosorbent assay (ELISA). After euthanization, spleens and lymph nodes were collected to produce hybridomas. Hybridomas were grown in 384-well tissue culture plates and supernatants from individual wells were screened by ELISA to identify positive binders for human and cynomolgus TIM-3 ECD proteins. Positive supernatants were also screened for blocking of phosphatidylserine binding to TIM-3 recombinant protein and binding to native TIM-3 protein by FACS analysis on TIM-3-expressing HEK293 cells. Positive clones were isolated and sequenced.
(179) Sequences of heavy and light chain variable regions for anti-TIM-3 monoclonal antibodies are provided in Tables 1 and 2, and the CDR regions for the anti-TIM-3 monoclonal antibodies are provided in Tables 3 and 4. The CDR regions for the anti-TIM-3 monoclonal antibodies were determined utilizing the IMGT method.
(180) TABLE-US-00001 TABLE 1 Sequences of heavy chain variable regions for anti-TIM-3 monoclonal antibodies (mAbs) mAb clones VH 20-L10-A QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKVLKWMVWIN TYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDAMDYWG QGTSVTVSS (SEQ ID NO: 1) 15-L23-A QIQLVQSGPELKKPGETVKISCRASGYTFTNYGMNWVKQAPGKGLKWMVWIN TYTGEPTFADDFKGRFAFSLETSASTAYLQIINLKNEDTATYFCARDTMDYWGQ GTSVTVSS (SEQ ID NO: 3) 8-F3-A QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMAWIN TYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDLEDYWGQ GTTLTVSS (SEQ ID NO: 5) 7-P15-A QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWIN TYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARDLMDYWG QGTTLTVSS (SEQ ID NO: 7) 18-N1-A QVQLQQPGAELVRPGVSVKLSCKASGYTFTSYWMHWIKQRPEQGLERIGEINPS NGGTNYNEKFKNKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARSYYTYDAID YWGQGTSVTVSS (SEQ ID NO: 9) 18-O22-A EVQLQQSGPELVKPGASVKVSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINP YNDVTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARSSDYDDGH WYFDVWGAGTTVTVSS (SEQ ID NO: 11) 16-L3-A QVQLQQSGPELVKPGASVKMSCKASGYTFTSYYIHWVKQRPGQGLEWIGWIYP GDGSTKYNEKFKGKTTLTADKSSSTAYMLLSSLTSEDSAIYFCATDRYDVAYWG QGTLVTVSA (SEQ ID NO: 13) 16-K5-A QVQLQQSGAELVKPGASVKLSCKASGYTFTSSDINWVRQRPEQGLEWIGWIFPG DGSTKYNEKFKGKATLTTDKSSSTAYMQLSRLTSEDSAVYFCARGLDYWGQGT TLTVSS (SEQ ID NO: 15) 19-A14-A DVQLQGSGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNILEWMGYISYS GSTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARDGRYDYYAMDY WGQGTSVTVSS (SEQ ID NO: 17) 2-K2-A QVQLQQSGAELAKPGASVKMSCKASGYTFTTYWMHWVKQRPGQGLEWIGYIN PSTGYTEYNQKFKDKSTLTADKSSSTAYMQLSSLTSEDSAVYYCANDHEGGFAY WGQGTLVTVSA (SEQ ID NO: 19) 6-H6-A EVQLQQFGAELVKPGASVKISCKASGYTFTDYNMDWVKQSHGKSLEWIGDIDP NYDSTTYNQKFKGKATLTVDKSSSTAYMELRSLTSEDTAVYYCARGGHYRYDG YYAMDYWGQGTSVTVSS (SEQ ID NO: 21) 1-A19-A EVQLQQFGAELVKPGASVKISCKASGYTFTDYNMDWVKQSHGKSLEWIGDIDP NYDITTYNQKFKGKATLTVDKSSSTAYMELRSLTSEDTAVYYCARGGHYRYDG YYALDYWGQGTSVTVSS (SEQ ID NO: 23) 10-O15-A QVQLQQSGADLVRPGASVKLSCKALGYTFTDYEMHWVKQTPVHGLEWIGAIHP GSGGTAYNQKFKGKATLTADKSSSTAYMELSSLTSEDSAVYFCSRSYYRYTGYF DVWGAGTTVTVSS (SEQ ID NO: 25) 6-I13-A EVQLQQSGPELEKPGASVKISCKASGYSFTGYNMNWVKQSNGKSLEWIGNIDPY YGVTSYNQKFKGKATLTVDKSSSTAYMQLKSLTSEDSAVYYCASYSLTYDGYY PFAYWGQGTLVTVSA (SEQ ID NO: 27) 5-K4-A EVQLQQSGPELVKTGASVKISCKASGYSFTAYYIHWVKQSHGKSLEWIGHISCFN GATSYNQKFKGKATFTVDTSSSTAYMQFNSLTSEDSAVYYCARRGDFDRPEFAY WGQGTLVTVSA (SEQ ID NO: 29) 12-G18-A DVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISY SGSTSYNPSLKSRISITRDTSKNQFFLQLNSVTIGDTATYYCASNYRYDYWFFGV WGAGTTVTVSS (SEQ ID NO: 31) 10-M21-A DVQLQESGPTLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSG STYYNPSLKSRISIIRDTSKNQYYLQLNSVTTEDTATYYCVSGNHFDYWGQGTTL TVSS (SEQ ID NO: 33) 12-M11-A SQVQLQQSGAELAKPGASVKMSCKASGYFTSYWMHWVKQRPGQGLEWIGYIN PITGYTEYNQKFKDKATLTADKSSSTAYMQLSRLTSEDSAVYYCARGVENFDYL YAMDYWGQGASVTVSS (SEQ ID NO: 35) 5-C11-A EVQLVESGGGLVKPGGSLKLSCAASGFTFSDFYMYWVRQTPEKRLEWVATISD GGSYTYYPDSVKGRFTISRDNAKNNLYLQMSSLKSEDTAMYYCASGYYYGSDY VMDYWGQGTSVTVSS (SEQ ID NO: 37) 16-J5-A DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMNWVRQAPEKGLEWVAYISS GSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARWGRWADFD YWGQGTTLTVSS (SEQ ID NO: 39) 7-N2-A QVQLKESGPGLVAPSQSLSITCTVSGFSLTGFGVNWVRQPPGKGLEWLGMIWGD GSTDYNSTLKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDYYGYVGNAM DYWGQGTSVTVSS (SEQ ID NO: 41) VH: heavy chain variable region
(181) TABLE-US-00002 TABLE 2 Sequences of light chain variable regions for anti-TIM-3 mAbs mAb clones VL 20-L10-A DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIY KVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPWTFGGGTK LEIK (SEQ ID NO: 2) 15-L23-A DIVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYK VSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPWTFGGGTKLE IK (SEQ ID NO: 4) 8-F3-A DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIY KVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQTTHVPWTFGGGTKL EIK (SEQ ID NO: 6) 7-P15-A DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIY KVSNRFSGVPDRFSGSGSGTDFTLKITRVEAEDLGVYFCSQSIHVPYTFGGGTKL EIK (SEQ ID NO: 8) 18-N1-A DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLI YWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTK LEIK (SEQ ID NO: 10) 18-O22-A DIVLTQSPASLAVSLGQRATISCKASQSVDYDGESYMNWYQQKPGQPPKLLIYV ASNLESGIPVRFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPTWTFGGGTKL EIK (SEQ ID NO: 12) 16-L3-A EIVLTQSPALMAASPGEKVTITCSVSSSISSSNLHWYQQKSETSPKPWIYGTSNLA S GVPVRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSYPLTFGAGTKLELK (SEQ ID NO: 14) 16-K5-A DIKMTQSPSSMYASLGERVTITCKASQDINSYLGWFQQKPGKSPKTLIYRADRLV DGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPLTFGAGTKLELK (SEQ ID NO: 16) 19-A14-A DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGQPPKLLIFAAS NQGSGVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCHQSKEVPWTFGGGTKLEI K (SEQ ID NO: 18) 2-K2-A DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFKGLIYHGTNLED GVPSRFSGSGSGADYSLTISSLESEDFADYYCVQYAQFPFTFGSGTKLEIK (SEQ ID NO: 20) 6-H6-A DIVLTQSPASSAVSLGQRATFSCRASQSVSTSSYSFMHWYQQKPGQPPKLLIKYA SNLESGVPARFSGSGSGTDFTLNIHPVEEEDTATYYCQHSWEIPPTFGGGTNLEIK (SEQ ID NO: 22) 1-A19-A DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYA ASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPFTFGSGTKLEI K (SEQ ID NO: 24) 10-O15-A DIVLTQSPASLAVSLGQRATISCRASKSVSASGYSYMHWYQQKPGQPPKWYLA SNLESGVPARFSGSGSGTDFTLNVHPVEEEDAATYYCQHSRELPFTFGSGTKLEI K (SEQ ID NO: 26) 6-I13-A DIVLTQSPASLAVSLGQRATISCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLA SNLESGVPARFSGSGSGTDFTLNIHPVEEEDAATYYCQHSRELPYTFGGGTKLEI K (SEQ ID NO: 28) 5-K4-A DIVLTQSPASLAVSLGQRATISCRASESVEYYGTSLMQWYQQKPGQPPKLLIYAA SNVESGVPARFSGSGSGTDFSLNIHPVEEDDIAMYFCQQSRKVPWTFGGGTKLEI K (SEQ ID NO: 30) 12-G18-A DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGQPPKLLIYAES NQGSGVPARFSGSGSGTDFSLNIHPMEEDDTAMYFCQQSKEVPYTFGGGTKLEI K (SEQ ID NO: 32) 10-M21-A DIQMTQSPSSLSASLGGKVTITCKASQDINRYIAWYQHKPGKGPRLLIHYTSTLQP GIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLLFTFGSGTKLEIK (SEQ ID NO: 34) 12-M11-A QIVLTQSPAIMSASPGEKVTMTCSASSSISYMHWYQQKPGTSPKRWIYDTSKLAS GVPTRFNGSGSGTSYSLTISSMEAEDAATYYCHQRSSYRTFGGGTKLEIK (SEQ ID NO: 36) 5-C11-A DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLI YWASTRESGVPDRFTGSGSGTDFTLTISSVQADDLAVYYCKQSYNLLTFGAGTK LELK (SEQ ID NO: 38) 16-J5-A DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYA ASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPPTFGGGTKLEI K (SEQ ID NO: 40) 7-N2-A DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLI YWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNHMYTFGGGT KLEIK (SEQ ID NO: 42) VL: light chain variable region
(182) TABLE-US-00003 TABLE 3 CDR Regions 1-3 of heavy chain for anti-TIM-3 mAbs HC mAb CDR1 CDR2 clones (SEQ ID NO:) (SEQ ID NO:) CDR3 (SEQ ID NO:) 20-L10-A GYTFTNYG (43) INTYTGEP (44) ARDAMDY (45) 15-L23-A GYTFTNYG (46) INTYTGEP (47) ARDTMDY (48) 8-F3-A GYTFTNYG (49) INTYTGEP (50) ARDLEDY (51) 7-P15-A GYTFTNYG (52) INTYTGEP (53) ARDLMDY (54) 18-N1-A GYTFTSYW (55) INPSNGGT (56) ARSYYTYDAIDY (57) 18-O22-A GYTFTSYV (58) INPYNDVT (59) ARSSDYDDGHWYFDV (60) 16-L3-A GYTFTSYY (61) IYPGDGST (62) ATDRYDVAY (63) 16-K5-A GYTFTSSD (64) IFPGDGST (65) ARGLDY (66) 19-A14-A GYSITSDYA (67) ISYSGST (68) ARDGRYDYYAMDY (69) 2-K2-A GYTFTTYW (70) INPSTGYT (71) ANDHEGGFAY (72) 6-H6-A GYTFTDYN (73) IDPNYDST (74) ARGGHYRYDGYYAMDY (75) 1-A19-A GYTFTDYN (76) IDPNYDIT (77) ARGGHYRYDGYYALDY (78) 10-O15-A GYTFTDYE (79) IHPGSGGT (80) SRSYYRYTGYFDV (81) 6-I13-A GYSFTGYN (82) IDPYYGVT (83) ASYSLTYDGYYPFAY (84) 5-K4-A GYSFTAYY (85) ISCFNGAT (86) ARRGDFDRPEFAY (87) 12-G18-A GYSITSDYA (88) ISYSGST (89) ASNYRYDYWFFGV (90) 10-M21-A GDSITSGY (91) ISYSGST (92) VSGNHFDY (93) 12-M11-A GYFTSYW (94) INPITGYT (95) ARGVENFDYLYAMDY (96) 5-C11-A GFTFSDFY (97) ISDGGSYT (98) ASGYYYGSDYVMDY (99) 16-J5-A GFTFSSFG (100) ISSGSSTI (101) ARWGRWADFDY (102) 7-N2-A GFSLTGFG (103) IWGDGST (104) ARDYYGYVGNAMDY (105) HC: heavy chain; CDR: complementarity determining region The HC CDRs for the anti-TIM-3 mAbs were determined utilizing the IMGT method (Lefranc, M.-P. et al., Nucleic Acids Res. 1999; 27: 209-212).
(183) TABLE-US-00004 TABLE 4 CDR regions 1-3 of the light chain for anti-TIM-3 mAbs LC mAb CDR2 (SEQ CDR3 clones CDR1 (SEQ ID NO:) ID NO:) (SEQ ID NO:) 20-L10-A QSLVHSNGNTY (106) KVS (107) SQNTHVPWT (108) 15-L23-A QSLVHSNGNTY (109) KVS (110) SQNTHVPWT (111) 8-F3-A QSLVHSNGNTY (112) KVS (113) SQTTHVPWT (114) 7-P15-A QSLVHSNGNTY (115) KVS (116) SQSIHVPYT (117) 18-N1-A QSLLNSRTRKNY (118) WAS (119) KQSYNLYT (120) 18-O22-A QSVDYDGESY (121) VAS (122) QQSNEDPTWT (123) 16-L3-A SSISSSN (124) GTS (125) QQWSSYPLT (126) 16-K5-A QDINSY (127) RAD (128) LQYDEFPLT (129) 19-A14-A ESVDNYGISF (130) AAS (131) HQSKEVPWT (132) 2-K2-A QGISSN (133) HGT (134) VQYAQFPFT (135) 6-H6-A QSVSTSSYSF (136) YAS (137) QHSWEIPPT (138) 1-A19-A QSVDYDGDSY (139) AAS (140) QQSNEDPFT (141) 10-O15-A KSVSASGYSY (142) LAS (143) QHSRELPFT (144) 6-I13-A KSVSTSGYSY (145) LAS (146) QHSRELPYT (147) 5-K4-A ESVEYYGTSL (148) AAS (149) QQSRKVPWT (150) 12-G18-A ESVDNYGISF (151) AES (152) QQSKEVPYT (153) 10-M21-A QDINRY (154) YTS (155) LQYDNLLFT (156) 12-M11-A SSISY (157) DTS (158) HQRSSYRT (159) 5-C11-A QSLLNSRTRKNY (160) WAS (161) KQSYNLLT (162) 16-J5-A QSVDYDGDSY (163) AAS (164) QQSNEDPPT (165) 7-N2-A QSLLNSRTRKNY (166) WAS (167) KQSYNHMYT (168) LC: light chain; CDR: complementarity determining region The LC CDRs for the anti-TIM-3 mAbs were determined utilizing the IMGT method (Lefranc, M.-P. et al., Nucleic Acids Res. 1999; 27: 209-212).
Example 2
TIM-3 and PtdSer Binding Assay Using ELISA
(184) To determine the effect of anti-TIM-3 antibodies on the interaction of TIM-3 with phosphatidylserine (PtdSer), 384-well ELISA plates were coated with PtdSer or phosphatidylcholine (PtdChol) at room temperature. The wells were washed using PBS supplemented with 0.1% Tween-20 and then blocked using PBS supplemented with 2% bovine serum albumin (BSA). Plates were washed and then incubated with a pre-equilibrated mixture of purified antibodies (0, 0.03, 0.08, 0.25, 0.74, 2.22, 6.67, or 20 μg/mL mAb) and TIM3(ECD)-huFc, a fusion protein containing the extracellular domain (ECD) of human TIM-3 and human Fc (huFc), in blocking buffer supplemented with CaCl.sub.2. The plates were washed and then incubated with HRP-coupled anti-huFc secondary antibody. Plates were washed, incubated with an HRP substrate, and read using a POLARstar Omega Microplate (BMG LABTECH). The assay was performed in triplicate. The signal of TIM-3 binding to PtdSer was defined as 100% signal and the signal of TIM-3 binding to PtChol as zero (background) to set the assay window. Results of the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 monoclonal antibodies (mAbs) as demonstrated by the ELISA assays are shown in
Example 3
FACS Binding Analysis of Purified Antibodies
(185) A human TIM-3-expressing plasmid was made and transiently transfected into HEK293T cells. After approximately 48 hours, cells were transferred to a 384-well V-bottom plate. Cells were washed with ice-cold FACS buffer (PBS supplemented with 1% BSA) and incubated with purified mAbs with gentle agitation at 4° C. for 45 minutes. The cells were washed with FACS buffer and incubated with an anti-mouse secondary Ab AlexaFluor488. The cells were washed and analyzed by FACS. Results of the FACS binding analysis of the anti-TIM-3 mAbs are provided in
Example 4
Dissociation Constant (KD) Analysis
(186) Binding experiments were performed on OCTET Red96 at 25° C. Antibodies were loaded onto Anti-Mouse Fc (AMC) biosensors. Loaded sensors were dipped into serial dilutions of antigen. Kinetic constants were calculated using a monovalent (1:1) model. The assay buffer was PBS supplemented with 0.1% BSA, 500 mM NaCl, 0.02% Tween-20, pH 7.2. The dissociation constant for antibody-antigen binding was determined for the anti-TIM-3 monoclonal antibodies and is shown below in Table 5.
(187) TABLE-US-00005 TABLE 5 KD values for anti-TIM-3 mAbs KD (nM) KD (nM) mAb clones Human TIM-3 Cyno TIM-3 5-K4-A 1.8 6.7 16-J5-A 2.7 0.054 10-O15-A 3.1 2.9 18-N1-A 1.1 14 16-K5-A 7.9 6.4 6-I13-A 9.9 5.2 10-M21-A 16 7.5 16-L3-A 14 6.5 1-A19-A 2.2 2.8 15-L23-A 13 8.9 20-L10-A 10 4.1 8-F3-A 1.6 22
Example 5
Humanization of Anti-TIM-3 mAb
(188) The mouse anti-TIM-3 mAb 16-K5-A was humanized to reduce the potential of immunogenicity when used in human patients. The sequences of the variable regions of the heavy and light chains (VH and VL) were compared with the human antibody sequences in the Protein Data Bank (PDB) database and homology models were built by applying SWISS-modeling. The CDRs in both the heavy and light chains of the mouse mAbs were grafted into human frameworks that have the highest possibility of maintaining the proper structure likely required for antigen binding. Backmutations from human residues to mouse residue were designed when necessary. The sequences of the humanized VH and VL regions are shown in Table 6. The humanized VH and VL regions were fused to the constant regions of human IgG4 heavy chain and kappa light chain, respectively. Constructs corresponding to the mAb sequences were used for transient transfection in 293E cells. The resulting antibody was purified by Protein A affinity column.
(189) TABLE-US-00006 TABLE 6 Sequences of heavy chain and light chain variable regions of humanized anti-TIM-3 mAbs SEQ VH/ ID VL SEQUENCE NO: H1 EVQLVESGGGLVQPGGSLRLSCAASGYTFTSSDINWVRQAPGKG 171 LVWIGWIFPGDGSTKYTPSLKDQATLSTDKAKNTAYLQMNSLRA EDTAVYFCARGLDYWGQGTLVTVSS H2 EVQLVESGGGLVQPGGSLRLSCAASGYTFTSSDINWVRQAPGKG 172 LVWIGWIFPGDGSTKYTPSLKDQATLSTDLAKNTAYLQMNSLRA EDTAVYFCARGLDYWGQGTLVTVSS H5 QVQLQESGPGLVKPSETLSLTCTASGYTFTSSDINWVRQPPGKG 173 LEWIGWIFPGDGSTKYNPSLKSRATLSTDKSKNQASLNLDSVSA ADTAIYFCARGLDYWGKGSTVTVSS H7 QVQLQESGPGLVKPSETLSLTCKASGYTFTSSDINWVRQPPGKG 174 LEWIGWIFPGDGSTKYNPSLKSRATLSTDKSKNQASLNLSSVTA ADTAVYFCARGLDYWGKGTTVTVSS L1 DIQMTQSPSSLSASVGDRVTITCKASQDINSYLGWFQQKPGKAP 175 KTLIYRADRLVDGVPSRFSGSGSGQDYTFTISSLQPEDIATYYC LQYDEFPLTFGQGTKLEIK L5 DIQMTQSPSSLSASVGDRVTITCKASQDINSYLGWFQQKPGKAP 176 KTLIYRADRLVDGVPSRFSGSGSGQDYTFTISSLQPEDIATYYC LQYDEFPLTFGPGTKVDIK H1, H2, H5 and H7 are humanized VH sequences; L1 and L5 are humanized VL sequences. H1L1, H2L1, H5L5 and H7L5 refer to the humanized mAbs constructed using a specific VH (e.g., H1) and a specific VL (e.g., L1) combination (to produce H1L1).
Example 6
ELISA Binding Analysis for Chimeric and Humanized Anti-TIM-3 mAbs
(190) Recombinant human TIM-3(ECD)-6His in carbonate coating buffer was coated on an ELISA plate at 4° C. overnight. The chimeric and humanized versions of anti-TIM-3 mAbs (H1L1, H2L1, H5L5 and H7L5) were added to the plate at different concentrations after being washed and incubated for 1 hour at room temperature. The plate was washed and antibody-binding was detected by adding anti-human IgG conjugated to horseradish peroxidase (hIgG-HRP) (ThermoFisher Scientific, Cat#: 31410) and incubating for 60 minutes. After washing, the ELISA was developed using One-step Detection Solution (ThermoFisher Scientific, Cat #: 34028), which was measured as the absorbance at 450 nm. Results are shown in
(191) It will be appreciated by those skilled in the art that changes could be made to the embodiments described above without departing from the broad inventive concept thereof. It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but it is intended to cover modifications within the spirit and scope of the present invention as defined by the present description.