ANIMAL FEED COMPOSITION AND USE THEREOF

20210337828 · 2021-11-04

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to a method of improving pigmentation by carotenoids in a monogastric animal comprising administering to the animal an animal feed or animal feed additive comprising one or more microbial muramidases.

    Claims

    1. A method of improving pigmentation by carotenoids in a monogastric animal comprising administering to the animal an animal feed or animal feed additive comprising one or more microbial muramidases.

    2. The method of claim 1, wherein the monogastric animal is selected from the group consisting of swine, piglet, growing pig, sow, poultry, turkey, duck, quail, guinea fowl, goose, pigeon, squab, chicken, broiler, layer, pullet and chick, cat, dog, horse, crustaceans, shrimps, prawns, fish, amberjack, arapaima, barb, bass, bluefish, bocachico, bream, bullhead, cachama, carp, catfish, catla, chanos, char, cichlid, cobia, cod, crappie, dorada, drum, eel, goby, goldfish, gourami, grouper, guapote, halibut, java, labeo, lai, loach, mackerel, milkfish, mojarra, mudfish, mullet, paco, pearlspot, pejerrey, perch, pike, pompano, roach, salmon, sampa, sauger, sea bass, seabream, shiner, sleeper, snakehead, snapper, snook, sole, spinefoot, sturgeon, sunfish, sweetfish, tench, terror, tilapia, trout, tuna, turbot, vendace, walleye and whitefish.

    3. The method of claim 2, wherein the monogastric animal is selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, pullet and chick.

    4. The method of claim 1, wherein the microbial muramidase is obtained or obtainable from the phylum Ascomycota or the subphylum Pezizomycotina.

    5. The method of claim 1, wherein the microbial muramidase comprises one or more domains selected from the list consisting of GH24 and GH25.

    6. The method of claim 1, wherein the microbial muramidase is selected from the group consisting of: (a) a polypeptide having at least 50%, e.g., at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 1; (b) a variant of SEQ ID NO: 1 wherein the variant has muramidase activity and comprises one or more amino acid substitutions, and/or one or more amino acid deletions, and/or one or more amino acid insertions or any combination thereof in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 positions; (c) a fragment of the polypeptide of (a) or (b) that has muramidase activity wherein the fragment comprises at least 170 amino acids, such as at least 175 amino acids, at least 177 amino acids, at least 180 amino acids, at least 185 amino acids, at least 190 amino acids, at least 195 amino acids or at least 200 amino acids; (d) a polypeptide having at least 50%, e.g., at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 4; (e) a variant of SEQ ID NO: 4 wherein the variant has muramidase activity and comprises one or more amino acid substitutions, and/or one or more amino acid deletions, and/or one or more amino acid insertions or any combination thereof in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 positions; and (f) a fragment of the polypeptide of (d) or (e) that has muramidase activity wherein the fragment comprises at least 210 amino acids, such as at least 215 amino acids, at least 220 amino acids, at least 225 amino acids, at least 230 amino acids, at least 235 amino acids or at least 240 amino acids.

    7. The method of claim 1, wherein the microbial muramidase is selected from the group consisting of amino acids 1 to 213 of SEQ ID NO: 1, amino acids 1 to 245 of SEQ ID NO: 4 and amino acids 1 to 208 of SEQ ID NO: 10.

    8. The method of claim 1, wherein the carotenoid is beta-carotene, astaxanthin, lutein and mixture thereof.

    9. The method of claim 1, wherein the pigmentation happens in the skin, paws or meat of the animal or in the egg of birds.

    10. A method of improving pigmentation by carotenoids in a monogastric animal comprising administering to the animal a composition, an animal feed or an animal feed additive comprising one or more microbial muramidases, wherein: (a) the microbial muramidase is a microbial muramidase comprising one or more domains selected from the list consisting of GH24 and GH25, is dosed at a level of 300 to 500 mg enzyme protein per kg animal feed; (b) the animal is a selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, pullet and chick.

    11. In one embodiment, the invention relates to a method of improving pigmentation by carotenoids in a monogastric animal comprising administering to the animal a composition, an animal feed or an animal feed additive comprising one or more microbial muramidases, wherein: (a) the microbial muramidase is a GH24 or GH 25 lysozyme obtained or obtainable from the phylum Ascomycota, and is dosed at a level of 300 to 500 mg enzyme protein per kg animal; (b) the animal is a selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, pullet and chick.

    12. A method of improving pigmentation of a monogastric animal comprising administering to the animal an animal feed or animal feed additive comprising one or more microbial muramidases and one or more carotenoids such as beta-carotene, astaxanthin, lutein and mixture thereof.

    13. Use of a composition, an animal feed or an animal feed additive for improving pigmentation by carotenoids in a monogastric animal wherein the composition, the animal feed or the animal feed additive comprises one or more microbial muramidases.

    14. Use of a composition, an animal feed or an animal feed additive for improving pigmentation of a monogastric animal wherein the composition, the animal feed or the animal feed additive comprises one or more microbial muramidases and one or more carotenoids such as beta-carotene, astaxanthin, lutein and mixture thereof.

    Description

    DETAILED DESCRIPTION OF THE INVENTION

    Methods of Improving Pigmentation

    [0039] It has been surprisingly found that supplementing an animal feed with a microbial muramidase results in a significant benefit of improving pigmentation by carotenoids in a monogastric animal, compared to an animal feed without the microbial muramidase.

    [0040] Particularly, treatment with muramidase may lead to a higher serum concentration of one or more carotenoids, such as beta-carotene, astaxanthin, lutein and mixture thereof, in an animal, and thus provide improved pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in the animal, compared to an animal feed without muramidase.

    [0041] Thus the invention relates to a method of improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal comprising administering to the animal an animal feed or animal feed additive comprising one or more microbial muramidases.

    [0042] Preferably, the pigmentation in the present invention happens in the skin, paws or meat of the animal. More preferably, the pigmentation happens in the skin of the animal.

    [0043] In the present invention, the improvement is compared to an animal feed or animal feed additive wherein the microbial muramidase is not present (herein referred to as the negative control).

    [0044] Preferably, the one or more parameters such as yellowness or organgeness or redness is highered by at least 1.0%, such as by at least 2.0%, at least 3.0%, at least 4.0%, at least 5.0%, at least 6.0%, at least 7.0% or at least 8.0% compared to the negative control.

    [0045] In the present invention, the microbial muramidase may be dosed at a level of 100 to 1000 mg enzyme protein per kg animal feed, such as 200 to 900 mg, 300 to 800 mg, 400 to 700 mg, 500 to 600 mg enzyme protein per kg animal feed, or any combination of these intervals.

    [0046] In the present invention, the monogastric animal may be selected from the group consisting of swine, piglet, growing pig, sow, poultry, turkey, duck, quail, guinea fowl, goose, pigeon, squab, chicken, broiler, layer, pullet and chick, cat, dog, horse, crustaceans, shrimps, prawns, fish, amberjack, arapaima, barb, bass, bluefish, bocachico, bream, bullhead, cachama, carp, catfish, catla, chanos, char, cichlid, cobia, cod, crappie, dorada, drum, eel, goby, goldfish, gourami, grouper, guapote, halibut, java, labeo, lai, loach, mackerel, milkfish, mojarra, mudfish, mullet, paco, pearlspot, pejerrey, perch, pike, pompano, roach, salmon, sampa, sauger, sea bass, seabream, shiner, sleeper, snakehead, snapper, snook, sole, spinefoot, sturgeon, sunfish, sweetfish, tench, terror, tilapia, trout, tuna, turbot, vendace, walleye and whitefish. Preferably, the monogastric animal is a selected from the group consisting of swine, piglet, growing pig, sow, poultry, turkey, duck, quail, guinea fowl, goose, pigeon, squab, chicken, broiler, layer, pullet and chick. More preferably, the the monogastric animal is a selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, and chick.

    [0047] In the present invention, the microbial muramidase may be fed to the animal from birth until slaughter. Preferably, the the microbial muramidase is fed to the animal on a daily basis from birth until slaughter. More Preferably, the microbial muramidase is fed to the animal on a daily basis for at least 10 days, such as at least 15 days or at least 20 days (where the days can be continuous or non-continuous) during the life span of the animal. Further preferably, the microbial muramidase is fed to the animal for 10-20 days followed by a non-treatment period of 5-10 days, and this cycle is repeated during the life span of the animal.

    [0048] In the present invention, the microbial muramidase may be fed to broilers for the first 49 days after hatching. Preferably, the microbial muramidase is fed to broilers for the first 36 days after hatching. More preferably, the microbial muramidase is fed to broilers on days 22 to 36 after hatching. Further preferably, the microbial muramidase is fed to broilers during the pre-starter (days 1-7) period. Further preferably, the microbial muramidase is fed to broilers during the starter (days 8-22) period. Further preferably, the microbial muramidase is fed to broilers during the pre-starter (days 1-7) and starter (days 8-22) period.

    [0049] In the present invention, the microbial muramidase may be fed to layers during the life span of the animal. Preferably, the microbial muramidase is fed to layers for 76 weeks from hatching. More preferably, the microbial muramidase is fed to layers during the laying period, (from ca. week 18). Further preferably, the microbial muramidase is fed to layers during the laying period but withheld during the forced molting period.

    [0050] In the present invention, the microbial muramidase may be fed to turkeys during life span of the animal. Preferably, the microbial muramidase is fed to turkeys for 24 weeks from hatching. More preferably, the microbial muramidase is fed to turkeys for the first 16 weeks from hatching (for hens) and for the first 20 weeks for hatching (for toms).

    [0051] In the present invention, the microbial muramidase may be fed to swine during life span of the animal. Preferably, the microbial muramidase is fed to swine for 27 weeks from birth. More preferably, the microbial muramidase is fed to piglets from birth to weaning (at 4 weeks). Further preferably, the microbial muramidase is fed to piglets for the first 6 weeks from birth (4 weeks of lactation and 2 weeks post-weaning). Further preferably, the microbial muramidase is fed to weaning piglets during the pre-starter (days 1-14 after weaning). Further preferably, the microbial muramidase is fed to weaning piglets during the starter (days 15-42 after weaning) period. Further preferably, the microbial muramidase is fed to weaning piglets during the pre-starter (days 1-14 after weaning) and starter (days 15-42 after weaning) period. Further preferably, the microbial muramidase is fed to swine during the grower/fattening period (week 10 to ca. week 27 after birth).

    [0052] In the present invention, the microbial muramidase may be of fungal origin. Preferably, the microbial muramidase is obtained or obtainable from the phylum Ascomycota, such as the sub-phylum Pezizomycotina. Preferably, the microbial muramidase comprises one or more domains selected from the list consisting of GH24 and GH25.

    [0053] In the present invention, the microbial muramidase may have at least 50%, e.g., at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 1, 4 or 10.

    [0054] In the present invention, the microbial muramidase may comprise or consist of the amino acid sequence of SEQ ID NO: 1 or an allelic variant thereof; or is a fragment thereof having muramidase activity, wherein the fragment comprises at least 170 amino acids, such as at least 175 amino acids, at least 177 amino acids, at least 180 amino acids, at least 185 amino acids, at least 190 amino acids, at least 195 amino acids or at least 200 amino acids. Preferably, the microbial muramidase comprises or consists of the amino acid sequence of SEQ ID NO: 1 or an allelic variant thereof and a N-terminal and/or C-terminal His-tag and/or HQ-tag. More preferably, the polypeptide comprises or consists of amino acids 1 to 213 of SEQ ID NO: 1.

    [0055] Alternatively, the microbial muramidase may comprise or consist of the amino acid sequence of SEQ ID NO: 4 or an allelic variant thereof; or is a fragment thereof having muramidase activity, wherein the fragment comprises at least 210 amino acids, such as at least 215 amino acids, at least 220 amino acids, at least 225 amino acids, at least 230 amino acids, at least 235 amino acids or at least 240 amino acids. Preferably, the microbial muramidase comprises or consists of the amino acid sequence of SEQ ID NO: 4 or an allelic variant thereof and a N-terminal and/or C-terminal His-tag and/or HQ-tag. More preferably, the polypeptide comprises or consists of amino acids 1 to 245 of SEQ ID NO: 4.

    [0056] More alternatively, the microbial muramidase may comprise or consist of the amino acid sequence of SEQ ID NO: 10 or an allelic variant thereof; or is a fragment thereof having muramidase activity, wherein the fragment comprises at least 210 amino acids, such as at least 215 amino acids, at least 220 amino acids, at least 225 amino acids, at least 230 amino acids, at least 235 amino acids or at least 240 amino acids. Preferably, the microbial muramidase comprises or consists of the amino acid sequence of SEQ ID NO: 10 or an allelic variant thereof and a N-terminal and/or C-terminal His-tag and/or HQ-tag. More preferably, the polypeptide comprises or consists of amino acids 1 to 208 of SEQ ID NO: 10.

    [0057] In the present invention, the microbial muramidase may be a variant of SEQ ID NO: 1, 4 or 10 wherein the variant has muramidase activity and comprises one or more substitutions, and/or one or more deletions, and/or one or more insertions or any combination thereof in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 positions. Preferably, the number of positions comprising one or more amino acid substitutions, and/or one or more amino acid deletions, and/or one or more amino acid insertions or any combination thereof in SEQ ID NO: 1, 4 or 10 is between 1 and 45, such as 1-40, 1-35, 1-30, 1-25, 1-20, 1-15, 1-10 or 1-5 positions. More preferably, the number of positions comprising one or more amino acid substitutions, and/or one or more amino acid deletions, and/or one or more amino acid insertions or any combination thereof in SEQ ID NO: 1, 4 or 10 is not more than 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. Further preferably, the number of substitutions, deletions, and/or insertions in SEQ ID NO: 1, 4 or 10 is not more than 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. Further preferably, the number of substitutions, preferably conservative substitutions, in SEQ ID NO: 1, 4 or 10 is not more than 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. Further preferably, the number of conservative substitutions in SEQ ID NO: 1, 4 or 10 is not more than 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.

    [0058] Any person skilled in the art can understand, the polypeptide of the microbial muramidase may have amino acid changes. The amino acid changes may be of a minor nature, that is conservative amino acid substitutions or insertions that do not significantly affect the folding and/or activity of the protein; small deletions, typically of 1-30 amino acids; small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue; a small linker peptide of up to 20-25 residues; or a small extension that facilitates purification by changing net charge or another function, such as a poly-histidine tract, an antigenic epitope or a binding domain.

    [0059] Examples of conservative substitutions are within the groups of basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (leucine, isoleucine and valine), aromatic amino acids (phenylalanine, tryptophan and tyrosine), and small amino acids (glycine, alanine, serine, threonine and methionine). Amino acid substitutions that do not generally alter specific activity are known in the art and are described, for example, by H. Neurath and R. L. Hill, 1979, In, The Proteins, Academic Press, New York. Common substitutions are Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, and Asp/Gly.

    [0060] Essential amino acids in a polypeptide can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, 1989, Science 244: 1081-1085). In the latter technique, single alanine mutations are introduced at every residue in the molecule, and the resultant mutant molecules are tested for muramidase activity to identify amino acid residues that are critical to the activity of the molecule. See also, Hilton et al., 1996, J. Biol. Chem. 271: 4699-4708. The active site of the enzyme or other biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction, or photoaffinity labeling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., 1992, Science 255: 306-312; Smith et al., 1992, J. Mol. Biol. 224: 899-904; Wlodaver et al., 1992, FEBS Lett. 309: 59-64. The identity of essential amino acids can also be inferred from an alignment with a related polypeptide.

    [0061] The crystal structure of the Acremonium alcalophilum CBS114.92 muramidase was solved at a resolution of 1.3 Å as disclosed in WO 2013/076253. These atomic coordinates can be used to generate a three dimensional model depicting the structure of the Acremonium alcalophilum CBS114.92 muramidase or homologous structures (such as the variants of the present invention). Using the x/ray structure, amino acid residues D95 and E97 (using SEQ ID NO: 1 for numbering) were identified as catalytic residues.

    [0062] In the present invention, examples of the carotenoid include but are not limited to beta-carotene, astaxanthin, lutein and mixture thereof.

    [0063] Accordingly, the invention also relates to a method of improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal comprising administering to the animal an animal feed or animal feed additive comprising one or more microbial muramidases and one or more carotenoids such as beta-carotene, astaxanthin, lutein and mixture thereof.

    [0064] In one embodiment, the invention relates to a method of improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal comprising administering to the animal a composition, an animal feed or an animal feed additive comprising one or more microbial muramidases, wherein:

    [0065] (a) the microbial muramidase is a microbial muramidase comprising one or more domains selected from the list consisting of GH24 and GH25, is dosed at a level of 300 to 500 mg enzyme protein per kg animal feed; and

    [0066] (b) the animal is a selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, pullet and chick.

    [0067] In one embodiment, the invention relates to a method of improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal comprising administering to the animal a composition, an animal feed or an animal feed additive comprising one or more microbial muramidases, wherein:

    [0068] (a) the microbial muramidase is a GH24 or GH 25 lysozyme obtained or obtainable from the phylum Ascomycota, and is dosed at a level of 300 to 500 mg enzyme protein per kg animal; and

    [0069] (b) the animal is a selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, pullet and chick.

    Formulation

    [0070] The microbial muramidase of the present invention may be formulated as a composition for improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal, which is also the present invention intents to cover. The microbial muramidase of the present invention may be formulated as a liquid or a solid.

    [0071] For a liquid formulation, the formulating agent may comprise a polyol (such as e.g. glycerol, ethylene glycol or propylene glycol), a salt (such as e.g. sodium chloride, sodium benzoate, potassium sorbate) or a sugar or sugar derivative (such as e.g. dextrin, glucose, sucrose, and sorbitol). Thus the composition of the present invention may a liquid composition comprising the microbial muramidase of the present invention and one or more formulating agents selected from the list consisting of glycerol, ethylene glycol, 1,2-propylene glycol, 1,3-propylene glycol, sodium chloride, sodium benzoate, potassium sorbate, dextrin, glucose, sucrose, and sorbitol. The liquid formulation may be sprayed onto the feed after it has been pelleted or may be added to drinking water given to the animals.

    [0072] For a solid formulation, the composition of the present invention may be for example as a granule, spray dried powder or agglomerate. The formulating agent may comprise a salt (organic or inorganic zinc, sodium, potassium or calcium salts such as e.g. such as calcium acetate, calcium benzoate, calcium carbonate, calcium chloride, calcium citrate, calcium sorbate, calcium sulfate, potassium acetate, potassium benzoate, potassium carbonate, potassium chloride, potassium citrate, potassium sorbate, potassium sulfate, sodium acetate, sodium benzoate, sodium carbonate, sodium chloride, sodium citrate, sodium sulfate, zinc acetate, zinc benzoate, zinc carbonate, zinc chloride, zinc citrate, zinc sorbate, zinc sulfate), starch or a sugar or sugar derivative (such as e.g. sucrose, dextrin, glucose, lactose, sorbitol).

    [0073] For example, the solid composition is in granulated form. The granule may have a matrix structure where the components are mixed homogeneously. However, the granule typically comprises a core particle and one or more coatings, which typically are salt and/or wax coatings. Examples of waxes are polyethylene glycols; polypropylenes; Carnauba wax; Candelilla wax; bees wax; hydrogenated plant oil or animal tallow such as hydrogenated ox tallow, hydrogenated palm oil, hydrogenated cotton seeds and/or hydrogenated soy bean oil; fatty acid alcohols; mono-glycerides and/or di-glycerides, such as glyceryl stearate, wherein stearate is a mixture of stearic and palmitic acid; micro-crystalline wax; paraffin's; and fatty acids, such as hydrogenated linear long chained fatty acids and derivatives thereof. A preferred wax is palm oil or hydrogenated palm oil. The core particle can either be a homogeneous blend of muramidase of the invention optionally combined with one or more additional enzymes and optionally together with one or more salts or an inert particle with the muramidase of the invention optionally combined with one or more additional enzymes applied onto it.

    [0074] In the above granule, the material of the core particles may be selected from the group consisting of inorganic salts (such as calcium acetate, calcium benzoate, calcium carbonate, calcium chloride, calcium citrate, calcium sorbate, calcium sulfate, potassium acetate, potassium benzoate, potassium carbonate, potassium chloride, potassium citrate, potassium sorbate, potassium sulfate, sodium acetate, sodium benzoate, sodium carbonate, sodium chloride, sodium citrate, sodium sulfate, zinc acetate, zinc benzoate, zinc carbonate, zinc chloride, zinc citrate, zinc sorbate, zinc sulfate), starch or a sugar or sugar derivative (such as e.g. sucrose, dextrin, glucose, lactose, sorbitol), sugar or sugar derivative (such as e.g. sucrose, dextrin, glucose, lactose, sorbitol), small organic molecules, starch, flour, cellulose and minerals and clay minerals (also known as hydrous aluminium phyllosilicates). Preferably, the core comprises a clay mineral such as kaolinite or kaolin.

    [0075] The salt coating is typically at least 1 μm thick and can either be one particular salt or a mixture of salts, such as Na.sub.2SO.sub.4, K.sub.2SO.sub.4, MgSO.sub.4 and/or sodium citrate. Other examples are those described in e.g. WO 2008/017659, WO 2006/034710, WO 1997/05245, WO 1998/54980, WO 1998/55599, WO 2000/70034 or polymer coating such as described in WO 2001/00042.

    [0076] Preferably, the composition of the present invention is a solid composition comprising the muramidase of the invention and one or more formulating agents selected from the list consisting of sodium chloride, sodium benzoate, potassium sorbate, sodium sulfate, potassium sulfate, magnesium sulfate, sodium thiosulfate, calcium carbonate, sodium citrate, dextrin, glucose, sucrose, sorbitol, lactose, starch and cellulose. More preferably, the formulating agent is selected from one or more of the following compounds: sodium sulfate, dextrin, cellulose, sodium thiosulfate and calcium carbonate. Further preferably, the solid composition is in granulated form. More further preferably, the solid composition is in granulated form and comprises a core particle, an enzyme layer comprising the muramidase of the invention and a salt coating.

    [0077] Preferably, the formulating agent is selected from one or more of the following compounds: glycerol, ethylene glycol, 1, 2-propylene glycol or 1, 3-propylene glycol, sodium chloride, sodium benzoate, potassium sorbate, sodium sulfate, potassium sulfate, magnesium sulfate, sodium thiosulfate, calcium carbonate, sodium citrate, dextrin, glucose, sucrose, sorbitol, lactose, starch, kaolin and cellulose. More preferably, the formulating agent is selected from one or more of the following compounds: 1, 2-propylene glycol, 1, 3-propylene glycol, sodium sulfate, dextrin, cellulose, sodium thiosulfate, kaolin and calcium carbonate.

    [0078] Preferably, the pigmentation in the present invention happens in the skin, paws or meat of the animal. More preferably, the pigmentation happens in the skin of the animal.

    Animal Feed and Animal Feed Additives

    [0079] The microbial muramidase of the present invention may also be formulated as animal feed or animal feed additive for improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in an animal, which is also the present invention intents to cover.

    [0080] Animal feed compositions or diets have a relatively high content of protein. Poultry and pig diets can be characterised as indicated in Table B of WO 2001/058275, columns 2-3. Fish diets can be characterised as indicated in column 4 of this Table B. Furthermore such fish diets usually have a crude fat content of 200-310 g/kg.

    [0081] An animal feed composition according to the present invention may have a crude protein content of between 50 and 800 g/kg, and furthermore comprises one or more microbial muramidases as described herein.

    [0082] Furthermore, or in the alternative (to the crude protein content indicated above), the animal feed composition of the present invention may have a content of metabolisable energy of 10-30 MJ/kg; and/or a content of calcium of 0.1-200 g/kg; and/or a content of available phosphorus of 0.1-200 g/kg; and/or a content of methionine of 0.1-100 g/kg; and/or a content of methionine plus cysteine of 0.1-150 g/kg; and/or a content of lysine of 0.5-50 g/kg.

    [0083] Particularly, the content of metabolisable energy, crude protein, calcium, phosphorus, methionine, methionine plus cysteine, and/or lysine may be within any one of ranges 2, 3, 4 or 5 in Table B of WO 2001/058275 (R. 2-5).

    [0084] The nitrogen content is determined by the Kjeldahl method (A.O.A.C., 1984, Official Methods of Analysis 14th ed., Association of Official Analytical Chemists, Washington D.C.) and crude protein is calculated as nitrogen (N) multiplied by a factor 6.25 (i.e. Crude protein (g/kg)=N (g/kg)×6.25).

    [0085] Metabolisable energy can be calculated on the basis of the NRC publication Nutrient requirements in swine, ninth revised edition 1988, subcommittee on swine nutrition, committee on animal nutrition, board of agriculture, national research council. National Academy Press, Washington, D.C., pp. 2-6, and the European Table of Energy Values for Poultry Feed-stuffs, Spelderholt centre for poultry research and extension, 7361 DA Beekbergen, The Netherlands. Grafisch bedrijf Ponsen & looijen by, Wageningen. ISBN 90-71463-12-5.

    [0086] The dietary content of calcium, available phosphorus and amino acids in complete animal diets is calculated on the basis of feed tables such as Veevoedertabel 1997, gegevens over chemische samenstelling, verteerbaarheid en voederwaarde van voedermiddelen, Central Veevoederbureau, Runderweg 6, 8219 pk Lelystad. ISBN 90-72839-13-7.

    [0087] The animal feed composition of the present invention may contain at least one vegetable protein as defined above.

    [0088] The animal feed composition of the present invention may also contain animal protein, such as Meat and Bone Meal, Feather meal, and/or Fish Meal, typically in an amount of 0-25%. The animal feed composition of the present invention may also comprise Dried Distillers Grains with Solubles (DDGS), typically in amounts of 0-30%.

    [0089] Preferaly, the animal feed composition of the present invention contains 0-80% maize; and/or 0-80% sorghum; and/or 0-70% wheat; and/or 0-70% Barley; and/or 0-30% oats; and/or 0-40% soybean meal; and/or 0-25% fish meal; and/or 0-25% meat and bone meal; and/or 0-20% whey.

    [0090] Preferably, the animal feed of the present invention comprises vegetable proteins. The protein content of the vegetable proteins is at least 10, 20, 30, 40, 50, 60, 70, 80, or 90% (w/w).

    [0091] In the present invention, the vegetable proteins may be derived from vegetable protein sources, such as legumes and cereals, for example, materials from plants of the families Fabaceae (Leguminosae), Cruciferaceae, Chenopodiaceae, and Poaceae, such as soy bean meal, lupin meal, rapeseed meal, and combinations thereof.

    [0092] The vegetable protein source may be material from one or more plants of the family Fabaceae, e.g., soybean, lupine, pea, or bean. The vegetable protein source may also be material from one or more plants of the family Chenopodiaceae, e.g. beet, sugar beet, spinach or quinoa. Other examples of vegetable protein sources are rapeseed, and cabbage. Soybean is a preferred vegetable protein source. Other examples of vegetable protein sources are cereals such as barley, wheat, rye, oat, maize (corn), rice, and sorghum.

    [0093] Animal diets can e.g. be manufactured as mash feed (non-pelleted) or pelleted feed. Typically, the milled feed-stuffs are mixed and sufficient amounts of essential vitamins and minerals are added according to the specifications for the species in question. Enzymes can be added as solid or liquid enzyme formulations. For example, for mash feed a solid or liquid enzyme formulation may be added before or during the ingredient mixing step. For pelleted feed the (liquid or solid) muramidase/enzyme preparation may also be added before or during the feed ingredient step. Typically a liquid enzyme preparation comprises the microbial muramidase of the present invention optionally with a polyol, such as glycerol, ethylene glycol or propylene glycol, and is added after the pelleting step, such as by spraying the liquid formulation onto the pellets. The muramidase may also be incorporated in a feed additive or premix.

    [0094] Alternatively, the microbial muramidase of the present invention may be prepared by freezing a mixture of liquid enzyme solution with a bulking agent such as ground soybean meal, and then lyophilizing the mixture.

    [0095] In the present invention, the animal feed composition may further comprise one or more additional enzymes, microbes, vitamins, minerals, amino acids, and/or other feed ingredients.

    [0096] Preferably, the composition comprises one or more of the microbial muramidases of the present invention, one or more formulating agents and one or more components selected from the list consisting of: one or more additional enzymes; one or more microbes; one or more vitamins; one or more minerals; one or more amino acids; and one or more other feed ingredients.

    [0097] The final muramidase concentration in the animal feed compositon of the present invention may be within the range of 0.01-200 mg enzyme protein per kg animal feed, such as 0.1 to 150 mg, 0.5 to 100 mg, 1 to 75 mg, 2 to 50 mg, 3 to 25 mg, 2 to 80 mg, 5 to 60 mg, 8 to 40 mg or 10 to 30 mg enzyme protein per kg animal feed, or any combination of these intervals.

    [0098] It is at present contemplated that the microbial muramidase is administered in one or more of the following amounts (dosage ranges): 0.01-200; 0.01-100; 0.5-100; 1-50; 5-100; 5-50; 10-100; 0.05-50; 5-25; or 0.10-10—all these ranges being in mg muramidase per kg feed (ppm).

    [0099] For determining mg muramidase protein per kg feed, the muramidase is purified from the feed composition, and the specific activity of the purified muramidase is determined using a relevant assay (see under muramidase activity). The muramidase activity of the feed composition as such is also determined using the same assay, and on the basis of these two determinations, the dosage in mg muramidase protein per kg feed is calculated.

    [0100] The animal feed additive of the present invention is intended for being included (or prescribed as having to be included) in animal diets or feed at levels of 0.01 to 10.0%; more particularly 0.05 to 5.0%; or 0.2 to 1.0% (% meaning g additive per 100 g feed). This is so in particular for premixes.

    [0101] The same principles apply for determining mg muramidase protein in feed additives. Of course, if a sample is available of the muramidase used for preparing the feed additive or the feed, the specific activity is determined from this sample (no need to purify the muramidase from the feed composition or the additive).

    Additional Enzymes

    [0102] In the present invention, the compositions or animal feed or animal feed additive described herein optionally include one or more enzymes. Enzymes can be classified on the basis of the handbook Enzyme Nomenclature from NC-IUBMB, 1992), see also the ENZYME site at the internet: http://www.expasy.ch/enzyme/. ENZYME is a repository of information relative to the nomenclature of enzymes. It is primarily based on the recommendations of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUB-MB), Academic Press, Inc., 1992, and it describes each type of characterized enzyme for which an EC (Enzyme Commission) number has been provided (Bairoch A. The ENZYME database, 2000, Nucleic Acids Res 28:304-305). This IUB-MB Enzyme nomenclature is based on their substrate specificity and occasionally on their molecular mechanism; such a classification does not reflect the structural features of these enzymes.

    [0103] Another classification of certain glycoside hydrolase enzymes, such as endoglucanase, xylanase, galactanase, mannanase, dextranase, muramidase and galactosidase is described in Henrissat et al, “The carbohydrate-active enzymes database (CAZy) in 2013”, Nucl. Acids Res. (1 Jan. 2014) 42 (D1): D490-D495; see also www.cazy.org.

    [0104] Thus the composition or animal feed or animal feed additive of the present invention may also comprise at least one other enzyme selected from the group consisting of phytase (EC 3.1.3.8 or 3.1.3.26), xylanase (EC 3.2.1.8); galactanase (EC 3.2.1.89); alpha-galactosidase (EC 3.2.1.22); protease (EC 3.4); phospholipase A1 (EC 3.1.1.32); phospholipase A2 (EC 3.1.1.4); lysophospholipase (EC 3.1.1.5); phospholipase C (3.1.4.3); phospholipase D (EC 3.1.4.4); amylase such as, for example, alpha-amylase (EC 3.2.1.1); arabinofuranosidase (EC 3.2.1.55); beta-xylosidase (EC 3.2.1.37); acetyl xylan esterase (EC 3.1.1.72); feruloyl esterase (EC 3.1.1.73); cellulase (EC 3.2.1.4); cellobiohydrolases (EC 3.2.1.91); beta-glucosidase (EC 3.2.1.21); pullulanase (EC 3.2.1.41), alpha-mannosidase (EC 3.2.1.24), mannanase (EC 3.2.1.25) and beta-glucanase (EC 3.2.1.4 or EC 3.2.1.6), or any combination thereof.

    [0105] Examples of commercially available phytases include Bio-Feed™ Phytase (Novozymes), Ronozyme® P, Ronozyme® NP and Ronozyme® HiPhos (DSM Nutritional Products), Natuphos™ (BASF), Finase® and Quantum® Blue (AB Enzymes), OptiPhos® (Huvepharma) Phyzyme® XP (Verenium/DuPont) and Axtra® PHY (DuPont). Other preferred phytases include those described in e.g. WO 98/28408, WO 00/43503, and WO 03/066847.

    [0106] Examples of commercially available xylanases include Ronozyme® WX and Ronozyme® G2 (DSM Nutritional Products), Econase® XT and Barley (AB Vista), Xylathin® (Verenium), Hostazym® X (Huvepharma) and Axtra® XB (Xylanase/beta-glucanase, DuPont).

    [0107] Examples of commercially available proteases include Ronozyme® ProAct (DSM Nutritional Products).

    Microbes

    [0108] In the present invention, the composition or animal feed or animal feed additive may further comprise one or more additional microbes. For example, the composition or animal feed further comprises a bacterium from one or more of the following genera: Lactobacillus, Lactococcus, Streptococcus, Bacillus, Pediococcus, Enterococcus, Leuconostoc, Carnobacterium, Propionibacterium, Bifidobacterium, Clostridium and Megasphaera or any combination thereof.

    [0109] Preferably, the composition or animal feed or animal feed additive of the present invention further comprises a bacterium from one or more of the following strains: Bacillus subtilis, Bacillus licheniformis, Bacillus amyloliquefaciens, Bacillus cereus, Bacillus pumilus, Bacillus polymyxa, Bacillus megaterium, Bacillus coagulans, Bacillus circulans, Enterococcus faecium, Enterococcus spp, and Pediococcus spp, Lactobacillus spp, Bifidobacterium spp, Lactobacillus acidophilus, Pediococsus acidilactici, Lactococcus lactis, Bifidobacterium bifidum, Propionibacterium thoenii, Lactobacillus farciminus, Lactobacillus rhamnosus, Clostridium butyricum, Bifidobacterium animalis ssp. animalis, Lactobacillus reuteri, Lactobacillus salivarius ssp. salivarius, Megasphaera elsdenii, Propionibacteria sp.

    [0110] More preferably, the composition or animal feed or animal feed additive of the present invention further comprises a bacterium from one or more of the following strains of Bacillus subtilis: 3A-P4 (PTA-6506), 15A-P4 (PTA-6507), 22C-P1 (PTA-6508), 2084 (NRRL B-500130), LSSA01 (NRRL-B-50104), BS27 (NRRL B-50105), BS 18 (NRRL B-50633), BS 278 (NRRL B-50634), DSM 29870, DSM 29871, NRRL B-50136, NRRL B-50605, NRRL B-50606, NRRL B-50622 and PTA-7547.

    [0111] More preferably, the composition, animal feed or animal feed additive of the present invention further comprises a bacterium from one or more of the following strains of Bacillus pumilus: NRRL B-50016, ATCC 700385, NRRL B-50885 or NRRL B-50886.

    [0112] More preferably, composition, animal feed additive or animal feed further comprises a bacterium from one or more of the following strains of Bacillus lichenformis: NRRL B 50015, NRRL B-50621 or NRRL B-50623.

    [0113] More preferably, the composition, animal feed or animal feed additive of the present invention further comprises a bacterium from one or more of the following strains of Bacillus amyloliquefaciens: DSM 29869, DSM 29872, NRRL B 50607, PTA-7543, PTA-7549, NRRL B-50349, NRRL B-50606, NRRL B-50013, NRRL B-50151, NRRL B-50141, NRRL B-50147 or NRRL B-50888.

    [0114] The bacterial count of each of the bacterial strains in the composition, animal feed or animal feed additive of the present invention is between 1×10.sup.4 and 1×10.sup.14 CFU/kg of dry matter, preferably between 1×10.sup.6 and 1×10.sup.12 CFU/kg of dry matter, more preferably between 1×10.sup.7 and 1×10.sup.11, and the most preferably between 1×10.sup.8 and 1×10.sup.10 CFU/kg of dry matter.

    [0115] The bacterial count of each of the bacterial strains in the composition, animal feed or animal feed additive of the present invention is between 1×10.sup.5 and 1×10.sup.15 CFU/animal/day, preferably between 1×10.sup.7 and 1×10.sup.13 CFU/animal/day, and more preferably between 1×10.sup.8 and 1×10.sup.12 CFU/animal/day, and the most preferably between 1×10.sup.9 and 1×10.sup.11 CFU/animal/day.

    [0116] In the present invention, the one or more bacterial strains may be present in the form of a stable spore.

    Premix

    [0117] In the present invention, the composition, animal feed or animal feed additive may include a premix, comprising e.g. vitamins, minerals, enzymes, amino acids, preservatives, antibiotics, other feed ingredients or any combination thereof which are mixed into the animal feed.

    Amino Acids

    [0118] the composition, animal feed or animal feed additive of the present invention may further comprise one or more amino acids. Examples of the amino acids include but are not limited to lysine, alanine, beta-alanine, threonine, methionine and tryptophan.

    Vitamins and Minerals

    [0119] In the present invention, the composition, animal feed or animal feed additive may include one or more vitamins, such as one or more fat-soluble vitamins and/or one or more water-soluble vitamins. Optionally, the composition, animal feed or animal feed additive of the present invention may include one or more minerals, such as one or more trace minerals and/or one or more macro minerals.

    [0120] Usually fat- and water-soluble vitamins, as well as trace minerals form part of a so-called premix intended for addition to the feed, whereas macro minerals are usually separately added to the feed.

    [0121] Non-limiting examples of fat-soluble vitamins include vitamin A, vitamin D3, vitamin E, and vitamin K, e.g., vitamin K3.

    [0122] Non-limiting examples of water-soluble vitamins include vitamin B12, biotin and choline, vitamin B1, vitamin B2, vitamin B6, niacin, folic acid and panthothenate, e.g., Ca-D-panthothenate.

    [0123] Non-limiting examples of trace minerals include boron, cobalt, chloride, chromium, copper, fluoride, iodine, iron, manganese, molybdenum, selenium and zinc.

    [0124] Non-limiting examples of macro minerals include calcium, magnesium, potassium and sodium.

    [0125] The nutritional requirements of these components (exemplified with poultry and piglets/pigs) are listed in Table A of WO 2001/058275. Nutritional requirement means that these components should be provided in the diet in the concentrations indicated.

    [0126] In the alternative, the composition, animal feed or animal feed additive of the present invention comprises at least one of the individual components specified in Table A of WO 01/58275. At least one means either of, one or more of, one, or two, or three, or four and so forth up to all thirteen, or up to all fifteen individual components. More specifically, this at least one individual component is included in the composition, animal feed or animal feed additive of the present invention in such an amount as to provide an in-feed-concentration within the range indicated in column four, or column five, or column six of Table A.

    [0127] Preferably, the animal feed additive of the invention comprises at least one of the below vitamins, to provide an in-feed-concentration within the ranges specified in the below Table 1 (for piglet and broiler diets, respectively).

    TABLE-US-00001 TABLE 1 Typical vitamin recommendations Vitamin Piglet diet Broiler diet Vitamin A 10,000-15,000 IU/kg feed 8-12,500 IU/kg feed Vitamin D3 1800-2000 IU/kg feed 3000-5000 IU/kg feed Vitamin E 60-100 mg/kg feed 150-240 mg/kg feed Vitamin K3 2-4 mg/kg feed 2-4 mg/kg feed Vitamin B1 2-4 mg/kg feed 2-3 mg/kg feed Vitamin B2 6-10 mg/kg feed 7-9 mg/kg feed Vitamin B6 4-8 mg/kg feed 3-6 mg/kg feed Vitamin B12 0.03-0.05 mg/kg feed 0.015-0.04 mg/kg feed Niacin 30-50 mg/kg feed 50-80 mg/kg feed (Vitamin B3) Pantothenic 20-40 mg/kg feed 10-18 mg/kg feed acid Folic acid 1-2 mg/kg feed 1-2 mg/kg feed Biotin 0.15-0.4 mg/kg feed 0.15-0.3 mg/kg feed Choline 200-400 mg/kg feed 300-600 mg/kg feed chloride

    Other Feed Ingredients

    [0128] the composition, animal feed or animal feed additive of the present invention may further comprise colouring agents, growth improving additives and aroma compounds/flavourings, polyunsaturated fatty acids (PUFAs); reactive oxygen generating species, anti-microbial peptides and anti-fungal polypeptides.

    [0129] Examples of the colouring agents are carotenoid such as beta-carotene, astaxanthin, and lutein.

    [0130] Examples of the stabilizing agents (e.g. acidifiers) are organic acids. Examples of these are benzoic acid (VevoVitali®, DSM Nutritional Products), formic acid, butyric acid, fumaric acid and propionic acid.

    [0131] Examples of the aroma compounds/flavourings are creosol, anethol, deca-, undeca- and/or dodeca-lactones, ionones, irone, gingerol, piperidine, propylidene phatalide, butylidene phatalide, capsaicin and tannin.

    [0132] Examples of the polyunsaturated fatty acids are C18, C20 and C22 polyunsaturated fatty acids, such as arachidonic acid, docosohexaenoic acid, eicosapentaenoic acid and gamma-linoleic acid.

    [0133] Examples of the reactive oxygen generating species are chemicals such as perborate, persulphate, or percarbonate; and enzymes such as an oxidase, an oxygenase or a syntethase.

    [0134] Examples of the antimicrobial peptides (AMP's) are CAP18, Leucocin A, Tritrpticin, Protegrin-1, Thanatin, Defensin, Lactoferrin, Lactoferricin, and Ovispirin such as Novispirin (Robert Lehrer, 2000), Plectasins, and Statins, including the compounds and polypeptides disclosed in WO 03/044049 and WO 03/048148, as well as variants or fragments of the above that retain antimicrobial activity.

    [0135] Examples of the antifungal polypeptides (AFP's) are the Aspergillus giganteus, and Aspergillus niger peptides, as well as variants and fragments thereof which retain antifungal activity, as disclosed in WO 94/01459 and WO 02/090384.

    Use of Microbial Lyzozyme

    [0136] In another aspect, the invention relates to the use of a composition, an animal feed or an animal feed additive for improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal wherein the composition, the animal feed or the animal feed additive comprises one or more microbial muramidases.

    [0137] In the present invention, the microbial muramidase may be dosed at a level of 100 to 1000 mg enzyme protein per kg animal feed, such as 200 to 900 mg, 300 to 800 mg, 400 to 700 mg, 500 to 600 mg enzyme protein per kg animal feed, or any combination of these intervals.

    [0138] In the present invention, the monogastric animal may be selected from the group consisting of swine, piglet, growing pig, sow, poultry, turkey, duck, quail, guinea fowl, goose, pigeon, squab, chicken, broiler, layer, pullet and chick, cat, dog, horse, crustaceans, shrimps, prawns, fish, amberjack, arapaima, barb, bass, bluefish, bocachico, bream, bullhead, cachama, carp, catfish, catla, chanos, char, cichlid, cobia, cod, crappie, dorada, drum, eel, goby, goldfish, gourami, grouper, guapote, halibut, java, labeo, lai, loach, mackerel, milkfish, mojarra, mudfish, mullet, paco, pearlspot, pejerrey, perch, pike, pompano, roach, salmon, sampa, sauger, sea bass, seabream, shiner, sleeper, snakehead, snapper, snook, sole, spinefoot, sturgeon, sunfish, sweetfish, tench, terror, tilapia, trout, tuna, turbot, vendace, walleye and whitefish. Preferably, the monogastric animal is a selected from the group consisting of swine, piglet, growing pig, sow, poultry, turkey, duck, quail, guinea fowl, goose, pigeon, squab, chicken, broiler, layer, pullet and chick. More preferably, the the monogastric animal is a selected from the group consisting of swine, piglet, growing pig, sow, chicken, broiler, layer, and chick.

    [0139] In the present invention, the microbial muramidase may be fed to the animal from birth until slaughter. Preferably, the the microbial muramidase is fed to the animal on a daily basis from birth until slaughter. More Preferably, the microbial muramidase is fed to the animal on a daily basis for at least 10 days, such as at least 15 days or at least 20 days (where the days can be continuous or non-continuous) during the life span of the animal. In one embodiment, the microbial muramidase is fed to the animal for 10-20 days followed by a non-treatment period of 5-10 days, and this cycle is repeated during the life span of the animal.

    [0140] In the present invention, the microbial muramidase may be fed to broilers for the first 49 days after hatching. Preferably, the microbial muramidase is fed to broilers for the first 36 days after hatching. More preferably, the microbial muramidase is fed to broilers on days 22 to 36 after hatching. Further preferably, the microbial muramidase is fed to broilers during the pre-starter (days 1-7) period. Further preferably, the microbial muramidase is fed to broilers during the starter (days 8-22) period. Further preferably, the microbial muramidase is fed to broilers during the pre-starter (days 1-7) and starter (days 8-22) period.

    [0141] In the present invention, the microbial muramidase may be fed to layers during the life span of the animal. Preferably, the microbial muramidase is fed to layers for 76 weeks from hatching. More preferably, the microbial muramidase is fed to layers during the laying period, (from ca. week 18). Further preferably, the microbial muramidase is fed to layers during the laying period but withheld during the forced molting period.

    [0142] In the present invention, the microbial muramidase may be fed to turkeys during life span of the animal. Preferably, the microbial muramidase is fed to turkeys for 24 weeks from hatching. More preferably, the microbial muramidase is fed to turkeys for the first 16 weeks from hatching (for hens) and for the first 20 weeks for hatching (for toms).

    [0143] In the present invention, the microbial muramidase may be fed to swine during life span of the animal. Preferably, the microbial muramidase is fed to swine for 27 weeks from birth. More preferably, the microbial muramidase is fed to piglets from birth to weaning (at 4 weeks). Further preferably, the microbial muramidase is fed to piglets for the first 6 weeks from birth (4 weeks of lactation and 2 weeks post-weaning). Further preferably, the microbial muramidase is fed to weaning piglets during the pre-starter (days 1-14 after weaning). Further preferably, the microbial muramidase is fed to weaning piglets during the starter (days 15-42 after weaning) period. Further preferably, the microbial muramidase is fed to weaning piglets during the pre-starter (days 1-14 after weaning) and starter (days 15-42 after weaning) period. Further preferably, the microbial muramidase is fed to swine during the grower/fattening period (week 10 to ca. week 27 after birth).

    [0144] In the present invention, the microbial muramidase may be of fungal origin. Preferably, the microbial muramidase is obtained or obtainable from the phylum Ascomycota, such as the sub-phylum Pezizomycotina. Preferably, the microbial muramidase comprises one or more domains selected from the list consisting of GH24 and GH25.

    [0145] In the present invention, examples of the carotenoid include but are not limited to beta-carotene, astaxanthin, lutein and mixture thereof.

    [0146] Accordingly, the invention also to the use of a composition, an animal feed or an animal feed additive for improving pigmentation, such as yellowness or organgeness and/or redness, by carotenoids in a monogastric animal wherein the composition, the animal feed or the animal feed additive comprises one or more microbial muramidases one or more carotenoids such as beta-carotene, astaxanthin, lutein and mixture thereof.

    [0147] Preferably, the pigmentation in the present invention happens in the skin, paws or meat of the animal. More preferably, the pigmentation happens in the skin of the animal.

    Examples

    Strains

    [0148] Trichophaea saccata CBS804.70 was purchased from the Centraalbureau voor Schimmelcultures (Utrecht, the Netherlands). According to Central Bureau vor Schnimmelkulture, Trichophaea saccata CBS804.70 was isolated from coal spoil tip soil from Staffordshire, England in May 1968.

    [0149] According to Central Bureau vor Schnimmelkulture, Acremonium alcalophilum CBS 114.92 was isolated by A. Yoneda in 1984 from the sludge of pig faeces compost near Tsukui Lake, Japan.

    Media and Solutions

    [0150] YP+2% glucose medium was composed of 1% yeast extract, 2% peptone and 2% glucose.

    [0151] YP+2% maltodextrin medium was composed of 1% yeast extract, 2% peptone and 2% maltodextrin.

    [0152] PDA agar plates were composed of potato infusion (potato infusion was made by boiling 300 g of sliced (washed but unpeeled) potatoes in water for 30 minutes and then decanting or straining the broth through cheesecloth). Distilled water was then added until the total volume of the suspension was one liter, followed by 20 g of dextrose and 20 g of agar powder. The medium was sterilized by autoclaving at 15 psi for 15 minutes (Bacteriological Analytical Manual, 8th Edition, Revision A, 1998).

    [0153] LB plates were composed of 10 g of Bacto-Tryptone, 5 g of yeast extract, 10 g of sodium chloride, 15 g of Bacto-agar, and deionized water to 1 liter.

    [0154] LB medium was composed of 10 g of Bacto-Tryptone, 5 g of yeast extract, 10 g of sodium chloride, and deionized water to 1 liter.

    [0155] COVE sucrose plates were composed of 342 g of sucrose, 20 g of agar powder, 20 ml of COVE salts solution, and deionized water to 1 liter. The medium was sterilized by autoclaving at 15 psi for 15 minutes (Bacteriological Analytical Manual, 8th Edition, Revision A, 1998). The medium was cooled to 60° C. and 10 mM acetamide, 15 mM CsCl, TRITON® X-100 (50 μl/500 ml) were added.

    [0156] COVE salts solution was composed of 26 g of MgSO.sub.4.7H2O, 26 g of KCL, 26 g of KH2PO4, 50 ml of COVE trace metals solution, and deionized water to 1 liter.

    [0157] COVE trace metals solution was composed of 0.04 g of Na2B4O7.10H2O, 0.4 g of CuSO4.5H2O, 1.2 g of FeSO4.7H2O, 0.7 g of MnSO4.H2O, 0.8 g of Na2MoO4.2H2O, 10 g of ZnSO4.7H2O, and deionized water to 1 liter.

    Example 1: Cloning, Expression and Purification of the GH25 Muramidase from Acremonium alcalophilum CBS 114.92

    [0158] The GH25 muramidase from Acremonium alcalophilum CBS 114.92 (SEQ ID NO: 1) was cloned and expressed as described in example 8 and purified as described in example 5 of WO 2013/076253. Alternatively, SEQ ID NO: 10 can be cloned and expressed as described in example 2 of WO 2013/076253.

    Example 2: Expression of the GH24 Muramidase from Trichophaea saccata

    [0159] The fungal strain was cultivated in 100 ml of YP+2% glucose medium in 1000 ml Erlenmeyer shake flasks for 5 days at 20° C. Mycelia were harvested from the flasks by filtration of the medium through a Buchner vacuum funnel lined with MIRACLOTH® (EMD Millipore, Billerica, Mass., USA). Mycelia were frozen in liquid nitrogen and stored at −80° C. until further use. Genomic DNA was isolated using a DNEASY® Plant Maxi Kit (QIAGEN GMBH, Hilden Germany) according to the manufacturer's instructions.

    [0160] Genomic sequence information was generated by Illumina MySeq (Illumina Inc., San Diego, Calif.). 5 μgs of the isolated Trichophaea saccata genomic DNA was used for library preparation and analysis according to the manufacturer's instructions. A 100 bp, paired end strategy was employed with a library insert size of 200-500 bp. One half of a HiSeq run was used for the total of 95,744,298, 100 bp raw reads obtained. The reads were subsequently fractionated to 25% followed by trimming (extracting longest sub-sequences having Phred-scores of 10 or more). These reads were assembled using Idba version 0.19. Contigs shorter than 400 bp were discarded, resulting in 8,954,791,030 by with an N-50 of 10,035. Genes were called using GeneMark.hmm ES version 2.3c and identification of the catalytic domain was made using “Phage muramidase PF00959” Hidden Markov Model provided by Pfam. The polypeptide coding sequence for the entire coding region was cloned from Trichophaea saccata CBS804.70 genomic DNA by PCR using the primers F-80470 and R-80470 (SEQ ID NO: 6 and SEQ ID NO: 7 respectively) as described below.

    TABLE-US-00002 (SEQ ID NO: 6) 5′- ACACAACTGGGGATCCACCATGCACGCTCTCACCCTTCT -3′ (SEQ ID NO: 7) 5′- CTAGATCTCGAGAAGCTTTTAGCACTTGGGAGGGTGGG -3′

    [0161] Bold letters represent Trichophaea saccata enzyme coding sequence. Restriction sites are underlined. The sequence to the left of the restriction sites is homologous to the insertion sites of pDau109 (WO 2005/042735).

    [0162] Extensor HIFI PCR mix, 2× concentration (Thermo Scientific cat no AB-0795) was used for experiment.

    [0163] The amplification reaction (25 μl) was performed according to the manufacturer's instructions (Thermo Scientific cat no AB-0795) with the following final concentrations:

    [0164] PCR Mix:

    [0165] 0.5 μM Primer F-80470

    [0166] 0.5 μM Primer R-80470

    [0167] 12.5 μl Extensor HIFI PCR mix, 2× conc.

    [0168] 11.0 μl H2O

    [0169] 10 ng of Trichophaea saccata CBS804.70 genomic DNA.

    [0170] The PCR reaction was incubated in a DYAD® Dual-Block Thermal Cycler (BioRad, USA) programmed for 1 cycle at 94° C. for 30 seconds; 30 cycles each at 94° C. for 30 seconds, 52° C. for 30 seconds and 68° C. for 60 seconds followed by 1 cycle at 68° C. for 6 minutes. Samples were cooled to 10° C. before removal and further processing.

    [0171] Three μl of the PCR reaction were analyzed by 1% agarose gel electrophoresis using 40 mM Tris base, 20 mM sodium acetate, 1 mM disodium EDTA (TAE) buffer. A major band of about 946 bp was observed. The remaining PCR reaction was purified directly with an ILLUSTRA™ GFX™ PCR DNA and Gel Band Purification Kit (GE Healthcare, Piscataway, N.J., USA) according to the manufacturer's instructions.

    [0172] Two μg of plasmid pDau109 was digested with Bam HI and Hind III and the digested plasmid was run on a 1% agarose gel using 50 mM Tris base-50 mM boric acid-1 mM disodium EDTA (TBE) buffer in order to remove the stuffer fragment from the restricted plasmid. The bands were visualized by the addition of SYBR® Safe DNA gel stain (Life Technologies Corporation, Grand Island, N.Y., USA) and use of a 470 nm wavelength transilluminator. The band corresponding to the restricted plasmid was excised and purified using an ILLUSTRA™ GFX™ PCR DNA and Gel Band Purification Kit. The plasmid was eluted into 10 mM Tris pH 8.0 and its concentration adjusted to 20 ng per μl. An IN-FUSION® PCR Cloning Kit (Clontech Laboratories, Inc., Mountain View, Calif., USA) was used to clone the 983 bp PCR fragment into pDau109 digested with Bam HI and Hind III (20 ng). The IN-FUSION® total reaction volume was 10 μl. The IN-FUSION® total reaction volume was 10 μl. The IN-FUSION® reaction was transformed into FUSION-BLUE™ E. coli cells (Clontech Laboratories, Inc., Mountain View, Calif., USA) according to the manufacturer's protocol and plated onto LB agar plates supplemented with 50 μg of ampicillin per ml. After incubation overnight at 37° C., transformant colonies were observed growing under selection on the LB plates supplemented with 50 μg of ampicillin per ml.

    [0173] Several colonies were selected for analysis by colony PCR using the pDau109 vector primers described below. Four colonies were transferred from the LB plates supplemented with 50 μg of ampicillin per ml with a yellow inoculation pin (Nunc A/S, Denmark) to new LB plates supplemented with 50 μg of ampicillin per ml and incubated overnight at 37° C.

    TABLE-US-00003 Primer 8653: (SEQ ID NO: 8) 5′-GCAAGGGATGCCATGCTTGG-3′ Primer 8654: (SEQ ID NO: 9) 5′-CATATAACCAATTG000TC-3′

    [0174] Each of the three colonies were transferred directly into 200 μl PCR tubes composed of 5 μl of 2× Extensor HIFI PCR mix, (Thermo Fisher Scientific, Rockford, Ill., USA), 0.5 μl of primer 8653 (10 pm/μl), 0.5 μl of primer 8654 (10 pm/μl), and 4 μl of deionized water. Each colony PCR was incubated in a DYAD® Dual-Block Thermal Cycler programmed for 1 cycle at 94° C. for 60 seconds; 30 cycles each at 95° C. for 30 seconds, 60° C. for 45 seconds, 72° C. for 60 seconds, 68° C. for 10 minutes, and 10° C. for 10 minutes.

    [0175] Three μl of each completed PCR reaction were submitted to 1% agarose gel electrophoresis using TAE buffer. All four E. coli transformants showed a PCR band of about 980 bp. Plasmid DNA was isolated from each of the four colonies using a QIAprep Spin Miniprep Kit (QIAGEN GMBH, Hilden Germany). The resulting plasmid DNA was sequenced with primers 8653 and 8654 (SEQ ID NO: 8 and 9) using an Applied Biosystems Model 3730 Automated DNA Sequencer using version 3.1 BIG-DYE™ terminator chemistry (Applied Biosystems, Inc., Foster City, Calif., USA). One plasmid, designated pKKSC0312-2, was chosen for transforming Aspergillus oryzae MT3568. A. oryzae MT3568 is an amdS (acetamidase) disrupted gene derivative of Aspergillus oryzae JaL355 (WO 2002/40694) in which pyrG auxotrophy was restored by inactivating the A. oryzae amdS gene. Protoplasts of A. oryzae MT3568 were prepared according to the method described in European Patent, EP0238023, pages 14-15.

    [0176] E. coli 3701 containing pKKSC0312-2 was grown overnight according to the manufacturer's instructions (Genomed) and plasmid DNA of pKKSC0312-2 was isolated using a Plasmid Midi Kit (Genomed JETquick kit, cat.nr. 400250, GENOMED GmbH, Germany) according to the manufacturer's instructions. The purified plasmid DNA was transformed into Aspergillus oryzae MT3568. A. oryzae MT3568 protoplasts were prepared according to the method of Christensen et al., 1988, Bio/Technology 6: 1419-1422. The selection plates consisted of COVE sucrose with +10 mM acetamide+15 mM CsCl+TRITON® X-100 (50 μl/500 ml). The plates were incubated at 37° C. Briefly, 8 μl of plasmid DNA representing 3 ugs of DNA was added to 100 μl MT3568 protoplasts. 250 μl of 60% PEG solution was added and the tubes were gently mixed and incubate at 37° for 30 minutes. The mix was added to 10 ml of pre melted Cove top agarose (The top agarose melted and then the temperature equilibrated to 40 C in a warm water bath before being added to the protoplast mixture). The combined mixture was then plated on two Cove-sucrose selection petri plates with 10 mM Acetamide. The plates were incubated at 37° C. for 4 days. Single Aspergillus transformed colonies were identified by growth on plates using the selection Acetimide as a carbon source. Each of the four A. oryzae transformants were inoculated into 750 μl of YP medium supplemented with 2% glucose and also 750 μl of 2% maltodextrin and also DAP4C in 96 well deep plates and incubated at 37° C. stationary for 4 days. At the same time the four transformants were restreaked on COVE-2 sucrose agar medium.

    [0177] Culture broth from the Aspergillus oryzae transformants were then analyzed for production of the GH24 polypeptide by SDS-PAGE using NUPAGE® 10% Bis-Tris SDS gels (Invitrogen, Carlsbad, Calif., USA) according to the manufacturer's recommendations. A protein band at approximately 27 kDa was observed for each of the Aspergillus oryzae transformants. One A. oryzae transformant was cultivated in 1000 ml Erlenmeyer shake flasks containing 100 ml of DAP4C medium at 26° C. for 4 days with agitation at 85 rpm.

    Example 3: Purification of the GH24 Muramidase from Trichophaea saccata

    [0178] The fermentation supernatant with the GH24 muramidase from example 2 was filtered through a Fast PES Bottle top filter with a 0.22 μm cut-off. The resulting solution was diafiltrated with 5 mM Na-acetate, pH 4.5 and concentrated (volume reduced by a factor of 10) on an Ultra Filtration Unit (Sartorius) with a 10 kDa cut-off membrane.

    [0179] After pretreatment about 275 mL of the muramidase containing solution was purified by chromatography on SP Sepharose (approximately 60 mL) in a XK26 column eluting the bound muramidase with 0 to 100% gradient of buffer A (50 mM Na-acetate pH 4.5) and buffer B (50 mM Na-acetate+1 M NaCl pH 4.5) over 10 column volumes. The fractions from the column were pooled based on the chromatogram (absorption at 280 and 254 nm) and SDS-PAGE analysis.

    [0180] The molecular weight, as estimated from SDS-PAGE, was approximately 27 kDa and the purity was >90%.

    Example 4: Other Characteristics for the GH24 Muramidase from Trichophaea saccata

    [0181] Determination of the N-terminal sequence was: YPVKTDL.

    [0182] The calculated molecular weight from this mature sequence is 26205.5 Da (M+H).sup.+.

    [0183] The molecular weight determined by intact molecular weight analysis was 26205.3 Da. (M+H).sup.+.

    [0184] The mature sequence (from EDMAN N-terminal sequencing data, intact molecular weight analysis and proteomic analysis):

    TABLE-US-00004 (SEQ ID NO: 4) YPVKTDLHCRSSPSTSASIVRTYSSGTEVQIQCQTTGTSVQGSNVWDKTQ HGCYVADYYVKTGHSGIFTTKCGSSSGGGSCKPPPINAATVALIKEFEGF VPKPAPDPIGLPTVGYGHLCKTKGCKEVPYSFPLTQETATKLLQSDIKTF TSCVSNYVKDSVKLNDNQYGALASWAFNVGCGNVQTSSLIKRLNAGENPN TVAAQELPKWKYAGGKVMPGLVRRRNAEVALFKKPSSVQAHPPKC.

    Example 5: Determination of Muramidase Activity

    [0185] Muramidase activity was determined by measuring the decrease (drop) in absorbance/optical density of a solution of resuspended Micrococcus lysodeikticus ATTC No. 4698 (Sigma-Aldrich M3770) or Exiguobacterium undea (DSM14481) measured in a spectrophotometer at 540 nm.

    Preparation of Micrococcus lysodeikticus Substrate

    [0186] Before use the cells were resuspended in citric acid—phosphate buffer pH 6.5 to a concentration of 0.5 mg cells/mL and the optical density (OD) at 540 nm was measured. The cell suspension was then adjusted so that the cell concentration equalled an OD540=1.0. The adjusted cell suspension was then stored cold before use. Resuspended cells were used within 4 hours.

    Preparation of Dried Cells of Exiguobacterium undae Substrate

    [0187] A culture of E. undae (DSM14481) was grown in 100 mL LB medium (Fluka 51208, 25 g/L) in a 500 mL shake-flask at 30° C., 250 rpm overnight. The overnight culture was then centrifuged at 20° C. and 5000 g for 10 minutes, and the pellet was then washed twice with sterile milliQ water, and resuspended in Milli-Q water. The washed cells were centrifuged for 1 minute at 13000 rpm and as much as possible of the supernatant was decanted. The washed cells were dried in a vacuum centrifuge for 1 hour. The cell pellet was resuspended in citric acid—phosphate buffer pH 4, 5 or 6 so that the optical density (OD) at 540 nm=1.

    Measurement of Muramidase Antimicrobial Activity in the Turbidity Assay

    [0188] The muramidase sample to be measured was diluted to a concentration of 100-200 mg enzyme protein/L in citric acid—phosphate buffer pH 4, 5 or 6, and kept on ice until use. In a 96 well microtiterplate (Nunc) 200 μL of the substrate was added to each well, and the plate was incubated at 37° C. for 5 minutes in a VERSAmax microplate reader (Molecular Devices). Following incubation, the absorbance of each well was measured at 540 nm (start value). To start the activity measurement, 20 μL of the diluted muramidase sample was added to each substrate (200 μL) and kinetic measurement of absorbance at 540 nm was initiated for minimum 30 minutes up to 24 hours at 37° C. The measured absorbance at 540 nm was monitored for each well and over time a drop in absorbance is seen if the muramidase has muramidase activity. The results are presented in table 2 below.

    TABLE-US-00005 TABLE 2 Muramidase Activity against Micrococcus lysodeikticus and Exiguobacterium undea as measured by Optical Density Drop Micrococcus Exiguobacterium Muramidase lysodeikticus.sup.1 undae.sup.1 GH22 muramidase from Gallus gallus +++ (pH 6)   + (pH 6) (SEQ ID NO: 5) GH24 muramidase from Trichophaea ++ (pH 6) ++ (pH 6)   saccata (SEQ ID NO: 4) GH25 muramidase from A. alcalophilum   + (pH 4) + (pH 5) (SEQ ID NO: 1) .sup.1Means no effect; + means small effect; ++ means medium effect; +++ means large effect. The pH value in the brackets lists the assay pH based on muramidase-substrate combination.

    [0189] The data confirms that the GH22 muramidase from Gallus gallus, the GH24 muramidase from Trichophaea saccata and the GH25 muramidase from A. alcalophilum all have muramidase activity.

    Example 6: In Vivo Broiler Trial

    Materials and Methods

    [0190] The trial was performed at Poultry Research Center (CEIEPAv), National Autonomous University of Mexico (UNAM), located in Mexico City. The average annual temperature is 16° C. and 60% of RH.

    [0191] A total of 960 1-day-old male broiler chickens (Ross 308) were used in a completely randomized experimental design, with 4 treatments, 8 replicates per treatment, and 30 birds per pen. The broilers had free access to feed and water throughout the study.

    [0192] Each pen used new and disinfected wood shapes as litter, feeders and drinkers for baby chickens were used for the initial phase (5 days); and manual feeders and bell-shaped drinkers until the end of growing period. Initial heating was provided by one conventional gas heaters per pen, the temperature and relative moisture of the poultry house were recorded every day by digital thermohydrometers. The poultry house is made of masonry and has lateral manual curtains. General management of equipment and birds rearing were the same as used in the region's integrated farms.

    [0193] The treatments were established as follow:

    TABLE-US-00006 TABLE 7 The treatments were established as follow: Group name Description Dosage (LSU/kg feed) T1 Negative Control (NC) — T2 Muramidase Low 25 000 LSU/kg (309 mg/kg) T3 Muramidase RD 35 000 LSU/kg (433 mg/kg) *Muramidase has activity 80,800 LFU(F)/g

    [0194] Enzymes: RONOZYME® HiPhos GT a 100 ppm (commercial name, lot manufactured preemption date) were part of the diet composition and included at 1000 FYT/kg. Phosphorus level in the experimental diet was adjusted according to the phytate concentration in the ingredient. Ca:P ratio, close to 1.5:1.0.

    [0195] Anticoccidial program: From 1-21 days Nicarbazin 125 ppm and from 22-49 days Salinomycin 60 ppm.

    [0196] Vaccination program: At 10 days old, Newcastle vaccine, and Newcastle/Influenza were administered simultaneously by eye's drop and subcutaneous application. Another Newcastle vaccine at 28 days old by water administration.

    Experimental Diets

    [0197] The experimental diets (pre-starter, Stater, Grower and finisher phase) were based on sorghum, soybean meal and DDGS. The diets were prepared according to composition as shown in the table below:

    TABLE-US-00007 TABLE 8 composition of experimental Diets (Kg/Ton) Diets (Kg per Ton) Ingredients Pre-starter Starter Grower Finisher Sorghum 11.17% 608 628 609 662 Soy 48.17% 234 181 180 125 DDGS low fat 50 80 80 80 Canola 36.56% 50 50 50 50 Oil soy 17 26 45 46 Premix 41 35 36 37 Total 1,000 1,000 1,000 1,000 T1 T2 T3 Pre-starter premix D1-7 Limestone 338.45 338.45 338.45 MDCP 223.84 223.84 223.84 HCl Lys 98.52 98.52 98.52 NaHCO3 81.32 81.32 81.32 ROVIMIX polio 0312 69.77 69.77 69.77 DL-Met 75.33 75.33 75.33 Salt 39.55 39.55 39.55 Thr 25.86 25.86 25.86 Nicarmix 25% 11.63 11.63 11.63 Cosistac 12% 0.00 0.00 0.00 RONOZYME HIPHOS 2.33 2.33 2.33 GT broil FLORAFIL 30 g 0.00 0.00 0.00 Carophyll Red 0.00 0.00 0.00 Enradin F 80 0.00 0.00 0.00 Sipernat 32.21 32.21 32.21 Total 1,000 1,000 1,000 Starter premix D8-21 Limestone 287.30 287.30 287.30 MDCP 220.61 220.61 220.61 HCl Lys 124.83 124.83 124.83 NaHCO3 97.12 97.12 97.12 ROVIMIX polio 0312 83.33 83.33 83.33 DL-Met 78.28 78.28 78.28 Salt 40.83 40.83 40.83 Thr 29.38 29.38 29.38 Nicarmix 25% 13.89 13.89 13.89 Cosistac 12% 0.00 0.00 0.00 RONOZYME HIPHOS 2.78 2.78 2.78 GT broil FLORAFIL 30 g 0.00 0.00 0.00 Carophyll Red 0.00 0.00 0.00 Enradin F 80 0.00 0.00 0.00 Sipernat 21.65 21.65 21.65 Total 1,000 1,000 1,000 Starter premix D22-35 Limestone 334.54 309.13 309.13 MDCP 184.08 170.35 170.35 HCl Lys 98.41 90.28 90.28 NaHCO3 87.30 80.27 80.27 ROVIMIX pollo 0312 81.08 75.00 75.00 DL-Met 62.90 58.26 58.26 Salt 37.94 35.48 35.48 Thr 22.09 20.32 20.32 Nicarmix 25% 0.00 0.00 0.00 Cosistac 12% 13.51 12.50 12.50 RONOZYME HIPHOS 2.71 2.50 2.50 GT broil FLORAFIL 30 g 54.05 112.50 112.50 Carophyll Red 1.08 1.25 1.25 Enradin F 80 0.00 0.00 0.00 Sipernat 20.31 31.98 31.98 Total 1,000 1,000 1,000 Starter premix D36-49 Limestone 332.67 307.04 307.04 MDCP 141.75 131.24 131.24 HCl Lys 104.56 96.85 96.85 NaHCO3 91.67 84.62 84.62 ROVIMIX pollo 0312 83.33 76.92 76.92 DL-Met 59.25 55.11 55.11 Salt 37.78 34.94 34.94 Thr 23.29 21.89 21.89 Nicarmix 25% 0.00 0.00 0.00 Cosistac 12% 13.89 12.82 12.82 RONOZYME HIPHOS 2.78 2.57 2.57 GT broil FLORAFIL 30 g 83.33 1533.85 1533.85 Carophyll Red 1.11 1.54 1.54 Enradin F 80 0.00 0.00 0.00 Sipernat 24.58 20.62 20.62 Total 1,000 1,000 1,000

    [0198] Feed storage conditions: Each phase of feed was elaborated one week before the use and was storage at room temperature. The temperature of whole storing period was monitored (18 Celsius degrees).

    [0199] Addition of testing products: Appropriate amount of muramidase (LOW 309 g/ton and 433 g/ton) was added at each treatment premix to finish the feed manufacturing; this premix was added to the rest of ingredients according to table 8.

    Experimental Measurements and Procedures

    [0200] Pigmentation: This evaluation was done in all live birds at 21, 35 and 49 days old. As well as in carcass at 49 days before and after chilling. Values were taken with a Chroma meters (Model CR-400, Konica Minolta Sensing Inc., Osaka, Japan) previously calibrated on the standard white ceramic. Colour was expressed in terms of CIE values for lightness (L*), redness (a*), and yellowness (b*).

    [0201] Statistical Analysis:

    [0202] Before the statistical analysis percentage of mortality, percentage of carcass yield, and xanthophyll serum levels were transformed by root square and arcsine to achieve homogeneity of variance. Statistical analysis of the parameters body weight, weight gain, feed intake and feed conversion rate were performed according to standard least squares procedures appropriate for the study design and the characteristics of the data set and comprising outlier check, analysis of variance including comparisons of means.

    Results and Discussion

    [0203] The addition of pigments started at 21 days of age (the color and carotenoids serum concentration is given by diet ingredients). The yellowness (b* value) showed the highest pigmentation for muramidase treatment at 35 days old according with highest carotenoids high concentration. However, there is a discrepancy at 49 days of age, because the Enramycin showed the highest skin yellowness, but had the lowest carotenoids serum concentration. The second highest value of skin yellowness was for muramidase-high treatment with the highest carotenoids serum concentration (Table 9 and 10).

    [0204] In addition, all treatments showed low skin yellowness compared with commercial standards.

    TABLE-US-00008 TABLE 9 Effect of pigmentation with and without Muramidase at 35 and 49 days of age Pigmentation (b* value) TX 21D 35D 49D T1 −0.26 ± 0.09 5.77 ± 0.16 .sup.b 11.16 ± 0.25 .sup.b T2 −0.47 ± 0.10 6.19 ± 0.16 .sup.b 13.49 ± 0.25 .sup.a T3 −0.57 ± 0.10 7.26 ± 0.16 .sup.a 10.85 ± 0.25 .sup.b T4 −0.61 ± 010  6.99 ± 0.16 .sup.a 11.27 ± 0.26 .sup.b .sup.a, b Means the different superscripts within the columns indicate significant difference

    TABLE-US-00009 TABLE 10 Serum concentration carotenoids at 21, 35 and 49 days of age Carotenoids serum concentration TX 21D 35D 49D T1 2.0 ± 0.06 .sup.a 6.9 ± 0.5 12.1 ± 0.8 .sup.a T2 1.6 ± 0.06 .sup.b 7.9 ± 0.5  8.6 ± 0.8 .sup.b T3 1.9 ± 0.07 .sup.a 7.5 ± 0.5 11.2 ± 0.8 .sup.a T4 1.5 ± 0.06 .sup.b 8.0 ± 0.5 13.1 ± 0.8 .sup.a .sup.a, b Means the different superscripts within the columns indicate significant difference

    Conclusions

    [0205] The results obtained in the study showed that the inclusion of microbial muramidase, especially high amount of muramidase was effective in improving skin pigmentaton of broiler chickens.

    Example 7: Experiment In Vivo 2

    Experimental Design

    [0206] Local: Innovation & Applied Science Center, Mairinque—SP, Brazil (I&ASC-MQ).

    [0207] Date start: May 2016

    [0208] Date finish: June 2016

    Animal and Housing

    [0209] It was used 600 broilers, male, Ross, with one day of age, housed in boxes in a completely randomized design. Broilers raised in a fresh litter.

    [0210] Vaccination program: no vaccine was held during the test. The birds only received routine vaccines in the hatchery and anticoccidia vaccine for challenge.

    [0211] The birds were raised in a conventional Brazilian barn broiler, with electric and gas heater, fans, and management blinds, which allow the exchange of air and temperature control. Water and feed were available ad libitum.

    [0212] Housing: chicken floors: 32 floor pens of 2.2 m.sup.2 with 25 birds each. The birds were distributed in 3 treatments, 8 replicates with 25 birds each. Total of 200 birds per treatment. The trial period was 42 days.

    Treatments:

    [0213] 1—Negative Control (NC)=0 LSU(F)/kg of muramidase;

    [0214] 2—NC+25,000 LSU(F)/kg (466 mg/kg) of muramidase;

    [0215] 3—NC+35,000 LSU(F)/kg (653 mg/kg) of muramidase.

    Feeding and Treatments

    [0216] The experimental diets were formulated in according to practical conditions in Brazil, based on corn and soybean meal (initial, growth and finish phase), with phytase (RONOZYME® HiPhos GT)—addition of 1000 FYT/kg of feed and premix vitamin and mineral in commercial levels (Table 11).

    TABLE-US-00010 TABLE 11 Composition and nutrient contents of the basal experimental diets Starter Grower Finisher Ingredients (%) 1-21 days 22-35 days 36-42 days CORN 54.8000 55.8100 55.0500 SOYBEAN MEAL 33.3200 29.2300 26.2700 RICE BRAN 3.0000 6.0000 9.0000 SOYBEAN OIL 3.4100 4.7300 5.5000 MEAT BONE MEAL 4.0000 2.6400 2.6400 LIMESTONE 0.3800 0.4900 0.4500 SALT 0.3300 0.3500 0.3500 DL-METHIONINE 0.3100 0.2800 0.2600 L-LYSINE 0.1900 0.2100 0.2200 PX ROVIMIX AVES (DSM)* 0.1500 0.1500 0.1500 PX ROLIGOMIX AVES 0.0500 0.0500 0.0500 (DSM)** L-THREONINE 0.0500 0.0500 0.0500 HiPhos GT 0.0100 0.0100 0.0100 100.0000 100.0000 100.0000 Calculated analysis, % AMEn, kcal/kg 3100.0000 3200.0000 3250.0000 Crude Protein 22.0000 20.0000 19.0000 Calcium 0.9000 0.7700 0.7500 Av. P 0.4700 0.4000 0.4000 Lys dig 1.2000 1.1000 1.0500 Met dig 0.6000 0.5500 0.5200 AAS dig 0.8900 0.8100 0.7700 Thr dig 0.7800 0.7100 0.6800 Trp dig 0.2300 0.2100 0.2000 Arg dig 1.3800 1.2400 1.1700 Val dig 0.9100 0.8400 0.8000 Ether Extract 6.8800 8.4300 9.5500 Starch 39.1400 39.9500 39.7900 *PX ROVIMIX AVES (DSM): Vit. A 9,000,000 UI/kg; Vit. D3 2,500,000 UI/kg; Vit. E 20,000 U I/kg; Vit. K3 2,500 mg/kg; Vit. B1 2,000 mg/kg; Vit. B2 6,000 mg/kg; Pantotenic acid 12 g/kg; Vit. B6 3,000 mg/kg; Vit. B12 15,000 mcg/kg; Nicotinic acid 35 g/kg; Folic acid 1,500 mg/kg; Biotin 100 mg/kg; Selenium 250 mg per kg of premix. **PX ROLIGOMIX AVES (DSM): Iron 100 g/kg; Cooper 20 g/kg; Manganese 130 g/kg; Cobalt 2,000 mg/kg; Zinc 130 mg/kg; Iodine 2,000 mg per kg of premix.

    [0217] 4 ppm of Apo-ester in the broiler diet (40 mg/kg of CAROPHYLL® yellow 10%) were added to all treatments for measurement in serum, with 28 days of age, the total carotenoid content.

    Experimental Parameters and Analyses

    [0218] Total Carotenoids: [0219] It were added 4 ppm of Apo-ester in the broiler diet (40 mg/kg of CAROPHYLL® yellow 10%); [0220] It were collected blood with EDTA of at least 20 birds per treatment at 28 days of age; [0221] Measured total carotenoids content in iCheck™ Carotene.

    Statistical Analysis

    [0222] All data were analyzed using the GLM procedure of SAS statistical package and means were compared by the test of Tukey at 5% probability level. Where deemed necessary, non-parametric analyses were performed in the R environment for statistical computing (version 3.2.2).

    Results and Discussion

    [0223] Birds from 35,000 LSU(F)/kg muramidase diet had levels of total carotenoids in the blood greater than the negative control group. In 25,000 LSU(F)/kg muramidase group, the carotenoid levels were similar to other treatments (Table 12).

    TABLE-US-00011 TABLE 12 Carotenoid levels in the blood of birds at 28 days of age Negative 25.000 35.000 Control LSU/kg of LSU/kg of Treatments (NC) muramidase muramidase p-value CV % Total 3.57 b 3.97 ab 4.38 a 0.0055 20.83 Carotenoids (mg/L) Different letters in the same row differ by Tukey test (P < 0.05). CV = coefficient of variation.

    Conclusion

    [0224] In this trial, supplementation of muramidase led the significant improvement of carotenoids serum concentration.

    Example 8. Experiment In Vivo 3

    Location and Housing

    [0225] The experiment was performed at the Servei de Granges i Camps Experimentals of the Universitat Autònoma de Barcelona (UAB).

    [0226] Animals were housed in one single room with 16 floor pens (8 pens (1.5 m×1 m) at each side of the room). The environmental conditions (temperature, relative humidity and ventilation rates) were controlled according to the Ross broiler management guidelines. Animals were disposed of nipple drinkers (3 drinkers/pen) and manual pan feeders (1 pan/pen).

    Experimental Animals

    [0227] 408 one-day-old male broiler chickens (Ross 308) were used (30/pen). They were obtained from a local hatchery, weighed, wing-tagged individually, and allocated to dietary treatments in a completely randomized design. Animals were vaccinated in ovo against Gumboro and Marek and also against coccidiosis (Hypracox, coarse spray at 1 day) and bronchitis (fine spray) after birth.

    Experimental Groups

    [0228] Each pen was allocated to one of two experimental treatments: A control diet (T1) or the same diet including muramidase (T2).

    Feeding Program

    [0229] The basel experimental diets were formulated to meet or exceed the nutrient requirements recommended for Ross broiler chickens. The ingredients, mineral-vitamin premix, the calculated and actual analyses of the diets are presented in Table 13. The basal diets did not contain any enzymes or feed additives (other than Muramidase), coccidiostats, veterinary antibiotics or any other growth promoters. All diets included Carophyll Yellow (10%) at 60 mg/kg.

    TABLE-US-00012 TABLE 13 Composition and nutrient contents of the basal experimental diets Ingredients (%) Starter Grower Soybean meal 48% 34.97 27.23 Maize/Corn 23.71 31.30 Wheat 20.00 20.00 Rye 12.00 12.00 Soyabean oil 4.86 Dicalcium Phosphate 1.79 1.47 Calcium Carbonate 0.92 0.80 Sodium Chloride 0.40 0.36 Mineral-vitamin premix 0.30 0.30 DL-methionine 0.27 0.23 L-lysine 0.17 0.19 Choline Chloride 0.04 L-threonine 0.04 0.05 Ethoxyquin 66% 0.02 0.02 Fat 5 FYSFEED 5.54 Carophyll Yellow 0.006 0.006 TiO.sub.2 0.5 0.5 Calculated content Crude protein (g/kg) 221.8 190.3 Metabolizable energy (MJ/kg).sup.2 .sup.1 Mineral-Vitamin premix provided per kilogram of diet: Vitamin A: 10'000 IU.; vitamin E: 40 IU.; vitamin K3: 3.0 mg; vitamin C: 100 mg; vitamin B1: 2.50 mg; vitamin B2: 8.00 mg; vitamin B6: 5.00 mg; vitamin B12: 0.03 mg; niacin: 50.0 mg; pantothenate calcium: 12.0 mg; folic acid: 1.50 mg; biotin 0.15 mg; cholin: 450 mg; ethoxyquine: 54 mg; Na: 1.17 g; Mg: 0.8 g; Mn: 80 mg; Fe: 60 mg; Cu: 30 mg; Zn: 54 mg; I: 1.24 mg; Co: 0.6 mg; Se: 0.3 mg

    [0230] Animals were randomly allocated in two experimental treatments consisting of a balanced diet supplemented or not with muramidase at 35,000 LSU(F)/kg feed (534 mg muramidase/kg feed). During the experimental period the animals received two diets (starter from 0-21 days and grower from 21-35 days) the starter diet was in crumble form and the grower in pellet form. All diets included titanium dioxide (0.5%) as digestibility marker.

    Experimental Design

    [0231] On day 9, 21 birds per cage (randomly selected) were sacrificed and one pooled sample of blood (from 2-3 animals) up to reach 5 ml total volume was taken (on heparinized tubes) from each pen for carotenoids analysis.

    Analysis

    [0232] The plasma concentrations of carotenoids (lutein, zeaxanthin), vitamin A, E and sialic acid were determined by HPLC.

    Statistical Analysis

    [0233] The results are expressed as means with their standard errors unless otherwise stated. Data was analysed with ANOVA using the GLM procedure taking into account the experimental diets as main effect. When frequencies were analyzed the Fisher's exact test was used. All the statistical analysis were performed using the Statistical Analysis Software SAS version 9.2 (SAS Institute Inc.). The a level used for the determination of significance for all the analysis was P=0.05. The statistical trend was also considered for P values >0.05 and <0.10.

    Results and Discussion

    [0234] Results of Content of carotenoids, Vitamin A, Vitamin E and sialic acid in plasma from broiler chickens are shown in Table 14.

    TABLE-US-00013 TABLE 14 Content of carotenoids, Vitamin A, Vitamin E and sialic acid in plasma from broiler chickens at Day 9 T1 T2 p-value Zeaxanthin total 341.2 367.1 0.509 [ng/mL] Lutein total 490.8 535.6 0.472 [ng/mL] Vitamin A (as total retinol) 521.4 615.6 0.040 [ng/mL] Vitamin E (as α-tocopherol) 8456.3 8560.1 0.941 [ng/mL] Sialic acid (as total N- 213.9 232.4 0.056 acetylneuraminic acid) [μg/mL]

    [0235] The content of carotenoids and vitamins including vitamin A and vitamin E in plasma increased significantly at day 9 compared to the control group (T1).

    [0236] Sialic acid, an acetylated derivative of neuroaminic acid, is a terminal component of the nonreducing end of carbohydrate chains of glycoproteins and glycolipids. The concentration of SA increases rapidly following the inflammatory and injury process. This is the first time that sialic acid has been measured in healthy birds supplemented or not with muramidase. For both groups, the content of SA in plasma increased significantly at Day 9 while the group supplemented with muramidase increased more.

    CONCLUSION

    [0237] The results obtained in the study showed that the inclusion of microbial muramidase was effective in improving carotenoids serum concentration in broilder chickens.

    [0238] The invention described and claimed herein is not to be limited in scope by the specific aspects herein disclosed, since these aspects are intended as illustrations of several aspects of the invention. Any equivalent aspects are intended to be within the scope of this invention. Indeed, various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims. In the case of conflict, the present disclosure including definitions will control.