FN3 domain-siRNA conjugates and uses thereof

11781138 · 2023-10-10

Assignee

Inventors

Cpc classification

International classification

Abstract

The present disclosure relates to compositions, such as siRNA molecules and FN3 domains conjugated to the same, as well as methods of making and using the molecules.

Claims

1. A composition comprising a siRNA molecule comprising a sense strand and antisense strand, wherein: the sense strand comprises a sequence of SEQ ID NO: 12, 18, 24, 30, 34, 152, 154, 164, 170, 182, 212, 214, or 216; and the anti-sense strand comprises a sequence of SEQ ID NO: 13, 19, 25, 31, 35, 153, 155, 165, 171, 183, 213, 215, or 217.

2. The composition of claim 1, wherein the siRNA further comprises a linker, wherein the linker is covalently attached to the sense strand or the anti-sense strand of the siRNA.

3. The composition of claim 2, wherein the siRNA is linked to one or more FN3 domains.

4. The composition of claim 2, wherein the linker is covalently attached to the 3′ end of the sense strand.

5. The composition of claim 4, wherein the siRNA is linked to one or more FN3 domains.

6. The composition of claim 2, wherein the linker comprises a compound having the formula of: ##STR00014##

7. The composition of claim 6, wherein the siRNA is linked to one or more FN3 domains.

8. The composition of claim 1, wherein the siRNA further comprises a vinyl phosphonate, wherein the vinyl phosphonate is covalently attached to the sense strand or the anti-sense strand of the siRNA.

9. The composition of claim 8, wherein the siRNA is linked to one or more FN3 domains.

10. The composition of claim 8, wherein the vinyl phosphonate is covalently attached to the 5′ end of the antisense strand.

11. The composition of claim 10, wherein the siRNA is linked to one or more FN3 domains.

12. The composition of claim 1, wherein the siRNA further comprises a linker covalently attached to the 3′ end of the sense strand and a vinyl phosphonate covalently attached to the 5′ end of the antisense strand.

13. The composition of claim 12, wherein the siRNA is linked to one or more FN3 domains.

14. The composition of claim 12, wherein the siRNA molecule comprises: a sense strand of SEQ ID NO: 188 and an antisense strand of SEQ ID NO: 189; a sense strand of SEQ ID NO: 190 and an antisense strand of SEQ ID NO: 191; a sense strand of SEQ ID NO: 192 and an antisense strand of SEQ ID NO: 193; a sense strand of SEQ ID NO: 196 and an antisense strand of SEQ ID NO: 197; a sense strand of SEQ ID NO: 206 and an antisense strand of SEQ ID NO: 207; or a sense strand of SEQ ID NO: 210 and an antisense strand of SEQ ID NO: 211.

15. The composition of claim 12, wherein the sense strand comprises a sequence of SEQ ID NO: 188, 190, 192, 196, 206, or 210; and the anti-sense strand comprises a sequence of SEQ ID NO: 189, 191, 193, 197, 207, or 211.

16. The composition of claim 15, wherein the siRNA is linked to one or more FN3 domains.

17. The composition of claim 1, wherein the siRNA molecule comprises: a sense strand of SEQ ID NO: 12 and an antisense strand of SEQ ID NO: 13; a sense strand of SEQ ID NO: 18 and an antisense strand of SEQ ID NO: 19; a sense strand of SEQ ID NO: 24 and an antisense strand of SEQ ID NO: 25; a sense strand of SEQ ID NO: 30 and an antisense strand of SEQ ID NO: 31; a sense strand of SEQ ID NO: 34 and an antisense strand of SEQ ID NO: 35; a sense strand of SEQ ID NO: 152 and an antisense strand of SEQ ID NO: 153; a sense strand of SEQ ID NO: 154 and an antisense strand of SEQ ID NO: 155; a sense strand of SEQ ID NO: 164 and an antisense strand of SEQ ID NO: 165; a sense strand of SEQ ID NO: 170 and an antisense strand of SEQ ID NO: 171; a sense strand of SEQ ID NO: 182 and an antisense strand of SEQ ID NO: 183; a sense strand of SEQ ID NO: 212 and an antisense strand of SEQ ID NO: 213; a sense strand of SEQ ID NO: 214 and an antisense strand of SEQ ID NO: 215; or a sense strand of SEQ ID NO: 216 and an antisense strand of SEQ ID NO: 217.

18. The composition of claim 17, wherein the siRNA is linked to one or more FN3 domains.

19. The composition of claim 1, wherein the siRNA is linked to one or more FN3 domains.

20. A pharmaceutical composition comprising a composition of claim 19.

21. A method of treating cancer in a subject in need thereof, the method comprising administering to the subject the composition of claim 19.

22. A method of reducing the expression of KRAS in a cell, the method comprising contacting the cell with the composition of claim 19.

23. A method of delivering a siRNA that targets KRAS to a cell in a subject, the method comprising administering to the subject a pharmaceutical composition comprising the composition of claim 19.

24. A composition having a formula of (X1)n-(X2)q-(X3)y-L-X4, wherein: X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; L is a linker; and X4 is a nucleic acid molecule, wherein n, q, and y are each independently 0 or 1, and wherein the nucleic acid molecule comprises a siRNA molecule having: a sense strand comprising a sequence of SEQ ID NO: 12, 18, 24, 30, 34, 152, 154, 164, 170, 182, 188, 190, 192, 196, 206, 210, 212, 214, or 216; and an anti-sense strand comprising a sequence of SEQ ID NO: 13, 19, 25, 31, 35, 153, 155, 165, 171, 183, 189, 191, 193, 197, 207, 211, 213, 215, or 217.

25. The composition of claim 24, wherein L comprises a compound having the formula of: ##STR00015##

26. The composition of claim 24, wherein each of X1, X2, or X3 is linked by a linker, wherein the linker comprises a sequences of SEQ ID NO: 369, 370, 371, 372, 373, 374, 375, or 376.

27. The composition of claim 24, wherein X1 comprises a sequence of SEQ ID NO: 300-335, 337-368, 377-392, or 395-623.

28. The composition of claim 24, wherein X2 comprises a sequence of SEQ ID NO: 300-335, 337-368, 377-392, or 395-623.

29. The composition of claim 24, wherein X3 comprises a sequence of SEQ ID NO: 300-335, 337-368, 377-392, or 395-623.

30. A composition having a formula A1-B1, wherein A1 has a formula of C1-L1-XS and B1 has a formula of XAS-L2-F1, wherein: C1 is a polymer; L1 and L2 are each, independently, a linker; XS is a 5′ to 3′ oligonucleotide sense strand of a double stranded siRNA molecule comprising a sequence of SEQ ID NO: 12, 18, 24, 30, 34, 152, 154, 164, 170, 182, 188, 190, 192, 196, 206, 210, 212, 214, or 216; XAS is a 3′ to 5′ oligonucleotide antisense strand of a double stranded siRNA molecule comprising a sequence of SEQ ID NO: 13, 19, 25, 31, 35, 153, 155, 165, 171, 183, 189, 191, 193, 197, 207, 211, 213, 215, or 217; and F1 is a polypeptide comprising at least one FN3 domain.

31. The composition of claim 30, wherein A1-B1 has a formula of: ##STR00016##

32. The composition of claim 30, wherein F1 comprises a polypeptide having a formula of (X1)n-(X2)q-(X3)y, wherein X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; and wherein n, q, and y are each independently 0 or 1, provided that at least one of n, q, and y is 1.

33. The composition of claim 32, wherein X1 comprises a sequence of SEQ ID NO: 300-335, 337-368, 377-392, or 395-623.

34. The composition of claim 32, wherein X2 comprises a sequence of SEQ ID NO: 300-335, 337-368, 377-392, or 395-623.

35. The composition of claim 32, wherein X3 comprises a sequence of SEQ ID NO: 300-335, 337-368, 377-392, or 395-623.

36. The composition of claim 30, wherein the linker comprises a sequence of SEQ ID NO: 369, 370, 371, 372, 373, 374, 375, or 376.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 illustrates the knock-down of KRAS with a FN3-siRNA conjugate.

(2) FIG. 2 illustrates the inhibition of cellular proliferation of a FN3-siRNA conjugate.

(3) FIG. 3 illustrates various embodiments provided herein.

(4) FIG. 4, panels A and B, illustrates various embodiments provided herein.

(5) FIG. 5 illustrates various embodiments provided herein.

(6) FIG. 6 illustrates various embodiments provided herein.

(7) FIG. 7 illustrates various embodiments provided herein.

(8) FIG. 8 illustrates various embodiments provided herein.

(9) FIG. 9 illustrates various embodiments provided herein.

(10) FIG. 10 illustrates various embodiments provided herein.

(11) FIG. 11 illustrates various embodiments provided herein.

DETAILED DESCRIPTION OF THE DISCLOSURE

(12) As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a cell” includes a combination of two or more cells, and the like.

(13) “Fibronectin type III (FN3) domain” (FN3 domain) refers to a domain occurring frequently in proteins including fibronectins, tenascin, intracellular cytoskeletal proteins, cytokine receptors and prokaryotic enzymes (Bork and Doolittle, Proc Nat Acad Sci USA 89:8990-8994, 1992; Meinke et al., J Bacteriol 175:1910-1918, 1993; Watanabe et al., J Biol Chem 265:15659-15665, 1990). Exemplary FN3 domains are the 15 different FN3 domains present in human tenascin C, the 15 different FN3 domains present in human fibronectin (FN), and non-natural synthetic FN3 domains as described for example in U.S. Pat. No. 8,278,419. Individual FN3 domains are referred to by domain number and protein name, e.g., the 3.sup.rd FN3 domain of tenascin (TN3), or the 10.sup.th FN3 domain of fibronectin (FN10).

(14) The term “capture agent” refers to substances that bind to a particular type of cells and enable the isolation of that cell from other cells. Exemplary capture agents are magnetic beads, ferrofluids, encapsulating reagents, molecules that bind the particular cell type and the like.

(15) “Sample” refers to a collection of similar fluids, cells, or tissues isolated from a subject, as well as fluids, cells, or tissues present within a subject. Exemplary samples are tissue biopsies, fine needle aspirations, surgically resected tissue, organ cultures, cell cultures and biological fluids such as blood, serum and serosal fluids, plasma, lymph, urine, saliva, cystic fluid, tear drops, feces, sputum, mucosal secretions of the secretory tissues and organs, vaginal secretions, ascites fluids, fluids of the pleural, pericardial, peritoneal, abdominal and other body cavities, fluids collected by bronchial lavage, synovial fluid, liquid solutions contacted with a subject or biological source, for example, cell and organ culture medium including cell or organ conditioned medium and lavage fluids and the like.

(16) “Substituting” or “substituted” or “mutating” or “mutated” refers to altering, deleting of inserting one or more amino acids or nucleotides in a polypeptide or polynucleotide sequence to generate a variant of that sequence.

(17) “Variant” refers to a polypeptide or a polynucleotide that differs from a reference polypeptide or a reference polynucleotide by one or more modifications for example, substitutions, insertions or deletions.

(18) “Specifically binds” or “specific binding” refers to the ability of a FN3 domain to bind to its target, such as CD71, with a dissociation constant (K.sub.D) of about 1×10.sup.−6 M or less, for example about 1×10.sup.−7 M or less, about 1×10.sup.−8 M or less, about 1×10.sup.−9 M or less, about 1×10.sup.−10 M or less, about 1×10.sup.−11 M or less, about 1×10.sup.−12M or less, or about 1×10.sup.−13 M or less. Alternatively, “specific binding” refers to the ability of a FN3 domain to bind to its target (e.g. CD71) at least 5-fold above a negative control in standard ELISA assay. In some embodiments, a negative control is an FN3 domain that does not bind CD71. In some embodiment, an FN3 domain that specifically binds CD71 may have cross-reactivity to other related antigens, for example to the same predetermined antigen from other species (homologs), such as Macaca Fascicularis (cynomolgous monkey, cyno) or Pan troglodytes (chimpanzee).

(19) “Library” refers to a collection of variants. The library may be composed of polypeptide or polynucleotide variants.

(20) “Stability” refers to the ability of a molecule to maintain a folded state under physiological conditions such that it retains at least one of its normal functional activities, for example, binding to a predetermined antigen such as CD71.

(21) “CD71” refers to human CD71 protein having the amino acid sequence of SEQ ID NOs: 2 or 3. In some embodiments, SEQ ID NO: 2 is full length human CD71 protein. In some embodiments, SEQ ID NO: 3 is the extracellular domain of human CD71.

(22) “Tencon” refers to the synthetic fibronectin type III (FN3) domain having the sequence shown in SEQ ID NO:1 (SPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQTSTIIQE LEPGVEYFIRVFAILENKKSIPVSARVAT) and described in U.S. Pat. Publ. No. 2010/0216708.

(23) A “cancer cell” or a “tumor cell” refers to a cancerous, pre-cancerous or transformed cell, either in vivo, ex vivo, and in tissue culture, that has spontaneous or induced phenotypic changes that do not necessarily involve the uptake of new genetic material. Although transformation can arise from infection with a transforming virus and incorporation of new genomic nucleic acid, or uptake of exogenous nucleic acid, it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene. Transformation/cancer is exemplified by, e.g., morphological changes, immortalization of cells, aberrant growth control, foci formation, proliferation, malignancy, tumor specific markers levels, invasiveness, tumor growth or suppression in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo (Freshney, Culture of Animal Cells: A Manual of Basic Technique (3rd ed. 1994)).

(24) “Vector” refers to a polynucleotide capable of being duplicated within a biological system or that can be moved between such systems. Vector polynucleotides typically contain elements, such as origins of replication, polyadenylation signal or selection markers that function to facilitate the duplication or maintenance of these polynucleotides in a biological system. Examples of such biological systems may include a cell, virus, animal, plant, and reconstituted biological systems utilizing biological components capable of duplicating a vector. The polynucleotide comprising a vector may be DNA or RNA molecules or a hybrid of these.

(25) “Expression vector” refers to a vector that can be utilized in a biological system or in a reconstituted biological system to direct the translation of a polypeptide encoded by a polynucleotide sequence present in the expression vector.

(26) “Polynucleotide” refers to a synthetic molecule comprising a chain of nucleotides covalently linked by a sugar-phosphate backbone or other equivalent covalent chemistry. cDNA is a typical example of a polynucleotide.

(27) “Polypeptide” or “protein” refers to a molecule that comprises at least two amino acid residues linked by a peptide bond to form a polypeptide. Small polypeptides of less than about 50 amino acids may be referred to as “peptides”.

(28) “Valent” refers to the presence of a specified number of binding sites specific for an antigen in a molecule. As such, the terms “monovalent”, “bivalent”, “tetravalent”, and “hexavalent” refer to the presence of one, two, four and six binding sites, respectively, specific for an antigen in a molecule.

(29) “Subject” includes any human or nonhuman animal. “Nonhuman animal” includes all vertebrates, e g, mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows chickens, amphibians, reptiles, etc. Except when noted, the terms “patient” or “subject” are used interchangeably.

(30) “Isolated” refers to a homogenous population of molecules (such as synthetic polynucleotides or a polypeptide such as FN3 domains) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step. “Isolated FN3 domain” refers to an FN3 domain that is substantially free of other cellular material and/or chemicals and encompasses FN3 domains that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.

(31) In some embodiments, a composition comprising a polypeptide, such as a polypeptide comprising a FN3 domain, linked to a nucleic acid molecule are provided. The nucleic acid molecule can be, for example, a siRNA molecule.

(32) Accordingly, in some embodiments, the siRNA is a double-stranded RNAi (dsRNA) agent capable of inhibiting the expression of a target gene. The dsRNA agent comprises a sense strand and an antisense strand. In some embodiments, each strand of the dsRNA agent can range from 12-40 nucleotides in length. For example, each strand can be from 14-40 nucleotides in length, 17-37 nucleotides in length, 25-37 nucleotides in length, 27-30 nucleotides in length, 17-23 nucleotides in length, 17-21 nucleotides in length, 17-19 nucleotides in length, 19-25 nucleotides in length, 19-23 nucleotides in length, 19-21 nucleotides in length, 21-25 nucleotides in length, or 21-23 nucleotides in length.

(33) In some embodiments, the sense strand and antisense strand typically form a duplex dsRNA. The duplex region of a dsRNA agent may be from 12-40 nucleotide pairs in length. For example, the duplex region can be from 14-40 nucleotide pairs in length, 17-30 nucleotide pairs in length, 25-35 nucleotides in length, 27-35 nucleotide pairs in length, 17-23 nucleotide pairs in length, 17-21 nucleotide pairs in length, 17-19 nucleotide pairs in length, 19-25 nucleotide pairs in length, 19-23 nucleotide pairs in length, 19-21 nucleotide pairs in length, 21-25 nucleotide pairs in length, or 21-23 nucleotide pairs in length. In another example, the duplex region is selected from 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, and 27 nucleotide pairs in length.

(34) In some embodiments, the dsRNA comprises one or more overhang regions and/or capping groups of dsRNA agent at the 3′-end, or 5′-end or both ends of a strand. The overhang can be 1-10 nucleotides in length, 1-6 nucleotides in length, for instance 2-6 nucleotides in length, 1-5 nucleotides in length, 2-5 nucleotides in length, 1-4 nucleotides in length, 2-4 nucleotides in length, 1-3 nucleotides in length, 2-3 nucleotides in length, or 1-2 nucleotides in length. The overhangs can be the result of one strand being longer than the other, or the result of two strands of the same length being staggered. The overhang can form a mismatch with the target mRNA or it can be complementary to the gene sequences being targeted or can be other sequence. The first and second strands can also be joined, e.g., by additional bases to form a hairpin, or by other non-base linkers.

(35) In some embodiments, the nucleotides in the overhang region of the dsRNA agent can each independently be a modified or unmodified nucleotide including, but not limited to 2′-sugar modified, such as, 2-F 2′-Omethyl, thymidine (T), 2′-O-methoxyethyl-5-methyluridine (Teo), 2′-O-methoxyethyladenosine (Aeo), 2′-O-methoxyethyl-5-methylcytidine (m5Ceo), and any combinations thereof. For example, TT can be an overhang sequence for either end on either strand. The overhang can form a mismatch with the target mRNA or it can be complementary to the gene sequences being targeted or can be other sequence.

(36) The 5′- or 3′-overhangs at the sense strand, antisense strand or both strands of the dsRNA agent may be phosphorylated. In some embodiments, the overhang region contains two nucleotides having a phosphorothioate between the two nucleotides, where the two nucleotides can be the same or different. In one embodiment, the overhang is present at the 3′-end of the sense strand, antisense strand or both strands. In one embodiment, this 3′-overhang is present in the antisense strand. In one embodiment, this 3′-overhang is present in the sense strand.

(37) The dsRNA agent may comprise only a single overhang, which can strengthen the interference activity of the dsRNA, without affecting its overall stability. For example, the single-stranded overhang is located at the 3′-terminal end of the sense strand or, alternatively, at the 3′-terminal end of the antisense strand. The dsRNA may also have a blunt end, located at the 5′-end of the antisense strand (or the 3′-end of the sense strand) or vice versa. Generally, the antisense strand of the dsRNA has a nucleotide overhang at the 3′-end, and the 5′-end is blunt. While not bound by theory, the asymmetric blunt end at the 5′-end of the antisense strand and 3′-end overhang of the antisense strand favor the guide strand loading into RISC process. For example the single overhang comprises at least two, three, four, five, six, seven, eight, nine, or ten nucleotides in length.

(38) In some embodiments, the dsRNA agent may also have two blunt ends, at both ends of the dsRNA duplex.

(39) In some embodiments, every nucleotide in the sense strand and antisense strand of the dsRNA agent may be modified. Each nucleotide may be modified with the same or different modification which can include one or more alteration of one or both of the non-linking phosphate oxygens and/or of one or more of the linking phosphate oxygens; alteration of a constituent of the ribose sugar, e.g., of the 2 hydroxyl on the ribose sugar; wholesale replacement of the phosphate moiety with “dephospho” linkers; modification or replacement of a naturally occurring base; and replacement or modification of the ribose-phosphate backbone.

(40) In some embodiments all or some of the bases in a 3′ or 5′ overhang may be modified, e.g., with a modification described herein. Modifications can include, e.g., the use of modifications at the 2′ position of the ribose sugar with modifications that are known in the art, e.g., the use of deoxyribonucleotides, 2′-deoxy-2′-fluoro (2′-F) or 2′-O-methyl modified instead of the ribosugar of the nucleobase, and modifications in the phosphate group, e.g., phosphorothioate modifications. Overhangs need not be homologous with the target sequence.

(41) In some embodiments, each residue of the sense strand and antisense strand is independently modified with LNA, HNA, CeNA, 2′-methoxyethyl, 2′-O-methyl, 2′-O-allyl, 2′-C-allyl, 2′-deoxy, or 2′-fluoro. The strands can contain more than one modification. In one embodiment, each residue of the sense strand and antisense strand is independently modified with 2′-O-methyl or 2′-fluoro.

(42) In some embodiments, at least two different modifications are typically present on the sense strand and antisense strand. Those two modifications may be the 2′-deoxy, 2′-O-methyl or 2′-fluoro modifications, acyclic nucleotides or others.

(43) In one embodiment, the sense strand and antisense strand each comprises two differently modified nucleotides selected from 2′-fluoro, 2′-O-methyl or 2′-deoxy.

(44) The dsRNA agent may further comprise at least one phosphorothioate or methylphosphonate internucleotide linkage. The phosphorothioate or methylphosphonate internucleotide linkage modification may occur on any nucleotide of the sense strand or antisense strand or both in any position of the strand. For instance, the internucleotide linkage modification may occur on every nucleotide on the sense strand and/or antisense strand; each internucleotide linkage modification may occur in an alternating pattern on the sense strand or antisense strand; or the sense strand or antisense strand comprises both internucleotide linkage modifications in an alternating pattern. The alternating pattern of the internucleotide linkage modification on the sense strand may be the same or different from the antisense strand, and the alternating pattern of the internucleotide linkage modification on the sense strand may have a shift relative to the alternating pattern of the internucleotide linkage modification on the antisense strand.

(45) In some embodiments, the dsRNA agent comprises the phosphorothioate or methylphosphonate internucleotide linkage modification in the overhang region. For example, the overhang region comprises two nucleotides having a phosphorothioate or methylphosphonate internucleotide linkage between the two nucleotides. Internucleotide linkage modifications also may be made to link the overhang nucleotides with the terminal paired nucleotides within duplex region. For example, at least 2, 3, 4, or all the overhang nucleotides may be linked through phosphorothioate or methylphosphonate internucleotide linkage, and optionally, there may be additional phosphorothioate or methylphosphonate internucleotide linkages linking the overhang nucleotide with a paired nucleotide that is next to the overhang nucleotide. For instance, there may be at least two phosphorothioate internucleotide linkages between the terminal three nucleotides, in which two of the three nucleotides are overhang nucleotides, and the third is a paired nucleotide next to the overhang nucleotide. In some embodiments, these terminal three nucleotides may be at the 3′-end of the antisense strand.

(46) In some embodiments, the dsRNA composition is linked by a modified base or nucleoside analogue as described in U.S. Pat. No. 7,427,672, which is incorporated herein by reference. In some embodiments, the modified base or nucleoside analogue is referred to as the linker or L in formulas described herein.

(47) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and a salt thereof.

(48) ##STR00001##
where Base represents an aromatic heterocyclic group or aromatic hydrocarbon ring group optionally having a substituent, R.sub.1 and R.sub.2 are identical or different, and each represent a hydrogen atom, a protective group for a hydroxyl group for nucleic acid synthesis, an alkyl group, an alkenyl group, a cycloalkyl group, an aryl group, an aralkyl group, an acyl group, a sulfonyl group, a silyl group, a phosphate group, a phosphate group protected with a protective group for nucleic acid synthesis, or —P(R.sub.4)R.sub.5 where R.sub.4 and R.sub.5 are identical or different, and each represent a hydroxyl group, a hydroxyl group protected with a protective group for nucleic acid synthesis, a mercapto group, a mercapto group protected with a protective group for nucleic acid synthesis, an amino group, an alkoxy group having 1 to 5 carbon atoms, an alkylthio group having 1 to 5 carbon atoms, a cyanoalkoxy group having 1 to 6 carbon atoms, or an amino group substituted by an alky group having 1 to 5 carbon atoms, R.sub.3 represents a hydrogen atom, an alkyl group, an alkenyl group, a cycloalkyl group, an aryl group, an aralkyl group, an acyl group, a sulfonyl group, or a functional molecule unit substituent, and m denotes an integer of 0 to 2, and n denotes an integer of 1 to 3.

(49) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein R.sub.1 is a hydrogen atom, an aliphatic acyl group, an aromatic acyl group, an aliphatic or aromatic sulfonyl group, a methyl group substituted by one to three aryl groups, a methyl group substituted by one to three aryl groups having an aryl ring substituted by a lower alkyl, lower alkoxy, halogen, or cyano group, or a silyl group.

(50) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein R.sub.1 is a hydrogen atom, an acetyl group, a benzoyl group, a methanesulfonyl group, a p-toluenesulfonyl group, a benzyl group, a p-methoxybenzyl group, a trityl group, a dimethoxytrityl group, a monomethoxytrityl group, or a tert-butyldiphenylsilyl group.

(51) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein R.sub.2 is a hydrogen atom, an aliphatic acyl group, an aromatic acyl group, an aliphatic or aromatic sulfonyl group, a methyl group substituted by one to three aryl groups, a methyl group substituted by one to three aryl groups having an aryl ring substituted by a lower alkyl, lower alkoxy, halogen, or cyano group, a silyl group, a phosphoroamidite group, a phosphonyl group, a phosphate group, or a phosphate group protected with a protective group for nucleic acid synthesis.

(52) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein R.sub.2 is a hydrogen atom, an acetyl group, a benzoyl group, a methanesulfonyl group, a p-toluenesulfonyl group, a benzyl group, a p-methoxybenzyl group, a tert-butyldiphenylsilyl group, —P(OC.sub.2H.sub.4CN)(N(i-Pr).sub.2), —P(OCH.sub.3)(N(i-Pr).sub.2), a phosphonyl group, or a 2-chlorophenyl- or 4-chlorophenylphosphate group.

(53) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein R.sub.3 is a hydrogen atom, a phenoxyacetyl group, an alkyl group having 1 to 5 carbon atoms, an alkenyl group having 1 to 5 carbon atoms, an aryl group having 6 to 14 carbon atoms, a methyl group substituted by one to three aryl groups, a lower aliphatic or aromatic sulfonyl group such as a methanesulfonyl group or a p-toluenesulfonyl group, an aliphatic acyl group having 1 to 5 carbon atoms such as an acetyl group, or an aromatic acyl group such as a benzoyl group.

(54) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein the functional molecule unit substituent as R.sub.3 is a fluorescent or chemiluminescent labeling molecule, a nucleic acid incision activity functional group, or an intracellular or nuclear transfer signal peptide.

(55) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein Base is a purin-9-yl group, a 2-oxopyrimidin-1-yl group, or a purin-9-yl group or a 2-oxopyrimidin-1-yl group having a substituent selected from the following a group: a group: A hydroxyl group, a hydroxyl group protected with a protective group for nucleic acid synthesis, an alkoxy group having 1 to 5 carbon atoms, a mercapto group, a mercapto group protected with a protective group for nucleic acid synthesis, an alkylthio group having 1 to 5 carbon atoms, an amino group, an amino group protected with a protective group for nucleic acid synthesis, an amino group substituted by an alkyl group having 1 to 5 carbon atoms, an alkyl group having 1 to 5 carbon atoms, and a halogen atom.

(56) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein Base is 6-aminopurin-9-yl (i.e., adeninyl), 6-aminopurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2,6-diaminopurin-9-yl, 2-amino-6-chloropurin-9-yl, 2-amino-6-chloropurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-amino-6-fluoropurin-9-yl, 2-amino-6-fluoropurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-amino-6-bromopurin-9-yl, 2-amino-6-bromopurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-amino-6-hydroxypurin-9-yl (i.e., guaninyl), 2-amino-6-hydroxypurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 6-amino-2-methoxypurin-9-yl, 6-amino-2-chloropurin-9-yl, 6-amino-2-fluoropurin-9-yl, 2,6-dimethoxypurin-9-yl, 2,6-dichloropurin-9-yl, 6-mercaptopurin-9-yl, 2-oxo-4-amino-1,2-dihydropyrimidin-1-yl (i.e., cytosinyl), 2-oxo-4-amino-1,2-dihydropyrimidin-1-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-oxo-4-amino-5-fluoro-1,2-dihydropyrimidin-1-yl, 2-oxo-4-amino-5-fluoro-1,2-dihydropyrimidin-1-yl having the amino group protected with a protective group for nucleic acid synthesis, 4-amino-2-oxo-5-chloro-1,2-dihydropyrimidin-1-yl, 2-oxo-4-methoxy-1,2-dihydropyrimidin-1-yl, 2-oxo-4-mercapto-1,2-dihydropyrimidin-1-yl, 2-oxo-4-hydroxy-1,2-dihydropyrimidin-1-yl (i.e., uracinyl), 2-oxo-4-hydroxy-5-methyl-1,2-dihydropyrimidin-1-yl (i.e., thyminyl), 4-amino-5-methyl-2-oxo-1,2-dihydropyrimidin-1-yl (i.e., 5-methylcytosinyl), or 4-amino-5-methyl-2-oxo-1,2-dihydropyrimidin-1-yl having the amino group protected with a protective group for nucleic acid synthesis.

(57) In some embodiments, the modified base or nucleoside analogue has the structure as shown in Chemical Formula I and salts thereof, wherein m is 0, and n is 1.

(58) In some embodiments, the modified base or nucleoside analogue is a DNA oligonucleotide or RNA oligonucleotide analogue, containing one or two or more of one or more types of unit structures of nucleoside analogues having the structure as shown in Chemical Formula II, or a pharmacologically acceptable salt thereof, provided that a form of linking between respective nucleosides in the oligonucleotide analogue may contain one or two or more phosphorothioate bonds [—OP(O)(S.sup.−)O—] aside from a phosphodiester bond [—OP(O.sub.2.sup.−)O—] identical with that in a natural nucleic acid, and if two or more of one or more types of these structures are contained, Base may be identical or different between these structures:

(59) ##STR00002##
where Base represents an aromatic heterocyclic group or aromatic hydrocarbon ring group optionally having a substituent, R.sub.3 represents a hydrogen atom, an alkyl group, an alkenyl group, a cycloalkyl group, an aryl group, an aralkyl group, an acyl group, a sulfonyl group, a silyl group, or a functional molecule unit substituent, and m denotes an integer of 0 to 2, and n denotes an integer of 1 to 3.

(60) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein R.sub.1 is a hydrogen atom, an aliphatic acyl group, an aromatic acyl group, an aliphatic or aromatic sulfonyl group, a methyl group substituted by one to three aryl groups, a methyl group substituted by one to three aryl groups having an aryl ring substituted by a lower alkyl, lower alkoxy, halogen, or cyano group, or a silyl group.

(61) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein R.sub.1 is a hydrogen atom, an acetyl group, a benzoyl group, a methanesulfonyl group, a p-toluenesulfonyl group, a benzyl group, a p-methoxybenzyl group, a trityl group, a dimethoxytrityl group, a monomethoxytrityl group, or a tert-butyldiphenylsilyl group.

(62) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein R.sub.2 is a hydrogen atom, an aliphatic acyl group, an aromatic acyl group, an aliphatic or aromatic sulfonyl group, a methyl group substituted by one to three aryl groups, a methyl group substituted by one to three aryl groups having an aryl ring substituted by a lower alkyl, lower alkoxy, halogen, or cyano group, a silyl group, a phosphoroamidite group, a phosphonyl group, a phosphate group, or a phosphate group protected with a protective group for nucleic acid synthesis.

(63) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein R.sub.2 is a hydrogen atom, an acetyl group, a benzoyl group, a benzyl group, a p-methoxybenzyl group, a methanesulfonyl group, a p-toluenesulfonyl group, a tert-butyldiphenylsilyl group, —P(OC.sub.2H.sub.4CN)(N(i-Pr).sub.2), —P(OCH.sub.3)(N(i-Pr).sub.2), a phosphonyl group, or a 2-chlorophenyl- or 4-chlorophenylphosphate group.

(64) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein R.sub.3 is a hydrogen atom, a phenoxyacetyl group, an alkyl group having 1 to 5 carbon atoms, an alkenyl group having 1 to 5 carbon atoms, an aryl group having 6 to 14 carbon atoms, a methyl group substituted by one to three aryl groups, a lower aliphatic or aromatic sulfonyl group such as a methanesulfonyl group or a p-toluenesulfonyl group, an aliphatic acyl group having 1 to 5 carbon atoms such as an acetyl group, or an aromatic acyl group such as a benzoyl group.

(65) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein the functional molecule unit substituent as R.sub.3 is a fluorescent or chemiluminescent labeling molecule, a nucleic acid incision activity functional group, or an intracellular or nuclear transfer signal peptide.

(66) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein Base is a purin-9-yl group, a 2-oxopyrimidin-1-yl group, or a purin-9-yl group or a 2-oxopyrimidin-1-yl group having a substituent selected from the following a group: a group: A hydroxyl group, a hydroxyl group protected with a protective group for nucleic acid synthesis, an alkoxy group having 1 to 5 carbon atoms, a mercapto group, a mercapto group protected with a protective group for nucleic acid synthesis, an alkylthio group having 1 to 5 carbon atoms, an amino group, an amino group protected with a protective group for nucleic acid synthesis, an amino group substituted by an alkyl group having 1 to 5 carbon atoms, an alkyl group having 1 to 5 carbon atoms, and a halogen atom.

(67) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein Base is 6-aminopurin-9-yl (i.e. adeninyl), 6-aminopurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2,6-diaminopurin-9-yl, 2-amino-6-chloropurin-9-yl, 2-amino-6-chloropurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-amino-6-fluoropurin-9-yl, 2-amino-6-fluoropurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-amino-6-bromopurin-9-yl, 2-amino-6-bromopurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-amino-6-hydroxypurin-9-yl (i.e., guaninyl), 2-amino-6-hydroxypurin-9-yl having the amino group protected with a protective group for nucleic acid synthesis, 6-amino-2-methoxypurin-9-yl, 6-amino-2-chloropurin-9-yl, 6-amino-2-fluoropurin-9-yl, 2,6-dimethoxypurin-9-yl, 2,6-dichloropurin-9-yl, 6-mercaptopurin-9-yl, 2-oxo-4-amino-1,2-dihydropyrimidin-1-yl (i.e., cytosinyl), 2-oxo-4-amino-1,2-dihydropyrimidin-1-yl having the amino group protected with a protective group for nucleic acid synthesis, 2-oxo-4-amino-5-fluoro-1,2-dihydropyrimidin-1-yl, 2-oxo-4-amino-5-fluoro-1,2-dihydropyrimidin-1-yl group having the amino group protected with a protective group for nucleic acid synthesis, 4-amino-2-oxo-5-chloro-1,2-dihydropyrimidin-1-yl, 2-oxo-4-methoxy-1,2-dihydropyrimidin-1-yl, 2-oxo-4-mercapto-1,2-dihydropyrimidin-1-yl, 2-oxo-4-hydroxy-1,2-dihydropyrimidin-1-yl (i.e., uracinyl), 2-oxo-4-hydroxy-5-methyl-1,2-dihydropyrimidin-1-yl (i.e., thyminyl), 4-amino-5-methyl-2-oxo-1,2-dihydropyrimidin-1-yl (i.e., 5-methylcytosinyl), or 4-amino-5-methyl-2-oxo-1,2-dihydropyrimidin-1-yl having the amino group protected with a protective group for nucleic acid synthesis.

(68) In some embodiments, the oligonucleotide analogue or the pharmacologically acceptable salt thereof has the structure as shown in Chemical Formula II, wherein m is 0, and n is 1.

(69) In some embodiments, compositions described herein further comprises a polymer (polymer moiety C). In some instances, the polymer is a natural or synthetic polymer, consisting of long chains of branched or unbranched monomers, and/or cross-linked network of monomers in two or three dimensions In some instances, the polymer includes a polysaccharide, lignin, rubber, or polyalkylen oxide (e.g., polyethylene glycol). In some instances, the at least one polymer includes, but is not limited to, alpha-, omega-dihydroxylpolyethyleneglycol, biodegradable lactone-based polymer, e.g. polyacrylic acid, polylactide acid (PLA), poly(glycolic acid) (PGA), polypropylene, polystyrene, polyolefin, polyamide, polycyanoacrylate, polyimide, polyethylenterephthalat (PET, PETG), polyethylene terephthalate (PETE), polytetramethylene glycol (PTG), or polyurethane as well as mixtures thereof. As used herein, a mixture refers to the use of different polymers within the same compound as well as in reference to block copolymers. In some cases, block copolymers are polymers wherein at least one section of a polymer is build up from monomers of another polymer. In some instances, the polymer comprises polyalkylene oxide. In some instances, the polymer comprises PEG. In some instances, the polymer comprises polyethylene imide (PEI) or hydroxy ethyl starch (HES).

(70) In some instances, C is a PEG moiety. In some instances, the PEG moiety is conjugated at the 5′ terminus of the nucleic acid molecule while the binding moiety is conjugated at the 3′ terminus of the nucleic acid molecule. In some instances, the PEG moiety is conjugated at the 3′ terminus of the nucleic acid molecule while the binding moiety is conjugated at the 5′ terminus of the nucleic acid molecule. In some instances, the PEG moiety is conjugated to an internal site of the nucleic acid molecule. In some instances, the PEG moiety, the binding moiety, or a combination thereof, are conjugated to an internal site of the nucleic acid molecule. In some instances, the conjugation is a direct conjugation. In some instances, the conjugation is via native ligation.

(71) In some embodiments, the polyalkylene oxide (e.g., PEG) is a polydispers or monodispers compound. In some instances, polydispers material comprises disperse distribution of different molecular weight of the material, characterized by mean weight (weight average) size and dispersity. In some instances, the monodisperse PEG comprises one size of molecules. In some embodiments, C is poly- or monodispersed polyalkylene oxide (e.g., PEG) and the indicated molecular weight represents an average of the molecular weight of the polyalkylene oxide, e.g., PEG, molecules.

(72) In some embodiments, the molecular weight of the polyalkylene oxide (e.g., PEG) is about 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3250, 3350, 3500, 3750, 4000, 4250, 4500, 4600, 4750, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 10,000, 12,000, 20,000, 35,000, 40,000, 50,000, 60,000, or 100,000 Da.

(73) In some embodiments, C is polyalkylene oxide (e.g., PEG) and has a molecular weight of about 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3250, 3350, 3500, 3750, 4000, 4250, 4500, 4600, 4750, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 10,000, 12,000, 20,000, 35,000, 40,000, 50,000, 60,000, or 100,000 Da. In some embodiments, C is PEG and has a molecular weight of about 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3250, 3350, 3500, 3750, 4000, 4250, 4500, 4600, 4750, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 10,000, 12,000, 20,000, 35,000, 40,000, 50,000, 60,000, or 100,000 Da. In some instances, the molecular weight of C is about 200 Da. In some instances, the molecular weight of C is about 300 Da. In some instances, the molecular weight of C is about 400 Da. In some instances, the molecular weight of C is about 500 Da. In some instances, the molecular weight of C is about 600 Da. In some instances, the molecular weight of C is about 700 Da. In some instances, the molecular weight of C is about 800 Da. In some instances, the molecular weight of C is about 900 Da. In some instances, the molecular weight of C is about 1000 Da. In some instances, the molecular weight of C is about 1100 Da. In some instances, the molecular weight of C is about 1200 Da. In some instances, the molecular weight of C is about 1300 Da. In some instances, the molecular weight of C is about 1400 Da. In some instances, the molecular weight of C is about 1450 Da. In some instances, the molecular weight of C is about 1500 Da. In some instances, the molecular weight of C is about 1600 Da. In some instances, the molecular weight of C is about 1700 Da. In some instances, the molecular weight of C is about 1800 Da. In some instances, the molecular weight of C is about 1900 Da. In some instances, the molecular weight of C is about 2000 Da. In some instances, the molecular weight of C is about 2100 Da. In some instances, the molecular weight of C is about 2200 Da. In some instances, the molecular weight of C is about 2300 Da. In some instances, the molecular weight of C is about 2400 Da. In some instances, the molecular weight of C is about 2500 Da. In some instances, the molecular weight of C is about 2600 Da. In some instances, the molecular weight of C is about 2700 Da. In some instances, the molecular weight of C is about 2800 Da. In some instances, the molecular weight of C is about 2900 Da. In some instances, the molecular weight of C is about 3000 Da. In some instances, the molecular weight of C is about 3250 Da. In some instances, the molecular weight of C is about 3350 Da. In some instances, the molecular weight of C is about 3500 Da. In some instances, the molecular weight of C is about 3750 Da. In some instances, the molecular weight of C is about 4000 Da. In some instances, the molecular weight of C is about 4250 Da. In some instances, the molecular weight of C is about 4500 Da. In some instances, the molecular weight of C is about 4600 Da. In some instances, the molecular weight of C is about 4750 Da. In some instances, the molecular weight of C is about 5000 Da. In some instances, the molecular weight of C is about 5500 Da. In some instances, the molecular weight of C is about 6000 Da. In some instances, the molecular weight of C is about 6500 Da. In some instances, the molecular weight of C is about 7000 Da. In some instances, the molecular weight of C is about 7500 Da. In some instances, the molecular weight of C is about 8000 Da. In some instances, the molecular weight of C is about 10,000 Da. In some instances, the molecular weight of C is about 12,000 Da. In some instances, the molecular weight of C is about 20,000 Da. In some instances, the molecular weight of C is about 35,000 Da. In some instances, the molecular weight of C is about 40,000 Da. In some instances, the molecular weight of C is about 50,000 Da. In some instances, the molecular weight of C is about 60,000 Da. In some instances, the molecular weight of C is about 100,000 Da.

(74) In some embodiments, the polyalkylene oxide (e.g., PEG) is a discrete PEG, in which the discrete PEG is a polymeric PEG comprising more than one repeating ethylene oxide units. In some instances, a discrete PEG (dPEG) comprises from 2 to 60, from 2 to 50, or from 2 to 48 repeating ethylene oxide units. In some instances, a dPEG comprises about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 35, 40, 42, 48, 50 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 2 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 3 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 4 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 5 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 6 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 7 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 8 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 9 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 10 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 11 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 12 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 13 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 14 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 15 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 16 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 17 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 18 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 19 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 20 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 22 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 24 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 26 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 28 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 30 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 35 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 40 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 42 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 48 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 50 or more repeating ethylene oxide units. In some cases, a dPEG is synthesized as a single molecular weight compound from pure (e.g., about 95%, 98%, 99%, or 99.5%) staring material in a step-wise fashion. In some cases, a dPEG has a specific molecular weight, rather than an average molecular weight. In some cases, a dPEG described herein is a dPEG from Quanta Biodesign, LMD.

(75) In some embodiments, the dsRNA agent comprises mismatch(es) with the target, within the duplex, or combinations thereof. The mismatch can occur in the overhang region or the duplex region. The base pair can be ranked on the basis of their propensity to promote dissociation or melting (e.g., on the free energy of association or dissociation of a particular pairing, the simplest approach is to examine the pairs on an individual pair basis, though next neighbor or similar analysis can also be used). In terms of promoting dissociation: A:U is preferred over G:C; G:U is preferred over G:C; and I:C is preferred over G:C (I=inosine). Mismatches, e.g., non-canonical or other than canonical pairings (as described elsewhere herein) are preferred over canonical (A:T, A:U, G:C) pairings; and pairings which include a universal base are preferred over canonical pairings.

(76) In some embodiments, the dsRNA agent can comprise a phosphorus-containing group at the 5′-end of the sense strand or antisense strand. The 5′-end phosphorus-containing group can be 5′-end phosphate (5′-P), 5′-end phosphorothioate (5′-PS), 5′-end phosphorodithioate (5′-PS.sub.2), 5′-end vinylphosphonate (5′-VP), 5′-end methylphosphonate (MePhos), or 5′-deoxy-5′-C-malonyl. When the 5′-end phosphorus-containing group is 5′-end vinylphosphonate (5′-VP), the 5′-VP can be either 5′-E-VP isomer, such as trans-vinylphosphate or cis-vinylphosphate, or mixtures thereof. Representative structures of these modifications can be found in, for example, U.S. Pat. No. 10,233,448, which is hereby incorporated by reference in its entirety.

(77) In some embodiments, the dsRNA agents are 5′ phosphorylated or include a phosphoryl analog at the 5′ prime terminus. 5′-phosphate modifications include those which are compatible with RISC mediated gene silencing. Suitable modifications include: 5′-monophosphate ((HO.sub.2(O)P—O-5′); 5′-diphosphate ((HO).sub.2(O)P—O—P(HO)(O)—O-5′); 5′-triphosphate ((HO).sub.2(O)P—O—(HO)(O)P—O—P(HO)(O)—O-5′); 5′-guanosine cap (7-methylated or non-methylated) (7m-G-O-5′-(HO)(O)P—O—(HO)(O)P—O—P(HO)(O)—O-5′); 5′-adenosine cap (Appp), and any modified or unmodified nucleotide cap structure (N—O-5′-(HO)(O)P—O—(HO)(O)P—O—P(HO)(O)—O-5′); 5′-monothiophosphate (phosphorothioate; (HO).sub.2(S)P—O-5′); 5′-monodithiophosphate (phosphorodithioate; (HO)(HS)(S)P—O-5′), 5′-phosphorothiolate ((HO).sub.2(O)P—S-5′); any additional combination of oxygen/sulfur replaced monophosphate, diphosphate and triphosphates (e.g. 5′-alpha-thiotriphosphate, 5′-gamma-thiotriphosphate, etc.), 5′-phosphoramidates ((HO).sub.2(O)P—NH-5′, (HO)(NH.sub.2)(O)P—O-5′), 5′-alkylphosphonates (R=alkyl=methyl, ethyl, isopropyl, propyl, etc., e.g. RP(OH)(O)—O-5′-, 5′-alkenylphosphonates (i.e. vinyl, substituted vinyl), (OH).sub.2(O)P-5′-CH2-), 5′-alkyletherphosphonates (R=alkylether=methoxymethyl (MeOCH2-), ethoxymethyl, etc., e.g. RP(OH)(O)—O-5′-). In some embodiments, the modification can in placed in the antisense strand of a dsRNA agent.

(78) In some embodiments, the antisense strand of the dsRNA agent is 100% complementary to a target RNA to hybridize thereto and inhibits its expression through RNA interference. The target RNA can be any RNA expressed in a cell. In another embodiment, the antisense strand of the dsRNA agent is at least 99%, at least 98%, at least 97%, at least 96%, 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, or at least 50% complementary to a target RNA. In some embodiments, the target RNA is KRAS RNA. In some embodiments, the target RNA is NRAS or HRAS. In some embodiments, the siRNA targets KRAS but does not significantly target NRAS or HRAS. In some embodiments, the siRNA molecule is a siRNA that reduces the expression of KRAS and does not significantly reduce the expression of HRAS and NRAS. In some embodiments, the siRNA molecule is a siRNA that reduces the expression of KRAS and does not reduce the expression of HRAS and NRAS by more than 50% in an assay described herein at a concentration of no more than 200 nm as described herein.

(79) The siRNA can be targeted against any gene or RNA (e.g. mRNA) transcript of interest. In some embodiments, the KRAS transcript that is targeted can have a substitution that would encode a G12C, G12V, G12S and G12D mutation in the KRAS protein. Accordingly, in some embodiments, the siRNA targets a KRAS transcript that encodes for a KRAS mutant protein comprising a G12C, G12V, G12S and/or G12D mutation (substitution).

(80) Other modifications and patterns of modifications can be found in, for example, U.S. Pat. No. 10,233,448, which is hereby incorporated by reference.

(81) In some embodiments the siRNA is linked to a protein, such as a FN3 domain The siRNA can be linked to multiple FN3 domains that bind to the same target protein or different target proteins.

(82) In some embodiments, compositions are provided herein having a formula of (X1).sub.n-(X2).sub.q-(X3).sub.y-L-X4, wherein X1 is a first FN3 domain, X2 is second FN3 domain, X3 is a third FN3 domain or half-life extender molecule, L is a linker, and X4 is a nucleic acid molecule, such as, but not limited to a siRNA molecule, wherein n, q, and y are each independently 0 or 1. In some embodiments, X1, X2, and X3 bind to different target proteins. In some embodiments, y is 0. In some embodiments, n is 1, q is 0, and y is 0. In some embodiments, n is 1, q is 1, and y is 0. In some embodiments, n is 1, q is 1, and y is 1. In some embodiments, the third FN3 domain increases the half-life of the molecule as a whole as compared to a molecule without X3. In some embodiments, the half-life extending moiety is a FN3 domain that binds to albumin Examples of such FN3 domains include, but are not limited to, those described in U.S. Patent Application Publication No. 20170348397 and U.S. Pat. No. 9,156,887, which is hereby incorporated by reference in its entirety. The FN3 domains may incorporate other subunits for example via covalent interaction. In some embodiments, the FN3 domains further comprise a half-life extending moiety. Exemplary half-life extending moieties are albumin, albumin variants, albumin-binding proteins and/or domains, transferrin and fragments and analogues thereof, and Fc regions Amino acid sequences of the human Fc regions are well known, and include IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE Fc regions. In some embodiments, the FN3 domains may incorporate a second FN3 domain that binds to a molecule that extends the half-life of the entire molecule, such as, but not limited to, any of the half-life extending moieties described herein. In some embodiments, the second FN3 domain binds to albumin, albumin variants, albumin-binding proteins and/or domains, and fragments and analogues thereof.

(83) In some embodiments, compositions are provided herein having a formula of (X1)-(X2)-L-(X4), wherein X1 is a first FN3 domain, X2 is second FN3 domain, L is a linker, and X4 is a nucleic acid molecule. In some embodiments, X4 is a siRNA molecule. In some embodiments, X1 is a FN3 domain that binds to one of CD71, EGFR, or EpCAM. In some embodiments, X2 is a FN3 domain that binds to one of CD71, EGFR, or EpCAM. In some embodiments X1 and X2 do not bind to the same target protein. In some embodiments, X1 and X2 bind to the same target protein, but at different binding sites on the protein. In some embodiments, X1 and X2 bind to the same target protein. In some embodiments, X1 and X2 are FN3 domains that bind to CD71. In some embodiments, X1 and X2 are FN3 domains that bind to EpCAM. In some embodiments, X1 is a FN3 domain that binds to CD71 and X2 is a FN3 domain that binds to EpCAM. In some embodiments, X1 is a FN3 domain that binds to EpCAM and X2 is a FN3 domain that binds to CD71. In some embodiments, any of the FN3 domains listed above or herein can be replaced or substituted with a FN3 domain that binds to EGFR. Non-limiting examples of EGFR FN3 binding domains are provided herein and can also be found in U.S. Pat. No. 9,695,228, which is hereby incorporated by reference in its entirety. In some embodiments, the composition does not comprise (e.g. is free of) a compound or protein that binds to ASGPR.

(84) In some embodiments, compositions or complexes are provided having a formula of A.sub.1-B.sub.1, wherein A.sub.1 has a formula of C-L.sub.1-X.sub.s and B.sub.1 has a formula of X.sub.AS-L.sub.2-F.sub.1, wherein: C is a polymer, such as PEG; L.sub.1 and L.sub.2 are each, independently, a linker; X.sub.S is a 5′ to 3′ oligonucleotide sense strand of a double stranded siRNA molecule; X.sub.AS is a 3′ to 5′ oligonucleotide antisense strand of a double stranded siRNA molecule; F.sub.1 is a polypeptide comprising at least one FN3 domain; wherein X.sub.S and X.sub.AS form a double stranded oligonucleotide molecule to form the composition/complex.

(85) In some embodiments, the sense strand is a sense strand as provided for herein.

(86) In some embodiments, the antisense strand is an antisense strand as provided for herein.

(87) In some embodiments, the sense and antisense strand form a double stranded siRNA molecule that targets RAS, such as KRAS. In some embodiments, the double stranded oligonucleotide is about 21-23 nucleotides base pairs in length.

(88) In some embodiments, C is a natural or synthetic polymer, consisting of long chains of branched or unbranched monomers, and/or cross-linked network of monomers in two or three dimensions In some instances, the polymer includes a polysaccharide, lignin, rubber, or polyalkylen oxide, which can be for example, polyethylene glycol. In some instances, the at least one polymer includes, but is not limited to, alpha-, omega-dihydroxylpolyethyleneglycol, biodegradable lactone-based polymer, e.g. polyacrylic acid, polylactide acid (PLA), poly(glycolic acid) (PGA), polypropylene, polystyrene, polyolefin, polyamide, polycyanoacrylate, polyimide, polyethylenterephthalat (PET, PETG), polyethylene terephthalate (PETE), polytetramethylene glycol (PTG), or polyurethane as well as mixtures thereof. As used herein, a mixture refers to the use of different polymers within the same compound as well as in reference to block copolymers. In some cases, block copolymers are polymers wherein at least one section of a polymer is build up from monomers of another polymer. In some instances, the polymer comprises polyalkylene oxide. In some instances, the polymer comprises PEG. In some instances, the polymer comprises polyethylene imide (PEI) or hydroxy ethyl starch (HES).

(89) In some embodiments, the polyalkylene oxide (e.g., PEG) is a polydispers or monodispers compound. In some instances, polydispers material comprises disperse distribution of different molecular weight of the material, characterized by mean weight (weight average) size and dispersity. In some instances, the monodisperse PEG comprises one size of molecules. In some embodiments, C is poly- or monodispersed polyalkylene oxide (e.g., PEG) and the indicated molecular weight represents an average of the molecular weight of the polyalkylene oxide, e.g., PEG, molecules.

(90) In some embodiments, the molecular weight of the polyalkylene oxide (e.g., PEG) is about 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3250, 3350, 3500, 3750, 4000, 4250, 4500, 4600, 4750, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 10,000, 12,000, 20,000, 35,000, 40,000, 50,000, 60,000, or 100,000 Da.

(91) In some embodiments, C is polyalkylene oxide (e.g., PEG) and has a molecular weight of about 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3250, 3350, 3500, 3750, 4000, 4250, 4500, 4600, 4750, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 10,000, 12,000, 20,000, 35,000, 40,000, 50,000, 60,000, or 100,000 Da. In some embodiments, C is PEG and has a molecular weight of about 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3250, 3350, 3500, 3750, 4000, 4250, 4500, 4600, 4750, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 10,000, 12,000, 20,000, 35,000, 40,000, 50,000, 60,000, or 100,000 Da. In some instances, the molecular weight of C is about 200 Da. In some instances, the molecular weight of C is about 300 Da. In some instances, the molecular weight of C is about 400 Da. In some instances, the molecular weight of C is about 500 Da. In some instances, the molecular weight of C is about 600 Da. In some instances, the molecular weight of C is about 700 Da. In some instances, the molecular weight of C is about 800 Da. In some instances, the molecular weight of C is about 900 Da. In some instances, the molecular weight of C is about 1000 Da. In some instances, the molecular weight of C is about 1100 Da. In some instances, the molecular weight of C is about 1200 Da. In some instances, the molecular weight of C is about 1300 Da. In some instances, the molecular weight of C is about 1400 Da. In some instances, the molecular weight of C is about 1450 Da. In some instances, the molecular weight of C is about 1500 Da. In some instances, the molecular weight of C is about 1600 Da. In some instances, the molecular weight of C is about 1700 Da. In some instances, the molecular weight of C is about 1800 Da. In some instances, the molecular weight of C is about 1900 Da. In some instances, the molecular weight of C is about 2000 Da. In some instances, the molecular weight of C is about 2100 Da. In some instances, the molecular weight of C is about 2200 Da. In some instances, the molecular weight of C is about 2300 Da. In some instances, the molecular weight of C is about 2400 Da. In some instances, the molecular weight of C is about 2500 Da. In some instances, the molecular weight of C is about 2600 Da. In some instances, the molecular weight of C is about 2700 Da. In some instances, the molecular weight of C is about 2800 Da. In some instances, the molecular weight of C is about 2900 Da. In some instances, the molecular weight of C is about 3000 Da. In some instances, the molecular weight of C is about 3250 Da. In some instances, the molecular weight of C is about 3350 Da. In some instances, the molecular weight of C is about 3500 Da. In some instances, the molecular weight of C is about 3750 Da. In some instances, the molecular weight of C is about 4000 Da. In some instances, the molecular weight of C is about 4250 Da. In some instances, the molecular weight of C is about 4500 Da. In some instances, the molecular weight of C is about 4600 Da. In some instances, the molecular weight of C is about 4750 Da. In some instances, the molecular weight of C is about 5000 Da. In some instances, the molecular weight of C is about 5500 Da. In some instances, the molecular weight of C is about 6000 Da. In some instances, the molecular weight of C is about 6500 Da. In some instances, the molecular weight of C is about 7000 Da. In some instances, the molecular weight of C is about 7500 Da. In some instances, the molecular weight of C is about 8000 Da. In some instances, the molecular weight of C is about 10,000 Da. In some instances, the molecular weight of C is about 12,000 Da. In some instances, the molecular weight of C is about 20,000 Da. In some instances, the molecular weight of C is about 35,000 Da. In some instances, the molecular weight of C is about 40,000 Da. In some instances, the molecular weight of C is about 50,000 Da. In some instances, the molecular weight of C is about 60,000 Da. In some instances, the molecular weight of C is about 100,000 Da.

(92) In some embodiments, the polyalkylene oxide (e.g., PEG) is a discrete PEG, in which the discrete PEG is a polymeric PEG comprising more than one repeating ethylene oxide units. In some instances, a discrete PEG (dPEG) comprises from 2 to 60, from 2 to 50, or from 2 to 48 repeating ethylene oxide units. In some instances, a dPEG comprises about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 35, 40, 42, 48, 50 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 2 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 3 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 4 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 5 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 6 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 7 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 8 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 9 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 10 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 11 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 12 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 13 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 14 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 15 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 16 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 17 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 18 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 19 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 20 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 22 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 24 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 26 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 28 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 30 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 35 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 40 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 42 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 48 or more repeating ethylene oxide units. In some instances, a dPEG comprises about 50 or more repeating ethylene oxide units. In some cases, a dPEG is synthesized as a single molecular weight compound from pure (e.g., about 95%, 98%, 99%, or 99.5%) staring material in a step-wise fashion. In some cases, a dPEG has a specific molecular weight, rather than an average molecular weight. In some cases, a dPEG described herein is a dPEG from Quanta Biodesign, LMD.

(93) In some embodiments, L.sub.1 is any linker that can be used to link the polymer C to the sense strand X.sub.S. In some embodiments, L.sub.1 has a formula of:

(94) ##STR00003##

(95) In some embodiments, L.sub.2 is any linker that can be used to link the polypeptide of F.sub.1 to the antisense strand X.sub.AS. In some embodiments, L.sub.2 has a formula of in the complex of:

(96) ##STR00004##
wherein X.sub.AS and F.sub.1 are as defined above. In some embodiments, the linker is covalently attached to F1 through a cysteine residue present on F1, which can be illustrated as follows:

(97) ##STR00005##
In some embodiments, A1-B1 has a formula of:

(98) ##STR00006##

(99) wherein C.sub.1 is the polymer C, such as PEG as provided for herein, X.sub.S is a 5′ to 3′ oligonucleotide sense strand of a double stranded siRNA molecule; X.sub.AS is a 3′ to 5′ oligonucleotide antisense strand of a double stranded siRNA molecule; and F.sub.1 is a polypeptide comprising at least one FN3 domain, wherein X.sub.S and X.sub.AS form a double stranded siRNA molecule.

(100) In some embodiments, F.sub.1 comprises polypeptide having a formula of (X.sub.1).sub.n-(X.sub.2).sub.q-(X.sub.3).sub.y, wherein X.sub.1 is a first FN3 domain; X.sub.2 is second FN3 domain; X.sub.3 is a third FN3 domain or half-life extender molecule; wherein n, q, and y are each independently 0 or 1, provided that at least one of n, q, and y is 1. In some embodiments, n, q, and y are each 1. In some embodiments, n and q are 1 and y is 0. In some embodiments n and y are 1 and q is 0.

(101) In some embodiment X.sub.1 is a CD71 FN3 binding domain, such as one provided herein. In some embodiments, X.sub.2 is a CD71 FN3 binding domain. In some embodiments, X1 and X.sub.2 are different CD71 FN3 binding domains In some embodiments, the binding domains are the same. In some embodiments, X.sub.3 is a FN3 domain that binds to human serum albumin In some embodiments, X.sub.3 is a Fc domain without effector function that extends the half-life of a protein. In some embodiments, X.sub.1 is a first CD71 binding domain, X.sub.2 is a second CD71 binding domain, and X.sub.3 is a FN3 albumin binding domain. In some embodiments, X.sub.2 is an EPCAM binding domain instead of a second CD71 binding domain. In some embodiments, X1 is an EPCAM binding FN3 domain, X2 is a CD71 FN3 binding domain, and X3 is an albumin FN3 binding domain. Examples of such polypeptides are provided herein and below. In some embodiments, compositions are provided herein having a formula of C—(X1).sub.n-(X2).sub.q-(X3).sub.y-L-X4, wherein C is a polymer; X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; L is a linker; and X4 is a nucleic acid molecule, wherein n, q, and y are each independently 0 or 1.

(102) In some embodiments, compositions are provided herein having a formula of (X1).sub.n-(X2).sub.q-(X3).sub.y-L-X4-C, wherein X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; L is a linker; X4 is a nucleic acid molecule; and C is a polymer, wherein n, q, and y are each independently 0 or 1.

(103) In some embodiments, compositions are provided herein having a formula of X4-L-(X1).sub.n-(X2).sub.q-(X3).sub.y, wherein X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; L is a linker; and X4 is a nucleic acid molecule, wherein n, q, and y are each independently 0 or 1.

(104) In some embodiments, compositions are provided herein having a formula of C—X4-L-(X1).sub.n-(X2).sub.q-(X3).sub.y, wherein C is a polymer; X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; L is a linker; and X4 is a nucleic acid molecule, wherein n, q, and y are each independently 0 or 1.

(105) In some embodiments, compositions are provided herein having a formula of X4-L-(X1).sub.n-(X2).sub.q-(X3).sub.y-C, wherein X1 is a first FN3 domain; X2 is second FN3 domain; X3 is a third FN3 domain or half-life extender molecule; L is a linker; X4 is a nucleic acid molecule; and C is a polymer, wherein n, q, and y are each independently 0 or 1.

(106) In some embodiments, the siRNA molecule comprises a sequence pair from Table 1.

(107) TABLE-US-00001 Table 1 siRNA Sense and Anti-sense sequences SEQ Sense SEQ Anti-sense siRNA ID Strand ID strand Pair NO 5′-3′ NO 5′-3′ A 10 cscsUfgucUf 11 UfsGfsaauauc CfUfugGfaua caagaGfacagg uUfca(invdT) susu B 12 CsasGfcuaAf 13 UfsAfsugauuc UfUfcaGfaau ugaauUfagcug cAfua (invdT) susu C 14 GsasAfuuaGf 15 UfsUfsgacgau CfufguAfucg acagcUfaauuc uCfaa (invdT) susu D 16 CfscsUfgUfc 17 usGfsaAfuAfU UfCfUfuGfga fCfcAfagaGfa uAfuUfcAf CfaGfgsUfsu (invdT) E 18 csAfsgCfuAf 19 usAfsuGfaUfU aUfUfCfaGfa fCfuGfaauUfa auCfuAfuAf GfcUfgsUfsu (invdt) F 20 GfsasAfuUfa 21 usUfsgAfcGf GfCfUfgUfau AfUfacaGfcU cGfuCfaAf faAfuUfcsUf (invdt) su G 22 CfscsUfgUfc 23 usGfsaAfuAfu UfcUfuGfgAf CfcAfaGfaGfa uAfuUfcAf CfaGfgsUfsu (invdT) H 24 csAfsgCfuAf 25 UfsasUfgAfuU aUfuCfaGfaA fcUfgAfaUfuA fuCfaUfa fgCfgsUfsu (invdt) I 26 gsAfsaUfuA 27 UfsusGfaCfaU fgCfuGfuAfu faCfaGfeUfa CfgUfcAfa AfuUfcsUfsu (invdt) J 28 cscsUfgucUf 29 UfsGfsaauauc CfUfugGfaua caagaGfacag uUfca(invdt) gsusu K 30 CsasGfcuaAf 31 UfsAfsugauu UfUfcaGfaau cugaauUfagc cAfua(invdt) ugsusu L 32 gsasAfuuaGf 33 UfsUfsgacgau CfUfguAfucg acagcUfaauuc uCfaa(invdt) susu M 34 CsasGfcuaAf 35 UfsAfsugauuc UfUfcaGfaau ugaauUfagcug cAfua(invdT) susu N 36 asusAfuaaAf 37 UfsAfscuacca CfUfugUfggu caaguUfuauau aGfua(invdT) susu O 38 usasAfacuUf 39 UfsCfscaacua GfUfggUfagu ccacaAfguuua uGfga(invdT) susu P 40 csasAfgagUf 41 UfsAfsucguca GfCfcuUfgac aggcaCfucuug gAfua(invdT) susu Q 42 gscsCfuugAf 43 UfsUfsagcugu CfGfauAfcag aucguCfaaggc cUfaa(invdT) susu R 44 usgsAfcgaUf 45 UfsGfsaauuag AfCfagCfuaa cuguaUfcguca uUfca(invdT) susu S 46 csgsAfuacAfG 47 UfsUfscugaauu fCfuaAfuuc agcuGfuaucgsu aGfaa(invdT) su T 48 gsusGfgacGf 49 UfsUfsggauca AfAfuaUfgau uauucGfuccac cCfaa(invdT) susu U 50 gsgsAfcgaAf 51 UfsGfsuuggau UfAfugAfucc cauauUfcgucc aAfca(invdT) susu V 52 gsasCfgaaUf 53 UfsUfsguugga AfUfgaUfcca ucauaUfucguc aCfaa(invdT) susu W 54 ascsGfaauAf 55 UfsUfsuguugg UfGfauCfcaa aucauAfuucgu cAfaa(invdT) susu X 56 csgsAfauaUf 57 UfsAfsuuguug GfAfucCfaac gaucaUfauucg aAfua(invdT) susu Y 58 asasUfaugAf 59 UfsCfsuauugu UfCfcaAfcaa uggauCfauauu uAfga(invdT) susu Z 60 gsasUfccaAf 61 UfsAfsuccucua CfAfauAfgag uuguUfggaucsu gAfua(invdT) su AA 62 cscsAfacaAf 63 UfsGfsgaauccu UfAfgaGfgau cuauUfguuggs uCfca(invdT) usu BB 64 csusAfcagGf 65 UfsAfscuacuug AfAfgcAfagu cuucCfuguags aGfua(invdT) usu CC 66 ascsAfggaAf 67 UfsUfsuacuacu GfCfaaGfuag ugcuUfccugusu uAfaa(invdT) su DD 68 gsusAfauuGf 69 UfsGfsguuucuc AfUfggAfgaa caucAfauuacsu aCfca(invdT) su EE 70 csusUfggaUf 71 UfsGfsugucgag AfUfucUfcga aauaUfccaagsu cAfca(invdT) su FF 72 csasGfcagGf 73 UfsAfscuccucu UfCfaaGfagg ugacCfugcugsu aGfua(invdT) su GG 74 gscsAfaugAf 75 UfsGfsuacuggu GfGfgaCfcag cccuCfauugcsu uAfca(invdT) su HH 76 csasAfugaGf 77 UfsUfsguacugg GfGfacCfagu ucccUfcauugsu aCfaa(invdT) su II 78 ususUfgugUf 79 UfsUfsuauggca AfUfuuGfcca aauaCfacaaasu uAfaa(invdT) su JJ 80 ususGfccaUf 81 UfsUfsaguauua AfAfauAfaua uuuaUfggcaasu cUfaa(invdT) su KK 82 usgsCfcauAf 83 UfsUfsuaguauu AfAfuaAfuac auuuAfuggcasu uAfaa(invdT) su LL 84 cscsAfuaaAf 85 UfsAfsuuuagua UfAfauAfcua uuauUfuauggsu aAfua(invdT) su MM 86 csasUfaaaUf 87 UfsGfsauuuagu AfAfuaCfuaaa auuaUfuuaugsu Ufca(invdT) su NN 88 asusAfaauAf 89 UfsUfsgauuuag AfUfacUfaaa uauuAfuuuausu uCfaa(invdT) su OO 90 gsasAfgauAf 91 UfsAfsuaauggu UfUfcaCfcau gaauAfucuucsu uAfua(invdT) su PP 92 asgsAfuauUf 93 UfsCfsuauaaug CfAfccAfuua gugaAfuaucusu uAfga(invdT) su QQ 94 asusAfuucAf 95 UfsCfsucuauaa CfCfauUfaua ugguGfaauausu gAfga(invdT) su RR 96 asgsAfacaAf 97 UfsAfscucuuu AfUfuaAfaag uaauuUfguucu aGfua(invdT) susu SS 98 gsasCfucuGf 99 UfsAfsgguaca AfAfgaUfgua ucuucAfgaguc cCfua(invdT) susu TT 100 csusGfaagAf 101 UfsCfscauagg UfGfuaCfcua uacauCfuucag uGfga(invdT) susu UU 102 asgsAfacaGf 103 UfsUfsuuugug UfAfgaCfacaa ucuacUfguucu Afaa(invdT) susu VV 104 csasGfgacUf 105 UfsAfscuucuu UfAfgcAfaga gcuaaGfuccug aGfua(invdT) susu WW 106 gsusUfgauGf 107 UfsAfsuagaag AfUfgcCfuuc gcaucAfucaac uAfua(invdT) susu XX 108 asusGfaugCf 109 UfsAfsuguaua CfUfucUfaua gaaggCfaucau cAfua(invdT) susu YY 110 usgsAfugcCf 111 UfsAfsauguau UfUfcuAfuac agaagGfcauca aUfua(invdT) susu ZZ 112 gsasUfgccUf 113 UfsUfsaaugua UfCfuaUfaca uagaaGfgcauc uUfaa(invdT) susu AAA 114 asusGfccuUf 115 UfsCfsuaaugu CfUfauAfcau auagaAfggcau uAfga(invdT) susu BBB 116 csusUfcuaUf 117 UfsCfsgaacua AfCfauUfagu auguaUfagaag uCfga(invdT) susu CCC 118 UscsUfauaCf 119 UfsCfsucgaac AfUfuaGfuuc uaaugUfauaga gAfga(invdT) susu DDD 120 UsasUfacaUf 121 UfsUfsucucga UfAfguUfcga acuaaUfguaua gAfaa(invdT) susu EEE 122 AsusAfcauUf 123 UfsUfsuucucg AfGfuuCfga aacuaAfuguau gaAfaa(invdT) susu FFF 124 UsasCfauuAf 125 UfsAfsuuucuc GfUfucGfaga gaacuAfaugua aAfua(invdT) susu GGG 126 UsusAfguuCf 127 UfsUfscgaauu GfAfgaAfau ucucgAfacuaa ucGfaa(invdT) susu HHH 128 AsgsUfucgAf 129 UfsUfsuucgaa GfAfaaUfuc uuucuCfgaacu gaAfaa(invdT) susu III 130 AsgsAfaauUf 131 UfsUfsuauguu CfGfaaAfaca uucgaAfuuucu uAfaa(invdT) susu JJJ 132 GsasAfauuCf 133 UfsUfsuuaugu GfAfaaAfcau uuucgAfauuuc aAfaa(invdT) susu KKK 134 AsasAfuucGf 135 UfsCfsuuuaug AfAfaaCfaua uuuucGfaauuu aAfga(invdT) susu LLL 136 AsasUfucgAf 137 UfsUfscuuuau AfAfacAfuaa guuuuCfgaauu aGfaa(invdT) susu MMM 138 AsusGfagcAf 139 UfsUfsuuacca AfAfgaUfgg ucuuuGfcucau uaAfaa(invdT) susu NNN 140 AsgsCfaaaGf 141 UfsCfsuuuuua AfUfggUfaaa ccaucUfuugcu aAfga(invdT) sus u OOO 142 AsusUfucuGfU 143 UfsAfsaacccc fCfuuGfgg aagacAfgaaau guUfua(invdT) susu PPP 144 GsgsGfuuuUf 145 UfsUfsgcaug UfGfguGfca caccaaAfaac ugCfaa(invdT) ccsusu QQQ 146 CsgsCfacaAf 147 UfsUfsaccca GfGfcaCfugg gugccuUfgug gUfaa(invdT) cgsusu RRR 148 GscsAfcaaGf 149 UfsAfsuaccc GfCfacUfggg agugccUfugug uAfua(invdT) csusu SSS 150 csUfsCfUfuG 151 usGfsasAfsu fgauAfuUfc sAfUfCfcAfag Af(invdT) aGfaCfaGfgsU fsu TTT 152 AfsasUfUfCf 153 usAfsusGfsas aGfaauCfuAf UfUfCfuGfaau uAf(invdt) UfaGfcUfgsUf su UUU 154 AfsasUfUfCf 155 usAfsusGfsas aGfaauCfuAf UfUfCfuGfaau uAf(invdt) UfaGfcUfgsUf su VVV 156 csUfscUfuGf 157 usGfsaAfsusAf gAfuAfuUfc suCfcAfaGfaG Af(invdT) faCfaGfgsUfsu- WWW 158 AfsasUfuCfa 159 UfsasUfsgsAfs GfaAfuCfaUf uUfcUfgAfaUfu a(invdt) AfgCfgsUfsu XXX 160 AfsgsCfuGfu 161 UfsusGfsasCfs AfuCfgUfcAf aUfaCfaGfcUfa a(invdt) AfuUfcsUfsu YYY 162 csUfsCfUfug 163 UfsGfsasasusa GfauauUfca uccaagaGfacag (invdt)- gsusu ZZZ 164 asAfsUfUfca 165 UfsAfsusgsasu GfaaucAfua ucugaauUfagcu (invdt) gsusu AAAA 166 asGfsCfUfgu 167 UfsUfsgsascsga AfucguCfaa uacagcUfaauucs (invdt) usu BBBB 168 CfscsUfgUfc 169 usGfsaAfuAfUf UfCfUfuGfga CfcAfagaGfaCf uAfgUfcAf aGfgsUfsu (invdT)- CCCC 170 csAfsgCfuAf 171 usAfsuGfaUfUf aUfUfCfaGfa CfuGfaauUfaGf auCfgAfuAf cUfgsUfsu- (invdt)- DDDD 172 GfsasAfuUf 173 usUfsgAfcGfAf aGfUfgUfau UfacaGfcUfaAf cGfgCfaAf uUfcsUfsu- (invdt) EEEE 174 CfscsUfgUf 175 usGfsaAfuAfuC cUfcUfuGfg fcAfaGfaGfaCf AfuAfgUfcA aGfgsUfsu f(invdT)- FFFF 176 csAfsgCfuA 177 UfsasUfgAfuUf faUfuCfaGf cUfgAfaUfuAfg aAfgCfaUfa CfgsUfsu (invdt) GGGG 178 gsAfsaUfuA 179 UfsusGfaCfaUf fgCfuGfuAf aCfaGfcUfaAfu uCfgUfcAfa UfcsUfsu (invdt) HHHH 180 cscsUfgucU 181 UfsGfsaauaucc fCfUfugGfa aagaGfacaggsu uagUfca su (invdt) IIII 182 csasGfcuaA 183 UfsAfsugauucu fUfUfcaGfa gaauUfagcugsu agcAfua su (invdt) JJJJ 184 gsasAfuuaG 185 UfsUfsgacgaua fCfUfguAfu cagcUfaauucsu cggCfaa su (invdt) KKKK 212 CcsAcsrGrC 213 (vinyl-p)sAfs rUrArArUrUr uGfaUfUfCfuGf CrArGrArArU aauUfaGfcUfgU rCrAsTcsAc fsasUf LLLL 214 CfsasGfcUfa 215 (vinyl-p)- AfUfUfcAfga sAfsuGfaUfUfC aUfcAfua fuGfaauUfaGfc UfgUfsasUf MMMM 216 csasrGrCrUr 217 (vinyl-p) ArArUrUrCrA sAfsuGfaUf rGrArArUrCr UfCfuGfaauU Asusa faGfcUfgUfs asUf Abbreviations Key: n = 2′-O-methyl re sidues, Nf = 2′-F residues, rN = unmodified residue, Nc = 2′,4′-BNAnc (2′-O,4′-C-aminomethylene bridged nucleic acid), s = phosphorothioate, (invdt) = inverted Dt, vinyl-p: (E)-vinylphosphonate, (n/N = anynucleotide)

(108) As described herein, in some embodiments, the nucleic acid molecules can be modified to include a linker at the 5′ end of the of the sense strand of the dsRNA. In some embodiments, the nucleic acid molecules can be modified to include a vinyl phosphonate at the 5′ end of the of the anti-sense strand of the dsRNA. In some embodiments, the nucleic acid molecules can be modified to include a linker at the 3′ end of the of the sense strand of the dsRNA. In some embodiments, the nucleic acid molecules can be modified to include a vinyl phosphonate at the 3′ end of the of the anti-sense strand of the dsRNA. The linker can be used to link the dsRNA to the FN3 domain. The linker can covalently attach, for example, to a cysteine residue on the FN3 domain that is there naturally or that has been substituted as described herein, and for example, in U.S. Pat. No. 10,196,446, which is hereby incorporated by reference in its entirety. Non-limiting examples of such modified strands of the dsRNA are illustrated in Table 2.

(109) TABLE-US-00002 TABLE 2 Pairs with Linker and/or vinyl phosphonate SEQ SEQ ID ID NO Sense 5′-3′ NO Antisense 5′-3′ Linker AB01 186 L- 187 (vinyl-p)- mal- cscsUfgucUfCfUfugGfaua UfsGfsaauauccaagaGfa NH—(CH.sub.2).sub.6— uUfca(invdT) caggsusu AB02 188 L- 189 (vinyl-p)- mal- csasGfcuaAfUfUfcaGfaauc UfsAfsugauucugaauUf NH—(CH.sub.2).sub.6— Afua(invdT) agcugsusu AB03 190 CfsasGfcUfaAfUfUfcAfga 191 (vinyl-p)- mal-  aUfcAfua-L sAfsuGfaUfUfCfuGfaa C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— uUfaGfcUfgUfsasUf AB04 192 CfsasGfcUfaAfuUfcAfgAf 193 (vinyl-p)- mal- aUfcAfua-L sAfsuGfaUfuCfuGfaAf C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— uUfaGfcUfgUfsasUf AB05 194 (L)cscsUfgucUfCfUfugGfa 195 (vinu)sGfsaauauccaaga mal- uauUfca(invdT) Gfacaggsusu C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— AB06 196 (L)csasGfcuaAfUfUfcaGfa 197 (vinu)sAfsugauucugaau mal- aucAfua Ufagcugsusu C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— AB07 198 (L)cscsUfgUfcUfcUfuGfg 199 (vinu)sGfsaAfuAfuCfc mal- AfuAfuUfcAf(invdT) AfaGfaGfaCfaggsusu C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— AB08 200 cscsUfgucUfCfUfugGfaua 201 (vinu)sGfsaauauccaaga mal- uUfca(L) Gfacaggsusu C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— AB09 202 (L)cscsUfgucUfCfUfugGfa 203 (vinu)sGfsaauauccaaga (Mal- uauUfca(invdT) Gfacaggsusu (PEG).sub.12NH(CH.sub.2).sub.6) AB10 204 CfscsUfgUfcUfCfUfuGfga 205 (vinu)sGfsaAfuAfUfCf mal- uAfuUfcAf(L)- cAfagaGfaCfaGfgsUfs C2H4C(O)NH—(CH2)6— u AB11 206 CfsasGfcUfaAfUfUfcAfga 207 vinu)sAfsuGfaUfUfCfu mal- aUfcAfuAf(L)- GfaaufaGfcfgsUfsu- C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— AB12 208 usUfsgAfcGfaUfaCfAfGfc 209 vinu)sGfsaAfuUfAfGfc mal- UfaauUfcAfuAf(L) fguaUfcGfuCfaAfsgsG C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— f AB13 210 (vinu)CfsasGfcUfaAfUfUf 211 AfsuGfaUfUfCfuGfaau mal- cAfgaaUfcAfua UfaGfcUfgUfsasUf-L C.sub.2H.sub.4C(O)NH—(CH.sub.2).sub.6— AB14 218 C.sub.CsA.sub.CsrGrCrUrArArUrUr 219 (vinyl- CrArGrArArU p)sAfsuGfaUfUfCfuGf rCrAsT.sub.CsA.sub.C aauUfaGfcUfgUfsasUf AB15 220 X- 221 (vinyl-p)- mal- CfsasGfcUfaAfUfUfcAfga sAfsuGfaUfUfCfuGfaa C.sub.2H.sub.4C(O)(NH)—(CH.sub.2).sub.6 aUfcAfua-L uUfaGfcUfgUfsasUf AB16 222 csasrGrCrUrArArUrUrCrA 223 (vinyl- mal- rGrArArUrCrAsusa-(L) p)sAfsuGfaUfUfCfuGf C.sub.2H.sub.4C(O)(NH)—(CH.sub.2).sub.6 aauUfaGfcUfgUfsasUf Abbreviations Key: n = 2′-O-methyl residues, Nf = 2′-F residues, rN = unmodified residue, N.sub.C = 2′,4′-BNA.sup.NC (2′-O,4′-C-aminomethylene bridged nucleic acid), s = phosphorothioate, (invdt) = inverted Dt, Vinu = vinylphosphonate, vinyl-p = (E)-vinylphosphonate, (L) is a linker, and embedded image

(110) Structure of the linkers (L) are as follows:

(111) mal-C.sub.2H.sub.4C(O)(NH)-(CH.sub.2).sub.6— is

(112) ##STR00008##
(Mal-(PEG).sub.12)(NH)CH.sub.2).sub.6) is

(113) ##STR00009##
and
Mal-NH—(CH.sub.2).sub.6—, which can also be referred to as aminohexyl linker-(CH.sub.2).sub.6—, is

(114) ##STR00010##

(115) When connected to the siRNA, the structures, L-(X4) can be represented by the following formulas:

(116) ##STR00011##

(117) Although certain siRNA sequences are illustrated herein with certain modified nucleobases, the sequences without such modifications are also provided herein. That is, the sequence can comprise the sequences illustrated in the tables provided herein without any modifications. The unmodified siRNA sequences can still comprise, in some embodiments, a linker at the 5′ end of the of the sense strand of the dsRNA. In some embodiments, the nucleic acid molecules can be modified to include a vinyl phosphonate at the 5′ end of the of the anti-sense strand of the dsRNA. In some embodiments, the nucleic acid molecules can be modified to include a linker at the 3′ end of the of the sense strand of the dsRNA. In some embodiments, the nucleic acid molecules can be modified to include a vinyl phosphonate at the 3′ end of the of the anti-sense strand of the dsRNA. The linker can be as provided herein.

(118) In some embodiments, the FN3 proteins comprise a polypeptide comprising a polypeptide that binds CD71 are provided. In some embodiments, the polypeptide comprises a FN3 domain that binds to CD71. In some embodiments, the polypeptide comprises a sequence of SEQ ID NOs: 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, or 328 are provided. In some embodiments, the polypeptide that binds CD71 comprises a sequence of SEQ ID NOs: 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, or 328. The sequence of CD71 protein that the polypeptides can bind to can be, for example, SEQ ID Nos: 2 or 3. In some embodiments, the FN3 domain that binds to CD71 specifically binds to CD71.

(119) In some embodiments, the FN3 domain that binds CD71 is based on Tencon sequence of SEQ ID NO:1 or Tencon 27 sequence of SEQ ID NO:4 (LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIQYQESEKVGEAIVLTVPGSERSYDLT GLKPGTEYTVSIYGVKGGHRSNPLSAIFTT), optionally having substitutions at residues positions 11, 14, 17, 37, 46, 73, or 86 (residue numbering corresponding to SEQ ID NO:4).

(120) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NOs: 300, 301, 302, 303, 304, 305, 306, 307, 308, 309, 310, 311, 312, 313, 314, 315, 316, or 317.

(121) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NOs: 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, or 328.

(122) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NOs: 395, 396, 397, 398, 399, 400, 401, 402, 403, 404, 405, 406, 407, 408, 409, 410, 411, 412, 413, 414, 415, 416, 417, 418, 419, 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454, 455, 456, 457, 458, 459, 460, 461, 462, 463, 464, 465, 466, 467, 468, 469, 470, 471, 472, 473, 474, 475, 476, 477, 478, 479, 480, 481, 482, 483, 484, 485, 486, 487, 488, 489, 490, 491, 492, 493, 494, 495, 496, 497, 498, 499, 500, 501, 502, 503, 504, 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522, 523, 524, 525, 526, 527, 528, 529, 530, 531, 532, 533, 534, 535, 536, 537, 538, 539, 540, 541, 542, 543, 544, 545, 546, 547, 548, 549, 550, 551, 552, 553, 554, 555, 556, 557, 558, 559, 560, 561, 562, 563, 564, 565, 566, 567, 568, 569, 570, 571, 572, 573, 574, 575, 576, 577, 578, 579, 580, 581, 582, 583, 584, 585, 586, 587, 588, 589, 590, 591, 592, 593, 594, 595, 596, 597, 598, 599, 600, 601, 602, 603, 604, 605, 606, 607, 608, 609, 610, 611, 612, 613, 614, 615, 616, 617, 618, 619, 620, 621, 622, or 623.

(123) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:300.

(124) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:301.

(125) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:302.

(126) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:303.

(127) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:304.

(128) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:305.

(129) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:306.

(130) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:307.

(131) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:308.

(132) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:309.

(133) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:310.

(134) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:311.

(135) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:312.

(136) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:313.

(137) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:314.

(138) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:315.

(139) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:316.

(140) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:317.

(141) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:318.

(142) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:319.

(143) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:320.

(144) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:321.

(145) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:322.

(146) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:323.

(147) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:324.

(148) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:325.

(149) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:326.

(150) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:327.

(151) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO:328.

(152) In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 395. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 396. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 397. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 398. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 399. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 400. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 401. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 402. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 403. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 404. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 405. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 406. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 407. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 408. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 409. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 410. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 411. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 412. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 413. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 414. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 415. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 416. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 417. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 418. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 419. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 420. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 421. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 422. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 423. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 424. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 425. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 426. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 427. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 428. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 429. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 430. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 431. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 432. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 433. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 434. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 435. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 436. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 437. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 438. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 439. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 440. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 441. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 442. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 443. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 444. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 445. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 446. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 447. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 448. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 449. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 450. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 451. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 452. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 453. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 454. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 455. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 456. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 457. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 458. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 459. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 460. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 461. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 462. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 463. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 464. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 465. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 466. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 467. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 468. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 469. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 470. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 471. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 472. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 473. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 474. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 475. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 476. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 477. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 478. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 479. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 480. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 481. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 482. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 483. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 484. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 485. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 486. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 487. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 488. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 489. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 490. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 491. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 492. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 493. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 494. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 495. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 496. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 497. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 498. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 499. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 500. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 501. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 502. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 503. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 504. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 505. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 506. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 507. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 508. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 509. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 510. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 511. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 512. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 513. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 514. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 515. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 516. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 517. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 518. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 519. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 520. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 521. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 522. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 523. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 524. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 525. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 526. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 527. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 528. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 529. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 530. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 531. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 532. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 533. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 534. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 535. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 536. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 537. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 538. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 539. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 540. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 541. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 542. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 543. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 544. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 545. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 546. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 547. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 548. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 549. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 550. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 551. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 552. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 553. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 554. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 555. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 556. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 557. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 558. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 559. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 560. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 561. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 562. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 563. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 564. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 565. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 566. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 567. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 568. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 569. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 570. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 571. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 572. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 573. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 574. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 575. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 576. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 577. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 578. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 579. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 580. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 581. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 582. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 583. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 584. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 585. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 586. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 587. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 588. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 589. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 590. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 591. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 592. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 593. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 594. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 595. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 596. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 597. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 598. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 599. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 600. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 601. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 602. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 603. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 604. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 605. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 606. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 607. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 608. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 609. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 610. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 611. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 612. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 613. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 614. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 615. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 616. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 617. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 618. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 619. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 620. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 621. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 622. In some embodiments, an isolated FN3 domain that binds CD71 comprises the amino acid sequence of SEQ ID NO: 623.

(153) In some embodiments, the isolated FN3 domain that binds CD71 comprises an initiator methionine (Met) linked to the N-terminus of the molecule.

(154) In some embodiments, the isolated FN3 domain that binds CD71 comprises an amino acid sequence that is 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one of the amino acid sequences of SEQ ID NOs: 300-317. In some embodiments, the isolated FN3 domain that binds CD71 comprises an amino acid sequence that is 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one of the amino acid sequences of SEQ ID NOs: 318-328. In some embodiments, the isolated FN3 domain that binds CD71 comprises an amino acid sequence that is 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one of the amino acid sequences of SEQ ID NOs: 395-623. Percent identity can be determined using the default parameters to align two sequences using BlastP available through the NCBI website. The sequences of the FN3 domains that bind to CD71 can be found, for example, in Table 3.

(155) TABLE-US-00003 TABLE 3 CD71-binding FN3 domain sequences SEQ ID Amino Acid sequence of FN3 domains that bind to CD71 300 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIQYEELTTVGEAIYLR VPGSERSYDLTGLKPGTEYVVWIEGVKGGLRSNPLGAAFTT 301 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAITYIEWWDVGEAIGL KVPGSERSYDLTGLKPGTEYRVHIQGVKGGNNSYPLDALFTT 302 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIAYFEAIWNGEAIYLT VPGSERSYDLTGLKPGTEYQVEIRGVKGGPTSRPLFAWFTT 303 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTITYIEWWENGEAIALS VPGSERSYDLTGLKPGTEYQVGIAGVKGGYKSYPLWALFTT 304 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIIYTEEEKEGEAIYLRV PGSERSYDLTGLKPGTEYLVEIEGVKGGKRSVPLNASFTT 305 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIAYEESHTTGEAIFLR VPGSERSYDLTGLKPGTEYSVSIEGVKGGHYSPPLTAKFTT 306 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIDYREWWTLGEAIVL TVPGSERSYDLTGLKPGTEYYVNIQGVKGGLRSYPLSAIFTT 307 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYWEYVGHGEAIVL TVPGSERSYDLTGLKPGTEYSVGIYGVKGGSLSRPLSAIFTT 308 MLPAPKNLVISRVTEDSARLSWTAPDAAFDSFFIYYIESYPAGEAIVLTV PGSERSYDLTGLKPGTEYWVGIDGVKGGRWSTPLSAIFTT 309 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIEYYESFYGGEAIVLT VPGSERSYDLTGLKPGTEYYVSIYGVKGGWLSRPLSAIFTT 310 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIEYYESYPGGEAIVLT VPGSERSYDLTGLKPGTEYDVYIYGVKGGYWSRPLSAIFTT 311 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIEYYESLPDGEAIVLT VPGSERSYDLTGLKPGTEYAVYIYGVKGGYYSRPLSAIFTT 312 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIYYLESYPEGEAIVLT VPGSERSYDLTGLKPGTEYWVGIDGVKGGTWSSPLSAIFTT 313 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIEYFEFTGTGEAIVLTV PGSERSYDLTGLKPGTEYYVSIYGVKGGLLSAPLSAIFTT 314 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEALGDGEAIVL TVPGSERSYDLTGLKPGTEYFVDIYGVKGGFWSLPLSAIFTT 315 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYFEQFNLGEAIVLT VPGSERSYDLTGLKPGTEYWVGIYGVKGGWLSHPLSAIFTT 316 MLPAPKNLVVSRVTEDSARLSWTAPDAAFSFGISYLEWWEDGEAIVL TVPGSERSYDLTGLKPGTEYWVSIAGVKGGKRSYPLSAIFTT 317 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYREGAWYGEAIVL TVPGSERSYDLTGLKPGTEYFVDITGVKGGWWSDPLSAIFTT 318 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIKYIEWWADGEAIVLT VPGSERSYDLTGLKPGTEYLVEIYGVKGGKWSWPLSAIFTT 319 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFKISYQEWWEDGEAIVL TVPGSERSYDLTGLKPGTEYWVNISGVKGGVQSYPLSAIFTT 320 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFISYIEWWDLGEAIVLT VPGSERSYDLTGLKPGTEYHVEIFGVKGGTQSYPLSAIFTT 321 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFQILYQENAFEGEAIVLT VPGSERSYDLTGLKPGTEYWVYIYGVKGGYPSVPLSAIFTT 322 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIEYWEFVGYGEAIVLT VPGSERSYDLTGLKPGTEYWVAIYGVKGGDLSKPLSAIFTT 323 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYFEALEGGEAIVLT VPGSERSYDLTGLKPGTEYFVGIYGVKGGPLSKPLSAIFTT 324 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIKYLEWWQDGEAIVL TVPGSERSYDLTGLKPGTEYYVHIAGVKGGYRSYPLSAIFTT 325 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEADGWGEAIVL TVPGSERSYDLTGLKPGTEYFVDIYGVKGGYLSVPLSAIFTT 326 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEWEDEGEAIVL TVPGSERSYDLTGLKPGTEYRVEIYGVKGGYPSKPLSAIFTT 327 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGHGEAIVLT VPGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTT 328 MLPAPKNLVVSRVTEDSARLSWRVESRTFDSFLIQYQESEKVGEAIVLT VPGSERSYDLTGLKPGTEYTVSIYGVVWDTRDNPISNPLSAIFTT 3 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPILYLELNHHGEEIVLT VPGSERSYDLTGLKPGTEYWVYIFGVKGGMYSAPLSAIFTTGG 395 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYREGAWYGEAIVL TVPGSERSYDLTGLKPGTEYAVYIPGVKGGPRSFPLSAIFTT 396 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIAYVEWWKLGEAIVL TVPGSERSYDLTGLKPGTEYVVPIPGVKGGGHSSPLSAIFTT 397 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIYYYESSGTGEAIVLT VPGSERSYDLTGLKPGTEYFVDIGGVKGGSYSLPLSAIFTT 398 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIYYWEVFPAGEAIELD VPGSERSYDLTGLKPGTEYFVRIEGVKGGASSYPLRAEFTT 399 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIWYWEKSVDGEAIVL TVPGSERSYDLTGLKPGTEYNVGIQGVKGGTPSDPLSAIFTT 400 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIWYAEWVNDGEAIVL TVPGSERSYDLTGLKPGTEYRVEITGVKGGTWSRPLSAIFTT 401 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYYEPVPAGEAIYLD VPGSERSYDLTGLKPGTEYDVTIYGVKGGYYSHPLFASFTT 402 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIEYFEWTVGGEAIVL TVPGSERSYDLTGLKPGTEYYVSIYGVKGGWLSPPLSAIFTT 403 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHISYEETPVVGEAIYLR VPGSERSYDLTGLKPGTEYTVAIHGVKGGRESTPLIAPFTT 404 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIHYWEFDPPGEAIVLT VPGSERSYDLTGLKPGTEYTVYIEGVKGGWWSKPLSAIFTT 405 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYWERTQPGEAIVLT VPGSERSYDLTGLKPGTEYDVWISGVKGGKWSEPLSAIFTT 406 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIRYWEWYVLGEAIVL TVPGSERSYDLTGLKPGTEYYVEISGVKGGWQSWPLSAIFTT 407 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIGYLEPGDNGEAIVLT VPGSERSYDLTGLKPGTEYNVSIGGVKGGLGSYPLSAIFTT 408 MLPAPKNLVVSRITEDSARLSWTAPDAAFDSFGIYYYEWWSTGEAIVLT VPGSERSYDLTGPKPGTEYYVKISGVKGGYRSYPLSAIFTT 409 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRISYYEWYDLGEAIVLT VPGSERSYDLTGLKPGTEYWVDIAGVKGGYYSYPLSAIFTT 410 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTT 411 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFISYFEGWASGEAIHLY VPGSERSYDLTGLKPGTEYSVHIQGVKGGQPSTPLSAIFTT 412 MLPAPKNLVVSRITEDSARLSWTAPDAAFDSFDIPYGEFDTIGEAIVLTV PGSERSYDLTGLKPGTEYDVYIEGVKGGHLSWPLSAIFTT 413 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFGIQYNEFVFRGEAIVLT VPGSERSYDLTGLKPGTEYFVPISGVKGGDDSRPLSAIFTT 414 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIEYWEVVGFGEAIVL TVPGSERSYDLTGLKPGTEYWVGIYGVKGGNPSVPLSAIFTT 415 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIDYDEPINSGEAIVLT VPGSERSYDLTGPKPGTEYEVEIYGVKGGYLSRPLSAIFTT 416 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIDYDEPQPVGEAIVLT VPGSERSYDLTGLKPGTEYRVDIWGVKGGPTSGPLRATFTT 417 MLLAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYFEYTGEGEAIVLT VPGSERSYDLTGLKPGTEYYVGIYGVKGGYLSRPLSAIFTT 418 MLPAPKNLVVSHVTEDSARLSWTAPDAAFDSFDIEYYELVGSGEAIVLT VPGSERSYDLTGLKPGTEYYVAIYGVKGGYLSRPLSAIFTT 419 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFGIAYYERSGAGEAIVLT VPGSERSYDLTGLKPGTEYMVYINGVKGGFVSSPLSAIFTT 420 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIAYEEHGLVGEAIYLR VPGSERSYDLTGLKPGTEYHVGIMGVKGGVFSSPLSAIFTT 421 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIQYTESHWVGEAIVLT VPGSERSYDLTGLKPGTEYAVPIEGVKGGDSSTPLSAIFTT 422 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIIYGEVNPYGEAIVLT VPGSERSYDLTGLKPGTEYDVFIEGVKGGHLSWPLSAIFTT 423 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIAYEELVTEGEAIYLR VPGSERSYDLTGLKPGTEYLVDIEGVKGGHLSSPLSAIFTT 424 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIHYHEWWEAGEAIVL TVPGSERSYDLTGLKPGTEYLVDIPGVKGGDLSVPLSAIFTT 425 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIYYYESVGTGEAIVLT VPGSERSYDLTGLKPGTEYFVDISGVKVGTYSLPLSAIFTT 426 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIAYFEFANPGEAIVLT VPGSERSYDLTGLKPGTEYKVVIQGVKGGTPSEPLSAISTT 427 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIHYKEHSWWGEAIVL TVPGSERSYDLTGLKPGTEYIVPIPGVKGGGISRPLSAIFTT 428 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYWEAVGSGEAIVLT VPGSERSYDLTGLKPGTEYHVYIYGVKGGYLSLPLSAIFTT 429 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTTT 430 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIAYSEVRYDGEAIVLT VPGSERSYDLTGLKPGTEYVVPIGGVKGGGSSSPLSAIFTT 431 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIPYGEAFNPGEAIVLT VPGSERSYDLTGLKPGTEYDVFIEGVKGGTLSWPLSAIFTT 432 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRILYGEVDPWGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGKLSWPLSAIFTT 433 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIEYEETPQKGEAIFLR VPGSERSYDLTGLKPGTEYVVNIRGVKGGDLSSPLGALFTT 434 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRIEYIEWWVGGEAIVLT VPGSERSYDLTGLKPGTEYWVDIKGVKGGKRSYPLSAIFTT 435 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIDYPEFPVRGEAIVLT VPGSERSYDLTGPKPGTEYNVTIQGVKGGFPSMPLSAIFTT 436 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFQIPYWEQSLGGEAIVLT VPGSERSYDLTGLKPGTEYEVWIEGVKGGDLSFPLSAISTT 437 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIPYEEYLYTGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGLTSWPLSAIFTT 438 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIDYPEFPVRGEAIVLT VPGSERSYDLTGLKPGTEYAVTIWGVKGGFTSQPLSAIFTT 439 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYFEFVGEGEAIVLT VPGSERSYDLTGLKPGTEYDVGIYGVKGGSLSSPLSAIFTT 440 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIDYLELGESGEAIVLT VPGSERSYDLTGLKPGTEYWVYIFGVKGGYPSAPLSAIFTT 441 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIPYGESPPSGEAIVLTV PGSERSYDLTGLKPGTEYVVIIRGVKGGGRSGPLSAISTT 442 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIINYIEIVQYGEAIVLTV PGSERSYDLTGLKPGTEYPESIWGVKGGGASSPLSAIFTT 443 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIEYYEAVGAGEAIVLT VPGSERSYDLTGLKPGTEYTVGIYGVKGGWLSKPLSVIFTT 444 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIPYVEAEVPGEAIQLH VPGSERSYDLTGLKPGTEYYVEIWGVKGGFYSPPLIAEFTT 445 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIDYYEGKGYGEAIVLT VPGSERSYDLTGLKPGTEYQVLISGVKGGKYSLPLSAIFTT 446 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIVYAEVTYDGEAIVLT VPGSERSYDLTGLKPGTEYDVFIEGVKGGELSWPLSAIFTT 447 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIVYGEAWVTGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGELSWPLSAIFTT 448 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIDYYERKYVGEAIVL TVPGSERSYDLTGLKPGTEYEVTIYGVKGGWYSDPLSAIFTT 449 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPISYYEMSGLGEAIVLT VPGSERSYDLTGLKPGTEYMVYIFGVKGGLNSLPLSAIFTT 450 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIYYIESYPAGEAIVLTV PGSERSYDLTGLKPGTEYWMGIDGVKGGRWSTPLSAIFTT 451 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIEYDEPSVAGEAIVLT VPGSERSYDLTGLKPGTEYRVFIWGVKGGNQSWPLSAIFTT 452 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIKYIEWWADGEAIVLT VPGSERSYDLTGLKPGTEYLVEIYGVKGGRQSYPLSAIFTT 453 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDISYWESGKYGEAIVLT VPGSESSYDLTGLKPGTEYLVDIFGVKGGYPSEPLSAIFTT 454 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWISYEESDTEGEAIYLR VPGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTT 455 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFVIEYFEQFNLGEAIVLT VPGSERSYDLTGLKPGTEYLVGIYGVKGGWLSHPLSAIFTT 456 MLPAPKNLVVSRVTKDSARLSWTAPDAAFDSFHIAYEEATTYGEAIFLR VPGSERSYDLTGLKPGTEYEVKIHGVKGGADSKPLVAPFTT 457 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIAYEEADSEGEAIYLR VPGSERSYDLTGLKPGTEYSVNIQGVKGGIVSFPLHAEFTT 458 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIPYAEVRPDGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGKLSLPLSAIFTT 459 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIPYAEPSPTGEAIVLTV PGSERSYDLTGLKPGTEYDVWIEGVKGGTLSWPLSAIFTT 460 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGLLSSPLSAIFTT 461 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGRNSDPLSAISTT 462 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIEYEEQYSTGEAIYLR VPGSERSYDLTGLKPGTEYHVDIEGVKGGRRSFPLNAFFTT 463 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIPYAEVRPDGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGKLSEPLSAIFTT 464 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPSPTGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGHLSDPLSAIFTT 465 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIPYAEPSPTGEAIVLTV PGSERSYDLTGLKPGTEYGVVILGVKGGYGSDPLSAIFTT 466 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSSPLSAIFTT 467 MLPAPKNLVVSRVTEDSARLSWTAPDAALDSFRIAYTEYFVGGEAIVLT VPGSERSYDLTGLKPGTEYGVGIYGVKGGAGSSPLSAIFTT 468 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIPYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGLLSSPLSAIFTT 469 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPITYRERSQYGEAIVLT VPGSERSYDLTGLKPGTEYVVPIEGVKGGRGSKPLSAIFTT 470 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYFENLGIGEAIVLTV PGSERSYDLTGLKPGTEYVVNIYGVKGGWLSSPLSAIFTT 471 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYYEYVGNGEAIVLT VPGSERSYDLTGLKPGTEYQVGIYGVKGGYYSRPLSAIFTT 472 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIDYLELDDYGEAIVLT VPGSERSYDLTGLKPGTEYPVYIYGVKGGLPSTPLSAIFTT 473 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGRNSDPLSAIFTT 474 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIAYGEWRQHGEAIVL TVPGSERSYDLTGLKPGTEYDVFIDGVKGGNLSWPLSAIFTT 475 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIRYWEELPTGEAIVLT VPGSERSYDLTGLKPGTEYTVEIFGVKGGYLSRPLSAISTT 476 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIAYEEATTYGEAIFLR VPGSERSYDLTGLKPGTEYDVWIEGVKGGTISGPLSAIFTT 477 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYFVDIFGVKGGTLSRPLSAIFTT 478 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGHLSDPLSAIFTT 479 MLPARKNLVVSRVTEDSARLSWTAPDAAFDSFFIPYAEPSPTGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGHLSDPLSAISTT 480 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTILYNEIQNVGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGELSWPLSAIFTT 481 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGTPSEPLSAIFTT 482 MLPAPKNLVVSRVTEDSARLSWTTPDAAFDSFFIGYLEPYPPGEAIVLTV PGSERSYDLTGLKPGTEYVVSIQGVKGGKPSDPLSAIFTT 483 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSVPLSAIFTT 484 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYPEYPATGEAIVLT VPGSERSYDLTGLKPGTEYFVDINGVKGGSLSYPLSAIFTT 485 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIRYLEWWDVGEAIVL TVPGSERSYDLTGLKPGTEYLVEIKGVKGGKFSYPLSAIFTT 486 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIEYDEWWALGEAITLI VPASERSYDLTGLKPGTEYVVKIHGVKGGQRSYPLIAFFTT 487 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIHYRELYVQAIVLTVP GSERSYDLTGLKPGTEYLVMIPGVKGGPTSVPLSAIFTT 488 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYKVVIQGVKGGTPSEPLSAIFTT 489 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYSVVIQGVKGGFPSDPLSAIFTT 490 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVGIHGVKGGHDSSPLSAIFTT 491 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGRASGPLSAIFTT 492 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIAYAEPIPRGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGRRSVPLSAIFTT 493 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYPVPIPGVKGGPGSSPLSAIFTT 494 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEISYYEMRGYGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVEGGDYSSPLSAISTT 495 MLPAPKNLVVSHVTEDSARLSWTAPDAAFDSFPIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGLLSSPLSAIFTT 496 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPYPPGEAIVLTV PGSERSYDLTGLKPGTEYVVSIQGVKGGTPSQPLSAIFTT 497 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGRPSNPLVAAFTT 498 MLPAPKNLVVSRITEDSARLSWTAPDAAFDSFGIGYYEHKRFGEAIQLS VPGSERSYDLTGLKPGTEYEVDIEGVKGGVLSWPLFAEFTT 499 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIDYDELAIYGEAIVLT VPGSERSYDLTGLKPGTEYGVMIIGVKGGLPSDPLSAIFTT 500 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLESAEAIVLTVPGS ERSYDLTGLKPGTEYLVTIQGVKGGIASDPLSAIFTT 501 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDFVIEYFEFVGYGEAIVLT VPGSERSYDLTGLKPGTEYSVGIYGVKGGKLSPPLSAIFTT 502 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGKLSLPLSAIFTT 503 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHEWVYFGEAIVLTVPG SERSYDLTGLKPGTEYFVDIWGVKGGTVSKPLSAIFTT 504 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYPEYPATGEAITLFV PGSERSYDLTGLKPGTEYNVVIQGVKGGRPSNPLVVAFTT 505 MLPAPENLVVSRVTEDSARLSWTAPDAAFDSFEITYEENWRRGEAIVLT VPGSERSYDLTGPKPGTEYIVIIQGVKGGAESWPLSAIFTT 506 MLPAPKNLVVSRVTEDSARLSWTALDAAFDSFFIGYLEPQPPGEAIVLT VPGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTT 507 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAVGNGEAIVL TVPGSERSYDLTGLKPGTEYWVDIWGVKGGEFSSPLSAIFTT 508 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIDYDELAIYGEAIVLT VPGSERSYDLTGLKPGTEYRVFIYGVKGGWTSWPLSTIFTT 509 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIEYDEIPFWGEAIVLTV PGSERSYDLTGLKPGTEYRVWIHGVKGGNSSWPLSAIFTT 510 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIHYVEWWVLGEAIVL TVPGSERSYDLTGLKPGTEYPVYIYGVKGGPKSIPLSAIFTT 511 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFKIDYLEINDNGEAIVLT VPGSERSYDLTGLKPGTEYPVYIWGVKGGYPSSPLSAIFTT 512 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIAYNEDRKFGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGSLSFPLSAIFTT 513 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFGIRYFEWWDLGEAIVL TVPGSERSYDPTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTT 514 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIEYYEWMHTGEAIVL TVPGSERSYDLTGLKPGTEYSVYIYGVKGGYPSSPLSAIFTT 515 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIDYWETWVIGEAIVLT VPGSERSYDLTGLKPGTEYEVIIPGVKGGTISPPLSAIFTT 516 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIDYLELTYSGEAIVLT VPGSERSYDLTGLKPGTEYYVYIYGVKGGYPSSPLSAIFTT 517 MLPAPKNLVVSRVTEDSARLSWTAPDAALDSFRIEYYESYGHGEAIVLT VPGSERSYDLTGLKPGTEYDVGIYGVKGGYYSRPLSAIFTT 518 MLPAPKNLVVSRVTEDSARLPWTAPDAAFDSFWISYYESVGYGEAIVLT VPGSERSYDLTGLKPGTEYYVDISGVKGGVYSLPLSAIFTT 519 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIDYDEPAWNGEAIVL TVPGSERSYDLTGLKPGTEYRVFIYGVKGGNTSWPLSAIFTT 520 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIEYDELWKNGEAIVL TVPGSERSYDLTGLKPGTEYRVFIYGVKGGYGSFPLSAIFTT 521 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGTPSEPLSAISTT 522 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFGIVYREPYVGGEAIVLT VPGSERSYDLTGLKPGTEYGVPIPGVKGGYDSGPLSAIFTT 523 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIPYIEYVWWGEAIVLT VQGSERSYDLTGLKPGTEYPVTIGGVKGGSRSHPLHAHFTT 524 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIVYGERFVNGEAIVLT VPGSERSYDLTGLKPGTEYHVYIDGVKGGDLSWPLSAIFTT 525 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWINYYEAQPDGEAIVL TVPGSERSYDLTGLKPGTEYDVEIAGVKGGTASLPLSAIFTT 526 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIEYWEQIGVGEAIVLT VPGSERSYDLTGLKPGTEYWVGIYGVKGGLLSSPLSAIFTT 527 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIYYWEIERAGEAIRLD VPGSERSYDLTGLKPGTEYRVDIWGVKGGPTSGPLRATFTT 528 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIPYGERQELGEAIVLT VPGSERSYDLTGLKPGTEYFVVIQGVKGGQPSYPLSAIFTT 529 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPTGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGYPSSPLSAIFTT 530 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPTPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGGLSLPLSAIFTT 531 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIEYWEWYFAGEAIVLT VPGSERSYDLTGLKPGTEYTVWITGVKGGTWSEPLSAIFTT 532 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTILYYEMVGEGEAIVLT VPGSERSYDLTGPKPGTEYWVDIYGVKGGGWSRPLSAIFTT 533 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIDYLELTYAGEAIVLT VPGSERSYDLTGLKPGTEYYVTIYGVKGGYPSSPLSAIFTT 534 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIIYEEDGTEGEAIYLR VPGSERSYDLTGLKPGTEYEVDIEGVKGGVLSWPLFAEFTT 535 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHISYQEVVAEGEAIYLR VPGSERSYDLTGLKPGTEYYVLIHGVKGGYESKPLDASFTT 536 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIEYFEWTGSGEAIVLT VPGSERSYDLTGLKPGTEYNVAIYGVKGGAVSYPLSAIFTT 537 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEALGDGEAIVL TVPGSERSYDLTGLKPGTEYFVDIPGVKGGTRSSPLSAISTT 538 MLLAPKNLVVSRVTEDSARLSWTAPDAAFDSFRYLEQGLYGEAIVLTV PGSERSYDLTGLKPGTEYWVEIIGVKGGEYSTPLSAIFTT 539 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFKIEYFEYVGYGEAIVLT VPGSERSYDLTGLKPGTEYYVAIYGVKGGWYSRPLSAIFTT 540 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIIYEEVLTEGEAIYLRV PGSERSYDLTGLKPGTEYGVTIKGVKGGAYSIPLIATFTT 541 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRIRYLEWWNIGEAIVLT VPGSERSYDLTGLKPGTEYHVDIWGVKGGYSSYPLSAIFTT 542 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIYYVEWSEAGEAIVLT VPGSERSYDLTGLKPGTEYRVEIRGVKGGSWSSPLSAIFTT 543 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIHYDEDWRRGEAIVLT VPGSERSYDLTGLKPGTEYLVEIPGVKGGKASYPLSAIFTT 544 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFQIRYPKRWISGEAIVLT VPGSERSYDLTGLKPGTEYEVVIRGVKGGEYSWPLSAIFTT 545 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIPYIETVALGEAIVLTV PGSERSYDLTGLKPGTEYYVEIYGVKGGSYSYPLSAISTT 546 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIAYDETLNLGEAIVLT VPGSERSYDLTGLKPGTEYIVGIFGVKGGTHSWPLSAIFTT 547 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIVYAEPIPNGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGRNSDPLSAIFTT 548 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYITYWETWDYGEAIVL TVPGSERSYDLTGLKPGTEYKVPITGVKGGGPSVPLSAIFTT 549 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSINYREWWSDGEAIYL PVPGSERSYDLTGLKPGTEYAVYIQGVKGGSRSFPLHAWFTT 550 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIEYYEELGSGEAIVLT VPGSERSYDLTGLKPGTEYRVYIYGVKGGYPSSPLSAIFTT 551 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTILYGEMGTTGEAIVLT VPGSERSYDLTGLKPGTEYDVFIEGVKGGELSWPLSAIFTT 552 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFKIFYQEFGGEAIVLTVP GSERSYDLTGLKPGTEYWVDIYGVKGGYTSSPLSAIFTT 553 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAITYYEGRWRGEAIVL TVPGSERSYDLTGLKPGTEYGVPIRGVKGGTGSLPLSAIFTT 554 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRIKYLEWWLGGEAIVL TVPGSERSYDLTGLKPGTEYWVDIQGVKGGVLSWPLSAIFTT 555 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIYYYEWFVSGEAIVLT VPGSERSYDLTGLKPGTEYFVDIDGVKGGYRSRPLSAIFTT 556 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIKYLEWWSWGEAIVL TVPGSERSYDLTGLKPGTEYRVPISGVKGGGMSGPLSAIFTT 557 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIPYYEWVNHGEAIVL TVPGSERSYDLTGLKPGTEYPVGIDGVKGGGPSWPLSAIFTT 558 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIDYSEFHLRGEAIVLT VPGSERSYDLTGLKPGTEYLGIFGVKGGEQSGPLSAIFTT 559 MLPAPKNLVVSRITEDSARLSWTAPDAAFDSFGIAYNEGDHYGEAIVLT VPGSERSYDLTGLKPGTEYSVWIEGVKGGNLSYPLSAIFTT 560 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIAYNEQNHYGEAIVLT VPGSERSYDLTGLKPGTEYGVWIEGVKGGTLSWPLSAIFTT 561 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIEWTYKGEAIVLTVPG SERSYDLTGLKPGTEYFVGIPGVKGGKSSYPLSAIFTTNPKGDTP 562 MGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIPYAEPSPTGEAIVL TVPGSERSYDLTGLKPGTEYPVWIQGVKGGSPSAPLSAEFTT 563 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIDYFESVGFGEAIVLT VPGSERSYDLTGLKPGTEYDVQITGVKGGPHSLPLSAIFTT 564 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPYPPGEAIVLTV PGSERSYDLTGLKPGTEYAVEIAGVKGGLLSSPLSAISTT 565 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIVTT 566 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIGYTEYGGYGEAIVLT VPGSERSYDLTGLKPGTEYWVLIQGVKGGGSSVPLSAIFTT 567 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIEYWETIGGGEAIVLT VPGSERSYDLTGLKPGTEYYVGIYGVKGGWWSRPLSAIFTT 568 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIPYAEPSPTGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGHLSDPLSAISTT 569 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIEYYELIGRGEAIVLT VPGSERSYDLTGLKPGTEYWVGIYGVKGGWLSRPLSAIFTT 570 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIVYHEPRPSGEAIVLT VPGSERSYDLTGLKPGTEYEVGIVGVKGGDLSVPLSAIFTT 571 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIVYHEPRPSGEAIVLT VPGSERSYDLTGLKPGTEYEVGIVSVKGGDLSVPLSAIFTT 572 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIPYAEPSPTGEAIVLTV PGSERSYDLTGLKPGTEYDVWIEGVKGGVLSWPLSAIFTT 573 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIEYFEFVDAGEAIVLT VPGSERSYDLTGLKPGTEYWVEIWGVKGGSWSKPLSAIFTT 574 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNISYYEYFVHGEAIVLT VPGSERSYDLTGLKPGTEYYVIDGVKGGDPSEPLSAIFTT 575 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIVYGEWGVPGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGDLSWPLSAIVTT 576 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIEYFEYTGEGEAIVLT VPGSERSYDLTGLKPGTEYYVGIYGVKGGYLSRPLSAIFTT 577 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAISTT 578 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRIKYQEWWVEGEAIVL TVPGSERSYDLTGLKPGTEYVVQIAGVKGGLSSYPLSAIFTT 579 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIYYIETSHQGEAIVLT VPGSERSYDLTGLKPGTEYFVLIKGVKGGYDSVPLSAIFTT 580 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFMIRYQEGTRWGEAIVL TVPGSERSYDLTGLKPGTEYIVMIAGVKGGQISLPLSAIFTT 581 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIVYSEIHVIGEAIVLTV PGSERSYDLTGLKPGTEYDVWIEGVKGGHLSEPLSAIFTT 582 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIVYGEAGAFGEAIVLT VPGSERSYDLTGLKPGTEYDVLIEGVKGGNLSWPLSAIFTT 583 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHINYAEVYTKGEAILLT VPGSERSYDLTGLKPGTEYEVYIPGVKGGPFSRPLNAQFTT 584 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIRYQEWQRWGEAIVL TVPGSERSYDLTGLKPGTEYTVHIAGVKGGMLSLPLSAIFTT 585 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIPYAETRDDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGDLSSPLSAIFTT 586 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFGIPYAESTPTGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGHLSDPLSAIFTT 587 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIFKDGEAIVLTVPGSE RSYDLTGLKPGTEYYVYIYGVKGGYPSKPLSAIFTT 588 MLPAPKNLVVSRVTEDSVRLSWTAPDAAFDSFAISYEEWWVHGEAIVL TVPGSERSYDLTGLKPGTEYSVVIPGVKGGLYSWTLSAISTT 589 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIAYAEVTLHGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGRNSDPLSAIFTT 590 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRIDYLELTSLGEAIVLT VPGSERSYDLTGLKPGTEYPVPILGVKGGLSSWPLSAIFTT 591 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWINYYEGIGEGEAIVLT VPGSERSYDLTGLKPGTEYYVDISGVKGGSYSLPLSAIFTT 592 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGHLSDPLSAIFTT 593 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIEYYESVGLGEAIVLT VPGSERSYDLTGLKPGTEYDVSIYGVKGGYLSRPLSAIFTT 594 MLPAPKNLVVRXVTEDSARLSWTAPDAAFDSFEIEYDEPYRGGEAIVLT VPGSERSYDLTSLKPGTEYPVSIGGVKGGITSDPLSAIFTT 595 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIDYDEIHDWGEAIVLT VPGSERSYDLTGLKPGTEYAVQIGGVKGGSFSWTLSAIFTT 596 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIVYHEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYEVVILGVKGGVHSYPLSAIFTT 597 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGLLSSPLSAIFTT 598 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTT 599 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGDYSSPLSAIFTT 600 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIYYPEFPVRGEAIVLT VPGSERSYDLTGLKPGTEYVVSIWGVKGGTQSWPLSAIFTT 601 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIEYHESGPVGEAIVLT VPGSERSYDLTGLKPGTEYMVWIFGVKGGFVSRPLSAIFTT 602 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAIVLTV PGSERSYDLTGLKPGTEYSVLIHGVKGGDYSSPLSAISTT 603 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIPYYEDTNDGEAIVLT VPGSERSYDLTGLKPGTEYWVSIQGVKGGTVSGPLSAIFTT 604 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFYLEQAWGGEAIVLTV PGSERSYDLTGLKPGTEYWVEITGVKGGYASSPLSAIFTT 605 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIEYEEPETEGEAIYLH VPGSERSYDLTGLKPGTEYKVLIRGVKGGSYSIPLQAPFTT 606 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIAYWELTPSGEAIELL VPGSERSYDLTGLKPGTEYRVDIIGVKGGFISEPLGATFTT 607 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIEYWEFTGSGEAIVLT VPGSERSYDLTGLKPGTEYDVSIYGVKGGWLSYPLSAIFTT 608 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSIIYSEWNVTGEAIVLT VPGSERSYDLTGLKPGTEYDVWIEGVKGGGMSKPLSAISTT 609 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPIPSGEAIVLTV PGSERSYDLTGLKPGTEYPVVIQGVKGGHPSQPLSAIFTT 610 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIILTV PGSERSYDLTGLKPGTEYNVTIQGVKGGFPSMPLSAIFTT 611 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIPYAETSPSGEAITLFV PGSERSYDLTGLKPGTEYNVVIQGVKGGRPSNPLVAASTT 612 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPIAYAEPRPDGEAIVLT VPGSERSYDLTGLKPGTEYSVLIHGVKGGLLSSPLSAISTT 613 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFLIEYWESVGYGEAIVLT VPGSERSYDLTGLKPGTEYWVGIYGVKGGYYSRPLSAIFTT 614 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIGYLEPQPPGEAIVLTV PGSERSYDLTGLKPGTEYNVTIHGVKGGTPSMPLSAIFTT 615 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIEYDEPYRGGEAIVLT VPGSERSYDLTSLKPGTEYPVSIGGVKGGITSDPLSAIFTT 616 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFDIYYPEYYDRGEAIVLT VPGSERSYDLTGLKPGTEYTVYIDGVKGGGGSGPLSAIFTT 617 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFFIAYFEFANPGEAIVLT VPGSERSYDLTGLKPGTEYKVVIQGVKGGTPSEPLSAIFTT 618 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIITYWEHVGDGEAIVLT VPGSERSYDLTGLKPGTEYFVEIYGVKGGYLSKPLSAIFTT 619 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFEIDYDEPFVYGEAIVLT VPGSERSYDLTGLKPGTEYRVFIFGVKGGNGSWPLSAIFTT 620 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIEYFETQGYGEAIVLT VPGSERSYDLTGLKPGTEYYVAIYGVKGGYLSRPLSAIFTT 621 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFPITYSEPAHYGEAIVLT VPGSERSYDLTGLKPGTEYHVGIMGVKGGVFSSPLSAIFTT 622 MLPAPKNLVVSEVTEDSARLSWQGVARAFDSFLITYREQIFAGEVIVLT VPGSERSYDLTGLKPGTEYPVWIQGVKGGSPSAPLSAISTT 623 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIDYLELDQEGEAIVLT VPGSERSYDLTGLKPGTEYAVYIFGVKGGYPSTPLSAIFTT

(156) As provided herein, in some embodiments, the FN3 domain that binds to CD71 binds to SEQ ID NO: 2 (human mature CD71) or SEQ ID NO: 5 (human mature CD71 extracellular domain), sequence of each provided below:

(157) TABLE-US-00004 2 MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRLLLLSLGL SLLLLVVVCVIGSQNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGG NVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAAL QGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVV TSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQ PDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEP PLL 5 QNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQL EKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERTCCPVN WVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHI GPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGE DCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL

(158) In some embodiments, the FN3 domain that binds to EpCAM comprises a polypeptide comprising an amino acid sequence of SEQ ID NOs: 329, 330, 331, 332, 333, 334, or 335 are provided.

(159) In some embodiments, fibronectin type III (FN3) domains that bind or specifically bind human EpCAM protein (SEQ ID NO: 336) are provided. As provided herein, these FN3 domains can bind to the EpCAM protein. Also provided, even if not explicitly stated is that the domains can also specifically bind to the EpCAM protein. Thus, for example, a FN3 domain that binds to EpCAM would also encompass a FN3 domain protein that specifically binds to EpCAM. In some embodiments, an isolated FN3 domain that binds or specifically binds EpCAM is provided.

(160) In some embodiments, the FN3 domain may bind EpCAM at least 5-fold above the signal obtained for a negative control in a standard ELISA assay.

(161) In some embodiments, the FN3 domain that binds or specifically binds EpCAM comprises an initiator methionine (Met) linked to the N-terminus of the molecule. In some embodiments, the FN3 domain that binds or specifically binds EpCAM comprises a cysteine (Cys) linked to a C-terminus of the FN3 domain. The addition of the N-terminal Met and/or the C-terminal Cys may facilitate expression and/or conjugation of half-life extending molecules.

(162) In some embodiments, the FN3 domain that binds EpCAM is based on Tencon sequence of SEQ ID NO:1 or Tencon 27 sequence of SEQ ID NO:4, optionally having substitutions at residues positions 11, 14, 17, 37, 46, 73, or 86 (residue numbering corresponding to SEQ ID NO:4).

(163) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NOs:329, 330, 331, 332, 333, 334, or 335.

(164) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:329.

(165) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:330.

(166) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:331.

(167) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:332.

(168) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:333.

(169) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:334.

(170) In some embodiments, an isolated FN3 domain that binds EpCAM comprises the amino acid sequence of SEQ ID NO:335.

(171) In some embodiments, the isolated FN3 domain that binds EpCAM comprises an initiator methionine (Met) linked to the N-terminus of the molecule.

(172) In some embodiments, the isolated FN3 domain that binds EpCAM comprises an amino acid sequence that is 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one of the amino acid sequences of SEQ ID NOs: 329-335. Percent identity can be determined using the default parameters to align two sequences using BlastP available through the NCBI website.

(173) The sequences of FN3 domains that can bind to EpCAM are provided in Table 4.

(174) TABLE-US-00005 TABLE 4 EpCAM-binding FN3 domain sequences SEQ Amino Acid sequences of FN3 domains ID NO: that bind to EpCAM 329 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSISYRERS AWGEAIALVVPGSERSYDLTGLKPGIEYIVGIIGVKGGLRS NPLRADFTT 330 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERS REGEVIALTVPGSERSYDLTGLKPGTEYIVGILGVKGGRRS KPLRAQFTT 331 MLPAPKNLVVSRVTEDSARLSWEGYRNNAHFDSFLIQYQ ESEKVGEAIVLTVPGSERSYDLTGLKPGTEYTVSIYGVVAA VPRNYYSNPLSAIFTT 332 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIRYYEGS GYGEAIVLTVPGSERSYDLTGLKPGTEYYVYIGGVKGGSP SSPLSAIFTTG 333 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFKIGYWEW RKYGEAIELNVPGSERSYDLTGLKPGTEYRVLIYGVKGGA GSHPLRALFTT 334 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSISYRERS AWGEAIALVVPGSERSYDLTGLKPGIEYIVGIIGVKGGLRS NPLRADFTTGGGGSGGGGSGGGGSGGGGSLPAPKNLVVS RVTEDSARLSWTAPDAAFDSFHIEYWEQSIVGEAIVLTVPG SERSYDLTGLKPGTEYRVWIYGVKGGNDSWPLSAIFTT 335 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERS REGEVIALTVPGSERSYDLTGLKPGTEYIVGILGVKGGRRS KPLRAQFTTGGGGSGGGGSGGGGSGGGGSLPAPKNLVVS RVTEDSARLSWTAPDAAFDSFHIEYWEQSIVGEAIVLTVPG SERSYDLTGLKPGTEYRVWIYGVKGGNDSWPLSAIFTT

(175) In some embodiments, the sequences provided herein, including those that bind to EpCAM or CD71, does not comprise the initial methionine. The methionine, for example, can be removed when the FN3 domain is linked to another domain, such as a linker or other FN3 domain.

(176) The sequence of EpCAM is as follows:

(177) TABLE-US-00006 SEQ ID QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKL NO: AAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD 336 ESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERV RTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFI TSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVK GESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSM QGLK

(178) In some embodiments, the FN3 domain that binds to EGFR comprises a polypeptide comprising an amino acid sequence of SEQ ID NOs: 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, or 368 are provided.

(179) As provided herein, these FN3 domains can bind to the EGFR protein. Also provided, even if not explicitly stated is that the domains can also specifically bind to the EGFR protein. Thus, for example, a FN3 domain that binds to EGFR would also encompass a FN3 domain protein that specifically binds to EGFR. In some embodiments, an FN3 domain that binds or specifically binds EGFR is provided.

(180) In some embodiments, the FN3 domain may bind EGFR at least 5-fold above the signal obtained for a negative control in a standard ELISA assay.

(181) In some embodiments, the FN3 domain that binds or specifically binds EGFR comprises an initiator methionine (Met) linked to the N-terminus of the molecule. In some embodiments, the FN3 domain that binds or specifically binds EGFR comprises a cysteine (Cys) linked to a C-terminus of the FN3 domain The addition of the N-terminal Met and/or the C-terminal Cys may facilitate expression and/or conjugation of half-life extending molecules.

(182) In some embodiments, the FN3 domain that binds EGFR comprises the amino acid sequence of SEQ ID NOs: 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, or 368.

(183) In some embodiments, the isolated FN3 domain that binds EGFR comprises an initiator methionine (Met) linked to the N-terminus of the molecule.

(184) In some embodiments, the isolated FN3 domain that binds EGFR comprises an amino acid sequence that is 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one of the amino acid sequences of SEQ ID NOs: 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 348, 349, 350, 351, 352, 353, 354, 355, 356, 357, 358, 359, 360, 361, 362, 363, 364, 365, 366, 367, or 368. Percent identity can be determined using the default parameters to align two sequences using BlastP available through the NCBI website. The sequences of the FN3 peptides that bind to EGFR can be, for example, found in Table 5.

(185) TABLE-US-00007 TABLE 5 EGFR-binding FN3 domain sequences SEQ ID NO: EGFR Binding FN3 Domains (Sequences) 337 LPAPKNLVVSEVTEDSLRLSWADPHGFYDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 338 LPAPKNLVVSEVTEDSLRLSWTYDRDGYDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 339 LPAPKNLAASEVTEDSLRLSWGYNGDHPDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 340 LPAPKNLVVSEVTEDSLRLSWDDPRGFYESFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 341 LPAPKNLVVSEVTEDSLRLSWTWPYADLDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 342 LPAPKNLVVSEVTEDSLRLSWGYNGDHPDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 343 LPAPKNLVVSEVTEDSLRLSWDYDLGVYFDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 344 LPAPKNLVVSEVTEDSLRLSWDDPWAFYESFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 345 LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVLGSYVFEHDVMLPLSA EFTT 346 LPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVGEAI VLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AIFTT 347 LPAPKNLVVSEVTEDSARLSWTAPDAAFDSFLIQYQESEKVGEAI VLTVPGSERSYDLTGLKPGTEYTVSIYGVLGSYVFEHDVMLPLSA IFTT 348 LPAPKNLVVSEVTEDSLRLSWTWPYADLDSFLIQYQESEKVGEAI NLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLPLS AEFTT 349 LPAPKNLVVSEVTEDSARLSWADPHGFYDSFLIQYQESEKVGE AIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGL PLSAIFTT 350 LPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVGE AIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGLP LSAIFTT 351 LPAPKNLVVSEVTEDSARLSWDDPHAFYESFLIQYQESEKVGEA IVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGLPLS AIFTT 352 LPAPKNLVVSEVTEDSARLSWADPHGFYDSFLIQYQESEKVGE AIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGLP LSAIFTT 353 MLPAPKNLVVSEVTEDSLRLSWADPHGFYDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 354 MLPAPKNLVVSEVTEDSLRLSWTYDRDGYDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 355 MLPAPKNLVVSEVTEDSLRLSWGYNGDHFDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 356 MLPAPKNLVVSEVTEDSLRLSWDDPRGFYESFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 357 MLPAPKNLVVSEVTEDSLRLSWTWPYADLDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 358 MLPAPKNLVVSEVTEDSLRLSWGYNGDHFDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 359 MLPAPKNLVVSEVTEDSLRLSWDYDLGVYFDSFLIQYQESEKVG EAINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGL PLSAEFTT 360 MLPAPKNLVVSEVTEDSLRLSWDDPWAFYESFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAEFTT 361 MLPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVLGSYVFEHDVMLPL SAEFTT 362 MLPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVGE AIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LSAIFTT 363 MLPAPKNLVVSEVTEDSARLSWTAPDAAFDSFLIQYQESEKVGE AIVLTVPGSERSYDLTGLKPGTEYTVSIYGVLGSYVFEHDVMLPL SAIFTT 364 MLPAPKNLVVSEVTEDSLRLSWTWPYADLDSFLIQYQESEKVGE AINLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRGLP LS AEFTT 365 MLPAPKNLVVSEVTEDSARLSWADPHGFYDSFLIQYQESEKVG EAIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNMRG LPLSAIFTT 366 MLPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVG EAIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGL PLSAIFTT 367 MLPAPKNLVVSEVTEDSARLSWDDPHAFYESFLIQYQESEKVG EAIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGL PLSAIFTT 368 MLPAPKNLVVSEVTEDSARLSWADPHGFYDSFLIQYQESEKVG EAIVLTVPGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGL PLSAIFTT

(186) In some embodiments, the FN3 domain comprises two FN3 domains connected by a linker. The linker can be a flexible linker. The linker can be a short peptide sequence, such as those described herein. For example, the linker can be a G/S or G/A linker and the like. As provided herein, the linker can be, for example, (GS).sub.2, (SEQ ID NO:369), (GGGS).sub.2 (SEQ ID NO:370), (GGGGS).sub.5 (SEQ ID NO:371), (AP).sub.2 (SEQ ID NO:372), (AP).sub.5 (SEQ ID NO:373), (SEQ ID NO:374), (AP).sub.20 (SEQ ID NO:375) and A(EAAAK).sub.5AAA (SEQ ID NO:376). These are non-limiting examples and other linkers can also be used. The number of GGGGS or GGGGA repeats can also be 1, 2, 3, 4, or 5. In some embodiments, the linker comprises one or more GGGGS repeats and one or more GGGGA repeats.

(187) In some embodiments, the FN3 domains may bind CD71, EpCAM, or EGFR, as applicable, with a dissociation constant (K.sub.D) of less than about 1×10.sup.−7 M, for example less than about 1×10.sup.−8 M, less than about 1×10.sup.−9 M, less than about 1×10.sup.−10 M, less than about 1×10.sup.−11 M, less than about 1×10.sup.−12M, or less than about 1×10.sup.−13 M as determined by surface plasmon resonance or the Kinexa method, as practiced by those of skill in the art. The measured affinity of a particular FN3 domain-antigen interaction can vary if measured under different conditions (e.g., osmolarity, pH). Thus, measurements of affinity and other antigen-binding parameters (e.g., K.sub.D, K.sub.on, K.sub.off) are made with standardized solutions of protein scaffold and antigen, and a standardized buffer, such as the buffers described herein.

(188) In some embodiments, the FN3 domain may bind to its target protein at least 5-fold above the signal obtained for a negative control in a standard ELISA assay.

(189) In some embodiments, the FN3 domain that binds or specifically binds its target protein comprises an initiator methionine (Met) linked to the N-terminus of the molecule. In some embodiments, the FN3 domain that binds or specifically binds to its target protein comprises a cysteine (Cys) linked to a C-terminus of the FN3 domain The addition of the N-terminal Met and/or the C-terminal Cys may facilitate expression and/or conjugation of half-life extending molecules.

(190) The FN3 domain can also contain cysteine substitutions, such as those that are described in U.S. Pat. No. 10,196,446, which is hereby incorporated by reference in its entirety. Briefly, in some embodiments, the polypeptide comprising an FN3 domain can have an FN3 domain that has a residue substituted with a cysteine, which can be referred to as a cysteine engineered fibronectin type III (FN3) domain In some embodiments, the FN3 domain comprises at least one cysteine substitution at a position selected from the group consisting of residues 6, 8, 10, 11, 14, 15, 16, 20, 30, 34, 38, 40, 41, 45, 47, 48, 53, 54, 59, 60, 62, 64, 70, 88, 89, 90, 91, and 93 of the FN3 domain based on SEQ ID NO: 1 (LPAPKNLVVSEVTEDSLRLSWTAPDAAFDSFLIQYQESEKVGEAINLTVPGSERSYDLTG LKPGTEYTVSIYGVKGGHRSNPLSAEFTT, SEQ ID NO: 624) of U.S. Pat. No. 10,196,446, which is hereby incorporated by reference in its entirety, and the equivalent positions in related FN3 domains. A cysteine substitution at a position in the domain or protein comprises a replacement of the existing amino acid residue with a cysteine residue. Other examples of cysteine modifications can be found in, for example, U.S. Patent Application Publication No. 20170362301, which is hereby incorporated by reference in its entirety. The alignment of the sequences can be performed using BlastP using the default parameters at, for example, the NCBI website.

(191) In some embodiments, the FN3 domain that binds to the target protein is internalized into a cell. In some embodiments, internalization of the FN3 domain may facilitate delivery of a detectable label or therapeutic into a cell. In some embodiments, internalization of the FN3 domain may facilitate delivery of a cytotoxic agent into a cell. The cytotoxic agent can act as a therapeutic agent. In some embodiments, internalization of the FN3 domain may facilitate the delivery of any detectable label, therapeutic, and/or cytotoxic agent disclosed herein into a cell. In some embodiments, the cell is a tumor cell. In some embodiments, the cell is a liver cell or a lung cell. In some embodiments, the therapeutic is a siRNA molecule as provided for herein.

(192) As provided herein, the different FN3 domains that are linked to the siRNA molecule can also be conjugated or linked to another FN3 domain that binds to a different target. This would enable the molecule to be multi-specific (e.g. bi-specific, tri-specific, etc.), such that it binds to a first target and another, for example, target. In some embodiments, the first FN3 binding domain is linked to another FN3 domain that binds to an antigen expressed by a tumor cell (tumor antigen).

(193) In some embodiments, FN3 domains can be linked together by a linker to form a bivalent FN3 domain The linker can be a flexible linker. In some embodiments, the linker is a G/S linker. In some embodiments the linker has 1, 2, 3, or 4 G/S repeats. A G/S repeat unit is four glycines followed by a serine, e.g. GGGGS. Other examples of linkers are provided herein and can also be used.

(194) Without being bound to any particular theory, in some embodiments, the FN3 domains that are linked to the nucleic acid molecule may be used in the targeted delivery of the therapeutic agent to cells that express the binding partner of the one or more FN3 domains (e.g. tumor cells), and lead intracellular accumulation of the nucleic acid molecule therein. This can allow the siRNA molecule to properly interact with the cell machinery to inhibit the expression of the target gene and also avoid, in some embodiments, toxicity that may arise with untargeted administration of the same siRNA molecule.

(195) The FN3 domain described herein that bind to their specific target protein may be generated as monomers, dimers, or multimers, for example, as a means to increase the valency and thus the avidity of target molecule binding, or to generate bi- or multispecific scaffolds simultaneously binding two or more different target molecules. The dimers and multimers may be generated by linking monospecific, bi- or multispecific protein scaffolds, for example, by the inclusion of an amino acid linker, for example a linker containing poly-glycine, glycine and serine, or alanine and proline. Exemplary linker include (GS).sub.2, (SEQ ID NO:369), (GGGS).sub.2 (SEQ ID NO:370), (GGGGS).sub.5 (SEQ ID NO:371), (AP).sub.2 (SEQ ID NO:372), (AP).sub.5 (SEQ ID NO:373), (AP).sub.10 (SEQ ID NO:374), (AP).sub.20 (SEQ ID NO:375) and A(EAAAK).sub.5AAA (SEQ ID NO:376). The dimers and multimers may be linked to each other in a N- to C-direction. The use of naturally occurring as well as artificial peptide linkers to connect polypeptides into novel linked fusion polypeptides is well known in the literature (Hallewell et al., J Biol Chem 264, 5260-5268, 1989; Alfthan et al., Protein Eng. 8, 725-731, 1995; Robinson & Sauer, Biochemistry 35, 109-116, 1996; U.S. Pat. No. 5,856,456). The linkers described in this paragraph may be also be used to link the domains provided in the formula provided herein and above.

(196) Half-Life Extending Moieties

(197) The FN3 domains may also, in some embodiments, incorporate other subunits for example via covalent interaction. In some embodiments, the FN3 domains that further comprise a half-life extending moiety. Exemplary half-life extending moieties are albumin, albumin variants, albumin-binding proteins and/or domains, transferrin and fragments and analogues thereof, and Fc regions Amino acid sequences of the human Fc regions are well known, and include IgG1, IgG2, IgG3, IgG4, IgM, IgA and IgE Fc regions. In some embodiments, the FN3 domains that specifically bind CD22 may incorporate a second FN3 domain that binds to a molecule that extends the half-life of the entire molecule, such as, but not limited to, any of the half-life extending moieties described herein. In some embodiments, the second FN3 domain binds to albumin, albumin variants, albumin-binding proteins and/or domains, and fragments and analogues thereof.

(198) All or a portion of an antibody constant region may be attached to the FN3 domain to impart antibody-like properties, especially those properties associated with the Fc region, such as Fc effector functions such as C1q binding, complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), phagocytosis, down regulation of cell surface receptors (e.g., B cell receptor; BCR), and may be further modified by modifying residues in the Fc responsible for these activities (for review; see Strohl, Curr Opin Biotechnol. 20, 685-691, 2009).

(199) Additional moieties may be incorporated into the FN3 domains such as polyethylene glycol (PEG) molecules, such as PEG5000 or PEG20,000, fatty acids and fatty acid esters of different chain lengths, for example laurate, myristate, stearate, arachidate, behenate, oleate, arachidonate, octanedioic acid, tetradecanedioic acid, octadecanedioic acid, docosanedioic acid, and the like, polylysine, octane, carbohydrates (dextran, cellulose, oligo- or polysaccharides) for desired properties. These moieties may be direct fusions with the protein scaffold coding sequences and may be generated by standard cloning and expression techniques. Alternatively, well known chemical coupling methods may be used to attach the moieties to recombinantly produced molecules disclosed herein.

(200) A pegyl moiety may for example be added to the FN3 domain t by incorporating a cysteine residue to the C-terminus of the molecule, or engineering cysteines into residue positions that face away from the binding face of the molecule, and attaching a pegyl group to the cysteine using well known methods.

(201) FN3 domains incorporating additional moieties may be compared for functionality by several well-known assays. For example, altered properties due to incorporation of Fc domains and/or Fc domain variants may be assayed in Fc receptor binding assays using soluble forms of the receptors, such as the FcγRI, FcγRII, FcγRIII or FcRn receptors, or using well known cell-based assays measuring for example ADCC or CDC, or evaluating pharmacokinetic properties of the molecules disclosed herein in in vivo models.

(202) The compositions provided herein can be prepared by preparing the FN3 proteins and the nucleic acid molecules and linking them together. The techniques for linking the proteins to a nucleic acid molecule are known and any method can be used. For example, in some embodiments, the nucleic acid molecule is modified with a linker, such as the linker provided herein, and then the protein is mixed with the nucleic acid molecule comprising the linker to form the composition. For example, in some embodiments, a FN3 domains is conjugated to a siRNA a cysteine using thiol-maleimide chemistry. In some embodiments, a cysteine-containing FN3 domain can be reduced in, for example, phosphate buffered saline (or any other appropriate buffer) with a reducing agent (e.g. tris(2-carboxyethyl) phosphine (TCEP)) to yield a free thiol. Then, in some embodiments, the free thiol containing FN3 domain was mixed with a maleimide linked-modified siRNA duplex and incubated under conditions to form the linked complex. In some embodiments, the mixture is incubated for 0-5 hr, or about 1, 2, 3, 4 or 5 hr at RT. The reaction can be, for example, quenched with N-ethyl maleimide. In some embodiments, the conjugates can be purified using affinity chromatography and ion exchange. Other methods can also be used and this is simply one non-limiting embodiment.

(203) Methods of making FN3 proteins are known and any method can be used to produce the protein. Examples are provided in the references incorporated by reference herein.

(204) Kits

(205) In some embodiments, a kit comprising the compositions described herein are provided.

(206) The kit may be used for therapeutic uses and as a diagnostic kit.

(207) In some embodiments, the kit comprises the FN3 domain conjugated to the nucleic acid molecule.

(208) Uses of the Conjugates FN3 Domains

(209) The compositions provided for herein may be used to diagnose, monitor, modulate, treat, alleviate, help prevent the incidence of, or reduce the symptoms of human disease or specific pathologies in cells, tissues, organs, fluid, or, generally, a host.

(210) In some embodiments, a method of treating a subject having cancer is provided, the method comprising administering to the subject a composition provided for herein.

(211) In some embodiments, the subject has a solid tumor.

(212) In some embodiments, the solid tumor is a melanoma.

(213) In some embodiments, the solid tumor is a lung cancer. In some embodiments, the solid tumor is a non-small cell lung cancer (NSCLC). In some embodiments, the solid tumor is a squamous non-small cell lung cancer (NSCLC). In some embodiments, the solid tumor is a non-squamous NSCLC. In some embodiments, the solid tumor is a lung adenocarcinoma.

(214) In some embodiments, the solid tumor is a renal cell carcinoma (RCC).

(215) In some embodiments, the solid tumor is a mesothelioma.

(216) In some embodiments, the solid tumor is a nasopharyngeal carcinoma (NPC).

(217) In some embodiments, the solid tumor is a colorectal cancer.

(218) In some embodiments, the solid tumor is a prostate cancer. In some embodiments, the solid tumor is castration-resistant prostate cancer.

(219) In some embodiments, the solid tumor is a stomach cancer.

(220) In some embodiments, the solid tumor is an ovarian cancer.

(221) In some embodiments, the solid tumor is a gastric cancer.

(222) In some embodiments, the solid tumor is a liver cancer.

(223) In some embodiments, the solid tumor is pancreatic cancer.

(224) In some embodiments, the solid tumor is a thyroid cancer.

(225) In some embodiments, the solid tumor is a squamous cell carcinoma of the head and neck.

(226) In some embodiments, the solid tumor is a carcinomas of the esophagus or gastrointestinal tract.

(227) In some embodiments, the solid tumor is a breast cancer.

(228) In some embodiments, the solid tumor is a fallopian tube cancer.

(229) In some embodiments, the solid tumor is a brain cancer.

(230) In some embodiments, the solid tumor is an urethral cancer.

(231) In some embodiments, the solid tumor is a genitourinary cancer.

(232) In some embodiments, the solid tumor is an endometriosis.

(233) In some embodiments, the solid tumor is a cervical cancer.

(234) In some embodiments, the solid tumor is a metastatic lesion of the cancer.

(235) In some embodiments, the subject has a hematological malignancy.

(236) In some embodiments, the hematological malignancy is a lymphoma, a myeloma or a leukemia. In some embodiments, the hematological malignancy is a B cell lymphoma. In some embodiments, the hematological malignancy is Burkitt's lymphoma. In some embodiments, the hematological malignancy is Hodgkin's lymphoma. In some embodiments, the hematological malignancy is a non-Hodgkin's lymphoma.

(237) In some embodiments, the hematological malignancy is a myelodysplastic syndrome.

(238) In some embodiments, the hematological malignancy is an acute myeloid leukemia (AML). In some embodiments, the hematological malignancy is a chronic myeloid leukemia (CML). In some embodiments, the hematological malignancy is a chronic myelomoncytic leukemia (CMML).

(239) In some embodiments, the hematological malignancy is a multiple myeloma (MM).

(240) In some embodiments, the hematological malignancy is a plasmacytoma.

(241) In some embodiments, methods of treating cancer in a subject in need thereof are provided. In some embodiments, the methods comprise administering to the subject any composition provided herein. In some embodiments, a use of a composition as provided herein are provided in the preparation of a pharmaceutical composition or medicament for treating cancer. In some embodiments, the composition can be used for treating cancer.

(242) In some embodiments, methods of reducing the expression of a target gene in a cell are provided. In some embodiments, the methods comprise contacting the cell with a composition a composition as provided herein. In some embodiments, the cell is contacted ex-vivo. In some embodiments, the cell is contacted in-vivo. In some embodiments, the target gene is KRAS. The target gene, however, can be any target gene as the evidence provided herein demonstrates that siRNA molecules can be delivered efficiently when conjugated to a FN3 domain.

(243) In some embodiments, methods of delivering a siRNA molecule to a cell in a subject are provided. In some embodiments, the methods comprise administering to the subject a pharmaceutical composition comprising a composition as provided for herein. In some embodiments, the cell is a CD71 positive cell. In some embodiments, the cell is an EpCAM positive cell. In some embodiments, the cell is an EGFR positive cell. In some embodiments, the cell is a CD71 positive cell and an EpCAM positive cell. In some embodiments, the cell is also positive for EGFR. The term “positive cell” in reference to a protein refers to a cell that expresses the protein. In some embodiments, the protein is expressed on the cell surface. In some embodiments, the cell is a muscle cell, a brain cell, or a cell inside the blood brain barrier. In some embodiments, the siRNA downregulates the expression of a target gene in the cell. In some embodiments, the target gene is KRAS. In some embodiments, the KRAS has a mutation. In some embodiments, the mutation in KRAS is a G12C, G12V, G12S or G12D mutation.

(244) In some embodiments, the compositions provided herein may be used to diagnose, monitor, modulate, treat, alleviate, help prevent the incidence of, or reduce the symptoms of human disease or specific pathologies in cells, tissues, organs, fluid, or, generally, a host, also exhibit the property of being able to cross the blood brain barrier. The blood-brain barrier (BBB) prevents most macromolecules (e.g., DNA, RNA, and polypeptides) and many small molecules from entering the brain. The BBB is principally composed of specialized endothelial cells with highly restrictive tight junctions, consequently, passage of substances, small and large, from the blood into the central nervous system is controlled by the BBB. This structure makes treatment and management of patients with neurological diseases and disorders (e.g., brain cancer) difficult as many therapeutic agents cannot be delivered across the BBB with desirable efficiency. Additional conditions that involve disruptions of the BBB include: stroke, diabetes, seizures, hypertensive encephalopathy, acquired immunodeficiency syndrome, traumatic brain injuries, multiple sclerosis, Parkinson's disease (PD) and Alzheimer disease. This ability is especially useful for treating brain cancers including for example: astrocytoma, medulloblastoma, glioma, ependymoma, germinoma (pinealoma), glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, and congenital tumors; or a cancer of the spinal cord, e.g., neurofibroma, meningioma, glioma, and sarcoma. In certain embodiments, the compositions provided for herein can be used to deliver a therapeutic or cytotoxic agent, for example, across the blood brain barrier. In certain embodiments, the compositions provided for herein can be used to deliver a therapeutic or cytotoxic agent, for example, across the blood brain barrier.

(245) In some embodiments, the compositions or pharmaceutical compositions provided herein may be administered alone or in combination with other therapeutics, that is, simultaneously or sequentially. In some embodiments, the other or additional therapeutics are other anti-tumor agent or therapeutics. Different tumor types and stages of tumors can require the use of various auxiliary compounds useful for treatment of cancer. For example, the compositions provided herein can be used in combination with various chemotherapeutics such as taxol, tyrosine kinase inhibitors, leucovorin, fluorouracil, irinotecan, phosphatase inhibitors, MEK inhibitors, among others. The composition may also be used in combination with drugs which modulate the immune response to the tumor such as anti-PD-1 or anti-CTLA-4, among others. Additional treatments can be agents that modulate the immune system, such antibodies that target PD-1 or PD-L1.

(246) “Treat” or “treatment” refers to the therapeutic treatment and prophylactic measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the development or spread of cancer. In some embodiments, beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.

(247) A “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount of the compositions provided herein may vary according to factors such as the disease state, age, sex, and weight of the individual. Exemplary indicators of an effective amount is improved well-being of the patient, decrease or shrinkage of the size of a tumor, arrested or slowed growth of a tumor, and/or absence of metastasis of cancer cells to other locations in the body.

(248) Administration/Pharmaceutical Compositions

(249) In some embodiments, pharmaceutical compositions of the compositions provided herein and a pharmaceutically acceptable carrier, are provided. For therapeutic use, the compositions may be prepared as pharmaceutical compositions containing an effective amount of the domain or molecule as an active ingredient in a pharmaceutically acceptable carrier. “Carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the active compound is administered. Such vehicles can be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. For example, 0.4% saline and 0.3% glycine can be used. These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration). The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc. The concentration of the molecules disclosed herein in such pharmaceutical formulation can vary widely, i.e., from less than about 0.5%, usually at least about 1% to as much as 15 or 20% by weight and will be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected. Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin, are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21.sup.st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, Pa. 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.

(250) The mode of administration for therapeutic use of the compositions disclosed herein may be any suitable route that delivers the agent to the host, such as parenteral administration, e.g., intradermal, intramuscular, intraperitoneal, intravenous or subcutaneous, pulmonary; transmucosal (oral, intranasal, intravaginal, rectal), using a formulation in a tablet, capsule, solution, powder, gel, particle; and contained in a syringe, an implanted device, osmotic pump, cartridge, micropump; or other means appreciated by the skilled artisan, as well known in the art. Site specific administration may be achieved by for example intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracelebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intracardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravascular, intravesical, intralesional, vaginal, rectal, buccal, sublingual, intranasal, or transdermal delivery.

(251) Pharmaceutical compositions can be supplied as a kit comprising a container that comprises the pharmaceutical composition as described herein. A pharmaceutical composition can be provided, for example, in the form of an injectable solution for single or multiple doses, or as a sterile powder that will be reconstituted before injection. Alternatively, such a kit can include a dry-powder disperser, liquid aerosol generator, or nebulizer for administration of a pharmaceutical composition. Such a kit can further comprise written information on indications and usage of the pharmaceutical composition.

EXAMPLES

(252) The following examples are illustrative of the embodiments disclosed herein. These examples are provided for the purpose of illustration only and the embodiments should in no way be construed as being limited to these examples, but rather should be construed to encompass any and all variations which become evidence as a result of the teaching provided herein. Those of skill in the art will readily recognize a variety of non-critical parameters that could be changed or modified to yield essentially similar results.

(253) Example 1: The siRNA sequence pairs, provided in Table 6, were made according to routine synthetic methods. The oligonucleotides were ordered from Axolabs GmbH, and Bio-Synthesis Inc. The oligonucleotides were confirmed by routine techniques.

(254) TABLE-US-00008 TABLE 6 siRNA Sense and Anti-sense Sequence Pairs siRNA SEQ SEQ Pair ID NO Sense Strand 5′-3  ID NO Anti-sense strand 5′-3′ A 10 cscsUfgucUfCfUfugGfauauUf 11 UfsGfsaauauccaagaGfaca ca(invdT) ggsusu B 12 CsasGfcuaAfUfUfcaGfaaucAf 13 UfsAfsugauucugaauUfagc ua(invdT) ugsusu C 14 GsasAfuuaGfCfufguAfucguCf 15 UfsUfsgacgauacagcUfaau aa(invdT) ucsusu D 16 CfscsUfgUfcUfCfUfuGfgauAf 17 usGfsaAfuAfUfCfcAfaga uUfcAf(invdT) GfaCfaGfgsUfsu E 18 csAfsgCfuAfaUfUfCfaGfaauC 19 usAfsuGfaUfUfCfuGfaau fuAfuAf(invdt) UfaGfcUfgsUfsu F 20 GfsasAfuUfaGfCfUfgUfaucGf 21 usUfsgAfcGfAfUfacaGfc uCfaAf(invdt) UfaAfuUfcsUfsu G 22 CfscsUfgUfcUfcUfuGfgAfuAf 23 usGfsaAfuAfuCfcAfaGfa uUfcAf(invdT) GfaCfaGfgsUfsu H 24 csAfsgCfuAfaUfuCfaGfaAfuC 25 UfsasUfgAfuUfcUfgAfaU faUfa(invdt) fuAfgCfgsUfsu I 26 gsAfsaUfuAfgCfuGfuAfuCfg 27 UfsusGfaCfaUfaCfaGfcU UfcAfa(invdt) faAfuUfcsUfsu J 28 cscsUfgucUfCfUfugGfauauUf 29 UfsGfsaauauccaagaGfaca ca(invdt) ggsusu K 30 csasGfcuaAfUfUfcaGfaaucAf 31 UfsAfsugauucugaauUfagc ua(invdt) ugsusu L 32 gsasAfuuaGfCfUfguAfucguCf 33 UfsUfsgacgauacagcUfaau aa(invdt) ucsusu M 34 csasGfcuaAfUfUfcaGfaaucAf 35 UfsAfsugauucugaauUfagc ua(invdT) ugsusu N 36 asusAfuaaAfCfUfugUfgguaGf 37 UfsAfscuaccacaaguUfuau ua(invdT) aususu O 38 usasAfacuUfGfUfggUfaguuGf 39 UfsCfscaacuaccacaAfguu ga(invdT) uasusu P 40 csasAfgagUfGfCfcuUfgacgAf 41 UfsAfsucgucaaggcaCfucu ua(invdT) ugsusu Q 42 gscsCfuugAfCfGfauAfcagcUf 43 UfsUfsagcuguaucguCfaag aa(invdT) gcsusu R 44 usgsAfcgaUfAfCfagCfuaauUf 45 UfsGfsaauuagcuguaUfcgu ca(invdT) casusu S 46 csgsAfuacAfGfCfuaAfuucaGf 47 UfsUfscugaauu agcuGfu au aa(invdT) cgsusu T 48 gsusGfgacGfAfAfuaUfgaucCf 49 UfsUfsggaucauauucGfucc aa(invdT) acsusu U 50 gsgsAfcgaAfUfAfugAfuccaAf 51 UfsGfsuuggaucauauUfcgu ca(invdT) ccsusu V 52 gsasCfgaaUfAfUfgaUfccaaCfa 53 UfsUfsguuggaucauaUfucg a(invdT) ucsusu W 54 ascsGfaauAfUfGfauCfcaacAfa 55 UfsUfsuguuggaucauAfuu a(invdT) cgususu X 56 csgsAfauaUfGfAfucCfaacaAf 57 UfsAfsuuguuggaucaUfau ua(invdT) ucgsusu Y 58 asasUfaugAfUfCfcaAfcaauAf 59 UfsCfsuauuguuggauCfaua ga(invdT) uususu Z 60 gsasUfccaAfCfAfauAfgaggAf 61 UfsAfsuccucuauuguUfgga ua(invdT) ucsusu AA 62 cscsAfacaAfUfAfgaGfgauuCf 63 UfsGfsgaauccucuauUfguu ca(invdT) ggsusu BB 64 csusAfcagGfAfAfgcAfaguaGf 65 UfsAfscuacuugcuucCfugu ua(invdT) agsusu CC 66 ascsAfggaAfGfCfaaGfuaguAf 67 UfsUfsuacuacuugcuUfccu aa(invdT) gususu DD 68 gsusAfauuGfAfUfggAfgaaaCf 69 UfsGfsguuucuccaucAfauu ca(invdT) acsusu EE 70 csusUfggaUfAfUfucUfcgacAf 71 UfsGfsugucgagaauaUfcca ca(invdT) agsusu FF 72 csasGfcagGfUfCfaaGfaggaGf 73 UfsAfscuccucuugacCfugc ua(invdT) ugsusu GG 74 gscsAfaugAfGfGfgaCfcaguAf 75 UfsGfsuacuggucccuCfauu ca(invdT) gcsusu HH 76 csasAfugaGfGfGfacCfaguaCf 77 UfsUfsguacuggucccUfcau aa(invdT) ugsusu II 78 ususUfgugUfAfUfuuGfccauAf 79 UfsUfsuauggcaaauaCfaca aa(invdT) aasusu JJ 80 ususGfccaUfAfAfauAfauacUf 81 UfsUfsaguauuauuuaUfggc aa(invdT) aasusu KK 82 usgsCfcauAfAfAfuaAfuacuAf 83 UfsUfsuaguauuauuuAfug aa(invdT) gcasusu LL 84 cscsAfuaaAfUfAfauAfcuaaAf 85 UfsAfsuuuaguauuauUfua ua(invdT) uggsusu MM 86 csasUfaaaUfAfAfuaCfuaaaUfc 87 UfsGfsauuuaguauuaUfuua a(invdT) ugsusu NN 88 asusAfaauAfAfUfacUfaaauCf 89 UfsUfsgauuuaguauuAfuu aa(invdT) uaususu OO 90 gsasAfgauAfUfUfcaCfcauuAf 91 UfsAfsuaauggugaauAfucu ua(invdT) ucsusu PP 92 asgsAfuauUfCfAfccAfuuauAf 93 UfsCfsuauaauggugaAfuau ga(invdT) cususu QQ 94 asusAfuucAfCfCfauUfauagAf 95 UfsCfsucuauaaugguGfaau ga(invdT) aususu RR 96 asgsAfacaAfAfUfuaAfaagaGf 97 UfsAfscucuuuuaauuUfgu ua(invdT) ucususu SS 98 gsasCfucuGfAfAfgaUfguacCf 99 UfsAfsgguacaucuucAfgag ua(invdT) ucsusu TT 100 csusGfaagAfUfGfuaCfcuauGf 101 UfsCfscauagguacauCfuuc ga(invdT) agsusu UU 102 asgsAfacaGfUfAfgaCfacaaAfa 103 UfsUfsuuugugucuacUfgu a(invdT) ucususu VV 104 csasGfgacUfUfAfgcAfagaaGf 105 UfsAfscuucuugcuaaGfucc ua(invdT) ugsusu WW 106 gsusUfgauGfAfUfgcCfuucuAf 107 UfsAfsuagaaggcaucAfuca ua(invdT) acsusu XX 108 asusGfaugCfCfUfucUfauacAf 109 UfsAfsuguauagaaggCfauc ua(invdT) aususu YY 110 usgsAfugcCfUfUfcuAfuacaUf 111 UfsAfsauguauagaagGfcau ua(invdT) casusu ZZ 112 gsasUfgccUfUfCfuaUfacauUf 113 UfsUfsaauguauagaaGfgca aa(invdT) ucsusu AAA 114 asusGfccuUfCfUfauAfcauuAf 115 UfsCfsuaauguauagaAfggc ga(invdT) aususu BBB 116 csusUfcuaUfAfCfauUfaguuCf 117 UfsCfsgaacuaauguaUfaga ga(invdT) agsusu CCC 118 UscsUfauaCfAfUfuaGfuucgAf 119 UfsCfsucgaacuaaugUfaua ga (invdT) gasusu DDD 120 UsasUfacaUfUfAfguUfcgagAf 121 UfsUfsucucgaacuaaUfgua aa(invdT) uasusu EEE 122 AsusAfcauUfAfGfuuCfgagaA 123 UfsUfsuucucgaacuaAfugu faa(invdT) aususu FFF 124 UsasCfauuAfGfUfucGfagaaAf 125 UfsAfsuuucucgaacuAfaug ua(invdT) uasusu GGG 126 UsusAfguuCfGfAfgaAfauucG 127 UfsUfscgaauuucucgAfacu faa(invdT) aasusu HHH 128 AsgsUfucgAfGfAfaaUfucgaA 129 UfsUfsuucgaauuucuCfgaa faa(invdT) cususu III 130 AsgsAfaauUfCfGfaaAfacauAf 131 UfsUfsuauguuuucgaAfuu aa(invdT) ucususu JJJ 132 GsasAfauuCfGfAfaaAfcauaAf 133 UfsUfsuuauguuuucgAfau aa(invdT) uucsusu KKK 134 AsasAfuucGfAfAfaaCfauaaAf 135 UfsCfsuuuauguuuucGfaau ga(invdT) uususu LLL 136 AsasUfucgAfAfAfacAfuaaaGf 137 UfsUfscuuuauguuuuCfgaa aa(invdT) uususu MMM 138 AsusGfagcAfAfAfgaUfgguaA 139 UfsUfsuuaccaucuuuGfcuc faa(invdT) aususu NNN 140 AsgsCfaaaGfAfUfggUfaaaaAf 141 UfsCfsuuuuuaccaucUfuug ga(invdT) cususu OOO 142 AsusUfucuGfUfCfuuGfggguU 143 UfsAfsaaccccaagacAfgaa fua(invdT) aususu PPP 144 GsgsGfuuuUfUfGfguGfcaugC 145 UfsUfsgcaugcaccaaAfaac faa(invdT) ccsusu QQQ 146 CsgsCfacaAfGfGfcaCfugggUf 147 UfsUfsacccagugccuUfgug aa(invdT) cgsusu RRR 148 GscsAfcaaGfGfCfacUfggguAf 149 UfsAfsuacccagugccUfugu ua(invdT) gcsusu SSS 150 csUfsCfUfuGfgauAfuUfcAf 151 usGfsasAfsusAfUfCfcAfa (invdT) gaGfaCfaGfgsUfsu TTT 152 AfsasUfUfCfaGfaauCfuAfuAf 153 usAfsusGfsasUfUfCfuGfa (invdt) auUfaGfcUfgsUfsu UUU 154 AfsasUfUfCfaGfaauCfuAfuAf 155 usAfsusGfsasUfUfCfuGfa (invdt) auUfaGfcUfgsUfsu VVV 156 csUfscUfuGfgAfuAfuUfcAf 157 usGfsaAfsusAfsuCfcAfa (invdT) GfaGfaCfaGfgsUfsu- WWW 158 AfsasUfuCfaGfaAfuCfaUfa 159 UfsasUfsgsAfsuUfcUfgAf (invdt) aUfuAfgCfgsUfsu XXX 160 AfsgsCfuGfuAfuCfgUfcAfa 161 UfsusGfsasCfsaUfaCfaGf (invdt) cUfaAfuUfcsUfsu YYY 162 csUfsCfUfugGfauauUfca 163 UfsGfsasasusauccaagaGfa (invdt)- caggsusu ZZZ 164 asAfsUfUfcaGfaaucAfua(invdt) 165 UfsAfsusgs asuucugaauUf agcugsusu AAAA 166 asGfsCfUfguAfucguCfaa(invdt) 167 UfsUfsgsascsgauacagcUfa auucsusu BBBB 168 CfscsUfgUfcUfCfUfuGfgauAf 169 usGfsaAfuAfUfCfcAfaga gUfcAf(invdT)- GfaCfaGfgsUfsu CCCC 170 csAfsgCfuAfaUfUfCfaGfaauC 171 usAfsuGfaUfUfCfuGfaau fgAfuAf(invdt)- UfaGfcUfgsUfsu- DDDD 172 GfsasAfuUfaGfUfgUfaucGfg 173 usUfsgAfcGfAfUfacaGfc CfaAf(invdt) UfaAfuUfcsUfsu- EEEE 174 CfscsUfgUfcUfcUfuGfgAfuAf 175 usGfsaAfuAfuCfcAfaGfa gUfcAf(invdT)- GfaCfaGfgsUfsu FFFF 176 csAfsgCfuAfaUfuCfaGfaAfgC 177 UfsasUfgAfuUfcUfgAfaU faUfa(invdt) fuAfgCfgsUfsu GGGG 178 gsAfsaUfuAfgCfuGfuAfuCfg 179 UfsusGfaCfaUfaCfaGfcU UfcAfa(invdt) faAfuUfcsUfsu HHHH 180 cscsUfgucUfCfUfugGfauagUf 181 UfsGfsaauauccaagaGfaca ca(invdt) ggsusu IIII 182 csasGfcuaAfUfUfcaGfaagcAf 183 UfsAfsugauucugaauUfagc ua(invdt) ugsusu JJJJ 184 gsasAfuuaGfCfUfguAfucggCf 185 UfsUfsgacgauacagcUfaau aa(invdt) ucsusu KKKK 212 CcsAcsrGrCrUrArArUrUrCrA 213 (vinyl- rGrArArU rCrAsT.sub.CsA.sub.C p)sAfsuGfaUfUfCfuGfaa uUfaGfcUf gUfsasUf LLLL 214 CfsasGfcUfaAfUfUfcAfgaaUf 215 (vinyl-p)- cAfua sAfsuGfaUfUfCfuGfaauU faGfcUfgUfsasUf MMMM 216 csasrGrCrUrArArUrUrCrArGr 217 (vinyl- ArArUrCrAsusa p)sAfsuGfaUfUfCfuGfaa uUfaGfcUfgUfsasUf Abbreviations Key: n = 2′-O-methyl residues, Nf = 2′-F residues, rN = unmodified residue, N.sub.C = 2′,4′-BNA.sup.NC (2′-O,4′-C-aminomethylene bridged nucleic acid), s = phosphorothioate, (invdt) = inverted Dt, vinyl-p: (E)-vinylphosphonate, (n/N = any nucleotide)

(255) Certain siRNAs were evaluated in a HEK-293 rLUC-KRAS reporter assay at 24 hours. siRNAs were delivered by lipofection. EnduRen luciferase substrate was used to generate the luminescent signal. Briefly, a synthetic lentiviral expression vector was constructed so that the DNA sequence encoding the human KRAS open reading frame was fused to the DNA sequence encoding Renilla luciferase. This results in a fusion mRNA from which the luciferase protein can be translated. Candidate siRNA sequences targeting the KRAS open reading frame are evaluated for their ability to induce RNAi in the luciferase-KRAS fusion mRNA. Luciferase signal is quantified using EnduRen live cell luciferase substrate (Promega). Stable cell lines expressing the luciferase reporter in HEK-293 and H358 cells were used to assess candidate siRNAs (Table 7), siRNAs attached to linker sequences (Table 8) and FN3-siRNA conjugates (Table 10).

(256) TABLE-US-00009 TABLE 7 Results of siRNA Knockdown of Luciferase SEQ Percent ID SEQ ID knockdown NO NO of luciferase siRNA Sense Antisense signal Pair Strand strand at 10 pM N 36 37 >30 O 38 39 <30 P 40 41 >30 Q 42 43 <30 R 44 45 <30 S 46 47 >30 M 34 35 >30 T 48 49 >30 U 50 51 >30 V 52 53 >30 W 54 55 <30 X 56 57 >30 Y 58 59 <30 Z 60 61 <30 AA 62 63 >30 BB 64 65 >30 CC 66 67 >30 DD 68 69 <30 EE 70 71 <30 FF 72 73 <30 GG 74 75 <30 HH 76 77 <30 II 78 79 <30 JJ 80 81 >30 KK 82 83 >30 LL 84 85 >30 MM 86 87 >30 NN 88 89 <30 OO 90 91 >30 PP 92 93 >30 QQ 94 95 <30 RR 96 97 <30 SS 98 99 <30 TT 100 101 <30 UU 102 103 >30 VV 104 105 <30 WW 106 107 <30 XX 108 109 <30 YY 110 111 <30 ZZ 112 113 <30 AAA 114 115 <30 BBB 116 117 <30 CCC 118 119 <30 DDD 120 121 <30 EEE 122 123 <30 FFF 124 125 <30 GGG 126 127 <30 HHH 128 129 <30 III 130 131 <30 JJJ 132 133 <30 KKK 134 135 <30 LLL 136 137 <30 MMM 138 139 <30 NNN 140 141 <30 SSS 150 151 <30 TTT 152 153 >30 UUU 154 155 <30 VVV 156 157 <30 WWW 158 159 >30 XXX 160 161 <30 YYY 162 163 >30 ZZZ 164 165 <30 AAAA 166 167 >30 BBBB 168 169 <30 CCCC 170 171 >30 DDDD 172 173 >30 EEEE 174 175 <30 FFFF 176 177 >30 GGGG 178 179 >30 HHHH 180 181 >30 IIII 182 183 >30 JJJJ 184 185 >30

(257) siRNA linker and vinyl phosphonates were generated according to known methods. The siRNA linker and modified strands made are provided in Table 8.

(258) TABLE-US-00010 TABLE 8 Pairs with Linker and/or Vinyl Phophosphonate SEQ ID SEQ NO Sense 5-3 ID NO Antisense 5-3 Linker AB01 186 L- 187 (vinyl-p)- mal- cscsUfgucUfCfUfugGfa UfsGfsaauauccaaga NH—(CH2)6— uauUfca(invdT) Gfacaggsusu AB02 188 L- 189 (vinyl-p)- mal- csasGfcuaAfUfUfcaGfa UfsAfsugauucugaa NH—(CH2)6— aucAfua(invdT) uUfagcugsusu AB03 190 CfsasGfcUfaAfUfUfcAf 191 (vinyl-p)- mal- gaaUfcAfua-L sAfsuGfaUfUfCfu C2H4CONH—(CH2)6— GfaauUfaGfcUfgUf sasUf AB04 192 CfsasGfcUfaAfuUfcAfg 193 (vinyl-p)- mal- AfaUfcAfua-L sAfsuGfaUfuCfuGf C2H4CONH—(CH2)6— aAfuUfaGfcUfgUfs asUf AB05 194 (L)cscsUfgucUfCfUfug 195 (vinu)sGfsaauaucca mal- GfauauUfca(invdT) agaGfacaggsusu C2H4CONH—(CH2)6— AB06 196 (L)csasGfcuaAfUfUfca 197 (vinu)sAfsugauucu mal- GfaaucAfua gaauUfagcugsusu C2H4CONH—(CH2)6— AB07 198 (L)cscsUfgUfcUfcUfuG 199 (vinu)sGfsaAfuAfu mal- fgAfuAfuUfcAf(invdT) CfcAfaGfaGfaCfag C2H4CONH—(CH2)6— gsusu AB08 200 cscsUfgucUfCfUfugGfa 201 (vinu)sGfsaauaucca mal- uauUfca(L) agaGfacaggsusu C2H4CONH—(CH2)6— AB09 202 (L)cscsUfgucUfCfUfug 203 (vinu)sGfsaauaucca (Mal- GfauauUfca(invdT) agaGfacaggsusu PEG12)(NHC6) AB10 204 CfscsUfgUfcUfCfUfuGf 205 (vinu)sGfsaAfuAfU Propyl_linker gauAfuUfcAf(L)- fCfcAfagaGfaCfaG fgsUfsu AB11 206 CfsasGfcUfaAfUfUfcAf 207 vinu)sAfsuGfaUfUf Propyl_linker gaaUfcAfuAf(L)- CfuGfaaufaGfcfgs Ufsu- AB12 208 usUfsgAfcGfaUfaCfAf 209 vinu)sGfsaAfuUfAf Propyl_linker GfcUfaauUfcAfuAf(L) GfcfguaUfcGfuCfa AfsgsGf AB13 210 (vinu)CfsasGfcUfaAfUf 211 AfsuGfaUfUfCfuG (Amc6- UfcAfgaaUfcAfua faauUfaGfcUfgUfs Glen)[BMPS- asUf-L Mal] AB14 218 C.sub.CsA.sub.CsrGrCrUrArArUr 219 (vinyl- UrCrArGrArArU p)sAfsuGfaUfUfCf rCrAsT.sub.CsA.sub.C uGfaauUfaGfcUf gUfsasUf AB15 220 X- 221 (vinyl-p)- mal- CfsasGfcUfaAfUfUfcAf sAfsuGfaUfUfCfu C.sub.2H.sub.4C(O)(NH)—(CH.sub.2).sub.6 gaaUfcAfua-L GfaauUfaGfcUfgUf sasUf AB16 222 csasrGrCrUrArArUrUr 223 (vinyl- mal- CrArGrArArUrCrAsusa- p)sAfsuGfaUfUfCf C.sub.2H.sub.4C(O)(NH)—(CH.sub.2).sub.6 (L) uGfaauUfaGfcUfg UfsasUf Abbreviations Key: n = 2′-O-methyl residues, Nf = 2′-F residues, rN = unmodified residue, N.sub.C = 2′,4′-BNA.sup.NC (2′-O,4′-C-aminomethylene bridged nucleic acid), s = phosphorothioate, (invdt) = inverted Dt, Vinu = vinylphosphonate, vinyl-p = (E)-vinylphosphonate, (L) is a linker, embedded image

(259) The sequences with the linkers and/or vinyl phosphonate modified sequences were then evaluated in HEK-293 rLUC-KRAS reporter assay at 24 hours as described above. NAC-quenched linkers were delivered to cells by lipofection. EnduRen luciferase substrate was used to generate the luminescent signal. EC50s and Emax were calculated using Graphpad Prism software. Results provided in Table 9.

(260) TABLE-US-00011 TABLE 9 siRNA linker and vinyl phosphonates Results siRNA Pair EC50 Identifier (pM) Emax (%) AB03 66.98 72.37 AB05 94.6 80.92 AB06 217.2 69.69 AB07 377.9 79.96 AB08 157.2 79.56 AB09 137.5 77.42 AB10 263.7 73.61 AB11 125 73.75 AB12 167 62.97

(261) FN3-siRNA Conjugates are active. FN3-siRNA conjugates are prepared in H358 KRAS-luciferase reporter line. H358 cells expressing the Renilla luciferase-KRAS reporter were treated with FN3-siRNA conjugates for 72 hours. The luciferase assay is described above. EnduRen luciferase substrate was used to generate the luminescent signal. EC50s and Emax were calculated using Graphpad Prism software. FN3 domains were conjugated to siRNA via unique cysteines using thiol-maleimide chemistry. Cysteine-containing FN3 domains in PBS were reduced with tris(2-carboxyethyl) phosphine (TCEP) to yield free thiol. Free thiol containing the FN3 domain was mixed with maleimide linked-modified siRNA duplex, incubated for 2 hr incubation at RT and quenched with N-ethyl maleimide. Conjugates were purified using affinity chromatography and ion exchange. FN3-siRNA conjugate homogeneity was confirmed by SDS-PAGE, analytical SEC and liquid chromatography/mass spectrometry (LC/MS). Results provided in Table 10.

(262) TABLE-US-00012 TABLE 10 FN3-siRNA Conjugate Results FN3 H358-rLuc- H358-rLuc- Domain KRAS EC50 KRAS Emax SEQ ID FN3-siRNA Conjugate (nM) (%) 377 EGFR-KRAS siRNA (AB03) 0.13 77.3 378 CD71-KRAS (AB03) 3.51 88.4 379 EPCAM12/H9-KRAS siRNA 0.12 88.0 (AB03) 380 TENCON (Control)-KRAS 9.20 90.5 siRNA (AB03) 381 CD71/CD71 (CD71_32)- 0.059 91.9 KRAS siRNA (AB03) 382 CD71/CD71/ABD-KRAS 0.41 92.6 siRNA (AB03) 383 EPCAM/EPCAM/ABD-KRAS 0.32 77.0 siRNA (AB03) 384 EPCAM/CD71/ABD-KRAS 0.20 88.8 siRNA (AB03)v1 385 EPCAM/CD71/ABD-KRAS 0.12 89.7 siRNA (AB03)v2 386 EPCAM/EPCAM_ABDcon N.D. N.D. KRAS siRNA (AB03) 387 EPCAM/EPCAM/ABD-KRAS N.D. N.D. siRNA (AB03) 388 EpCAM/CD71/ABD_V2_ N.D. N.D. KRAS siRNA (AB03) 389 CD71/EpCAM/ABD_KRAS N.D. N.D. siRNA (AB03) 390 EpCAM_CD71_ABD N.D. N.D. 391 EpCAM/EpCAM/CD71/ABD_ N.D. N.D. KRAS siRNA (AB03) 392 EPCAM/CD71/EPCAM- N.D. N.D. KRAS siRNA (AB03)

(263) Sequences of FN3 Domains referenced in the table above that were conjugated to the siRNA or as shown as controls are provided in Table 11.

(264) TABLE-US-00013 TABLE 11 Sequences of FN3 domains SEQ ID SEQUENCE 377 MLPAPKNLVVSEVTEDSARLSWDDPWAFYESFLIQYQESEKVGEAIVLTV PGSERSYDLTGLKPGTEYTVSIYGVHNVYKDTNIRGLPLSAIFTT 378 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGHGEAIVLTV PGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTT 379 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFHIEYWEQSIV GEAIVLTVPGSERSYDLTGLKPGTEYRVWIYGVKGGNDSWPLSAIFTT 380 MLPAPKNLVVSEVTEDSARLSWTAPDAAFDSFLIQYQESEKVGEAIVLTVP GSERSYDLTGLKPGTEYTVSIYGVKGGHRSNPLSAIFTT 381 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGHGEAIVLTV PGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTTGGGGSGGGGS GGGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIG HGEAIVLTVPGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTT 382 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGHGEAIVLTV PGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTTGGGGSGGGGS GGGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIG HGEAIVLTVPGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTTA PAPAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVN ALKDEILKA 383 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSRE GEVIALTVPGSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTAPA PAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNAL KDEILKA 384 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGH GEAIVLTVPGSERSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTTAP APAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNA LKDEILKA 385 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTAPAPAPAPAPLP APKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGHGEAIVLTVPGSE RSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTTAPAPAPAPAPTIDE WLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA 386 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSISYRERSAW GEAIALVVPGSERSYDLTGLKPGIEYIVGIIGVKGGLRSNPLRADFTTAPAP APAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALK DEILKA 387 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSISYRERSAWGEAIALVV PGSERSYDLTGLKPGIEYIVGIIGVKGGLRSNPLRADFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSRE GEVIALTVPGSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTAPA PAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNAL KDEILKA 388 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVISRVTEDSARLSWTAPDAAFDSFFIYYIESYPAG EAIVLTVPGSERSYDLTGLKPGTEYWVGIDGVKGGRWSTPLSAIFTTAPAP APAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALK DEILKA 389 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIYYLESYPEGEAIVLTVP GSERSYDLTGLKPGTEYWVGIDGVKGGTWSSPLSAIFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSRE GEVIALTVPGSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTAPA PAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNAL KDEILKA 390 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIYYLESYPE GEAIVLTVPGSERSYDLTGLKPGTEYWVGIDGVKGGTWSSPLSAIFTTAPA PAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNAL KDEILKA 391 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFSISYRERSAW GEAIALVVPGSERSYDLTGLKPGIEYIVGIIGVKGGLRSNPLRADFTTGGGG SGGGGSGGGGSGGGGSLPAPKNLVISRVTEDSARLSWTAPDAAFDSFFIYY IESYPAGEAIVLTVPGSERSYDLTGLKPGTEYWVGIDGVKGGRWSTPLSAI FTTAPAPAPAPAPTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTV EGVNALKDEILKA 392 MLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVP GSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTAPAPAPAPAPLP APKNLVVSRVTEDSARLSWTAPDAAFDSFTIWYAEAIGHGEAIVLTVPGSE RSYDLTGLKPGTEYWVDIWGVKGGQQSKPLSAIFTTAPAPAPAPAPLPAP KNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSREGEVIALTVPGSERS YDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTT 393 MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIYYLESYPEGEAIVLTVP GSERSYDLTGLKPGTEYWVGIDGVKGGTWSSPLSAIFTTGGGGSGGGGSG GGGSGGGGSLPAPKNLVVSRVTEDSARLSWTAPYAAFDSFAISYRERSRE GEVIALTVPGSERSYDLTGLKPGTEYIVGILGVKGGRRSKPLRAQFTTGGG GSGGGGSGGGGSGGGGSLPAPKNLVASRVTEDSARLSWTAPDAAFDSFNI AYWEPGIGGEAIWLRVPGSERSYDLTGLKPGTEYKVWIHGVKGGASSPPL IARFTTGGHHHHHHC

(265) SEQ ID NO: 388 was also made N-ethyl maleimide reacted with the C-terminus, which is done to keep the FN3 domain in a monomeric form. The structure can be represented by the following formula:

(266) ##STR00013##

(267) Example 2. FN3-siRNA conjugate (SEQ ID NO:385) specifically lowers endogenous KRAS mRNA. A431 cells (wild-type KRAS, non-KRAS dependent) were treated with the FN3-siRNA (SEQ ID NO: 385 linked to AB03) conjugates for 96 hours. cDNA from the cells was generated and quantitative RT-PCR was performed using Taqman primer/probe assays specific for KRAS, HRAS, and NRAS. Ubiquitin C (UBC) was the endogenous control. The delta-delta Ct method was used to quantify expression of each gene in cells that were treated with FN3-siRNA conjugates. SEQ 41 showed dose-dependent, specific knockdown of KRAS. The corresponding FN3 construct alone (No siRNA Ctrl) did not produce knockdown of KRAS. The non-targeting FN3 control (Tencon) conjugated to the KRAS siRNA did not produce significant knockdown of KRAS. This is illustrated in FIG. 1. The data is also illustrated in tabular form in Table 12.

(268) TABLE-US-00014 TABLE 12 Results of FN3-siRNA conjugates nM SEQ ID No siRNA Conjugate NO: 385 Ctrl (AB03) Relative KRAS mRNA levels 0.132 1.502 1.976 1.894 1.6 1.399 1.595 2.068 8 1.231 1.906 2.008 40 0.554 2.289 1.504 200 0.105 1.544 1.13 Relative HRAS mRNA levels 0.132 1.335883 1.107742 1.167772 1.6 1.246747 1.126604 1.181024 8 1.119824 1.147848 1.0595 40 1.131173 1.14322 1.182572 200 1.048989 1.056286 1.099616 Relative NRAS mRNA levels 0.132 1.3048 1.089474 1.164604 1.6 1.068661 1.052238 1.258119 8 1.000139 0.974874 1.051284 40 1.043022 1.164602 1.239046 200 1.121631 1.062723 1.17195

(269) Quantitative polymerase chain reaction (qPCR) for quantification of gene knockdown. Quantitative reverse transcription polymerase chain reactions (RT-PCR) were performed on cellular samples in order to directly measure knockdown of endogenous KRAS mRNA. After treatment with FN3-siRNA conjugates, A431 cells are lysed and cDNA is generated using Cells-to-Ct kits (ThermoFisher). cDNAs were quantitated using TaqMan gene expression assays specific for KRAS, HRAS, NRAS, or an endogenous control (ubiquitin C).

(270) Example 3. FN3-siRNA conjugates reduce proliferation of KRAS dependent cells. SEQ ID 385 and SEQ ID 381 conjugated to (AB03) reduce proliferation in KRAS-dependent H358 cells in vitro. H358 grown in 3D spheroid conditions were treated with FN3 constructs with or without a conjugated KRAS siRNA. Both the EPCAM/CD71 and CD71/CD71 FN3 domains without the siRNA showed ˜25-40% inhibition of proliferation after 7 days of treatment while FN3-KRAS conjugates inhibited proliferation up to 100%. The data is illustrated in FIG. 2.

(271) 3-dimensional proliferation assay. Cells are grown as 3-dimensional spheroids using 3D Spheroid Microplates (Corning). These plates favor the formation of 3-D spheroids of tumor cells, a format that is known to support KRAS-driven cell growth. Cell proliferation is measured using CellTiterGlo-3D assays (Promega), which use cellular ATP levels as an indicator of cell number. Following treatment with FN3-siRNA conjugates, H358 spheroids are lysed with CellTiterGlo-3D reagent and quantified using a plate reader to measure luminescence. Percent inhibition of proliferation is calculated by comparing the ATP signal present at the end of the conjugate treatment to the ATP signal present in the starting number of cells immediately prior to treatment (FIG. 2).

(272) These examples demonstrate the surprising and unexpected ability of FN3-siRNA conjugates to reduce a target gene and also inhibit cellular proliferation. The results also demonstrate that it can be done with a composition comprising more than one FN3 domain and still effectively deliver a siRNA molecule, which has not previously been demonstrated. Furthermore, the examples and embodiments provided herein demonstrate FN3 Domain-siRNA conjugates enable receptor specific delivery of siRNA to extra-hepatic cell types; intracellular trafficking and an endosomal depot for FN3 contributes to an extended duration of activity of FN3-siRNA conjugates; FN3-siRNA conjugates have demonstrated potent reduction of mRNA and protein and inhibition of proliferation in epithelial tumor cell lines; and bispecific binding of FN3 domains to tumor cells expressing high levels of targeted receptors improves avidity and activity and can improve selectivity

(273) Example 4. siRNA sequences directed against KRAS conjugated with malemide were found to inhibit KRAS expression. Various linker site and linkage chemistry of KRAS siRNAs were evaluated by transfection using a HEK293 luciferase cell line. Each of the molecules were found to inhibit KRAS expression by this assay, which are illustrated in FIG. 3.

(274) Example 5. KRAS-FN3 domain conjugates inhibit cancer cell growth. H358, NSCLC, cell line in 3D spheroid culture was treated with KRAS FN3 conjugates for 15 days (FIG. 4, Panel A). The siRNA-FN3 domain conjugate was conjugated to either a CD71 or EPCAM FN3 binding domain. Cells were subsequently treated with CellTiter-Glo to assess proliferation MIA-PaCa, pancreatic cancer, cell line in 3D spheroid culture was treated with KRAS FN3 conjugates for 7 days CellTiter-Glo to assess proliferation (FIG. 4, Panel B). The conjugates were found to be effective in inhibit cell growth. The results are illustrated in FIG. 4.

(275) Example 6. A H358 luciferase line that can be used measure KRAS expression was treated with a monomeric CD71 FN3 binding, EpCam FN3 binding KRAS siRNA conjugates. The plates were read at 24 h, 48 h, and 72 h. A time dependent effect was observed consistent with receptor mediated uptake and accumulation of the conjugate in the cell. These results are illustrated in FIG. 5. These results demonstrate that the FN3-siRNA conjugates can be internalized into the cell.

(276) Example 7. A H358 3D spheroids were treated with FN3 domain KRAS siRNA conjugates for 72 h. The cells were washed after 6 h and 24 h and then measured for fluorescent signal. The 6 h and 24 h washout experiment demonstrates a lasting effects for the FN3 accumulation in the early endosome and siRNA silencing on KRAS mRNA. These results are illustrated in FIG. 6. These results demonstrate the persistence of the effect.

(277) Example 8. FN3 Binding Domains-siRNA conjugates can inhibit the expression of more than one KRAS mutant. H358-NSCLC (G12C), MIA PaCa-2-pancreatic (G12C), HPAF II-pancreatic (G12D), A549-NSCLC (G12S), H460-NSCLC (Q61H) and A431-skin (KRAS WT) cancer lines were treated with KRAS2 EPCAM/CD71 FN3 conjugates for 72 h. The cells from each experiment were measured for residual KRAS mRNA using qPCR. The conjugates were found to decrease the expression of each variant. These results are illustrated in FIG. 7.

(278) Example 9. EPCAM/CD71-FN3 Bispecific Binding Domain siRNA conjugates decreases KRAS protein levels. A431 and H358 cells were treated with bispecific FN3 domains conjugated to KRAS siRNA at 2, 20 and 200 nM concentrations. After 72 h the cells were compared by Western blot and for the presence of KRAS protein. A good correlation between mRNA silencing and protein was observed. These results are illustrated in FIG. 8.

(279) Example 10. FN3-siRNA conjugates reduce proliferation of KRAS dependent cells. SEQ ID 393 conjugated to (AB03) reduce proliferation in KRAS-G12D dependent cells in vitro. The cells grown in 3D spheroid conditions were treated with the constructs with or without a conjugated KRAS siRNA as described in Example 3. A control, AMG-510, that targets G12C was used as a negative control. The FN3-KRAS conjugate inhibited proliferation up to 100%, which was significantly more than the control without the siRNA or AMG-510, which is G12C RAS inhibitor. The data is illustrated in FIG. 9. SEQ ID NO: 393 is illustrated as a polypeptide that comprises 3 FN3 domains that bind to CD71 (SEQ ID NO: 312), EpCAM (SEQ ID NO: 330-without the initial methionine) and an albumin binding domain comprising the sequence of: (LPAPKNLVASRVTEDSARLSWTAPDAAFDSFNIAYWEPGIGGEAIWLRVPGSERSYDLT GLKPGTEYKVWIHGVKGGASSPPLIARFTTGG (SEQ ID NO: 394). Each of these domains are exemplary only and linked by various peptide linkers. The domains can be swapped with other CD71, EpCAM and albumin binding domains, such as those provided herein or referenced herein.

(280) Example 11. FN3 Domain Conjugation, PEG Modifier and siRNA

(281) FIG. 10 illustrates a non-limiting example of how a FN3 domain was linked to a siRNA and PEG molecule. Briefly, a polypeptide as provided herein was conjugated to a siRNA linker with the distal 5′ disulfide 4 through cysteine maleimide chemistry. The reaction was passed through a desalting column (7 kD molecular weight cutoff-MCWO) to afford product 5. The conjugate was purified in two steps. Step I affinity chromatography; to remove un-reacted siRNA linker using a Ni-NTA column. Step II-Ion exchange chromatography (CaptoQ or DEAE); to remove un-reacted Centyrin. Fractions containing pure conjugate (determined by SDS gel) were pooled, exchanged into PBS by desalting using Zeba desalting columns (Thermo), and concentrated if necessary.

(282) The cysteine group was removed using 10 mM TCEP. The reaction was monitored by LC-MS. After completion of the reduction TCEP was removed by desalting (7 kD MWCO) to yield 6. Intermediate 6 with was then stirred with the maleimide-PEG moiety (10 equivalents with respect to 6) in PBS. The reaction was incubated at room temperature (˜20-25 C) for 6-12 hrs. The reaction was monitored by LC/MS. After completion of reaction the product 7 was purified by passing the reaction mixture through desalting column (7 kD MCWO) to remove excess maleimide-PEG.

(283) Analytical Characterization of CENTYRIN Domain-siRNA Conjugates

(284) FN3-siRNA conjugates were characterized by a combination of analytical techniques. SDS-PAGE was used to compare amounts of conjugate to free protein. For SDS-PAGE, 4-20% Mini-PROTEAN® TGX Stain-Free™ Protein Gels (BioRad) were run in SDS buffer for one hour at 100 V. Gels were visualized under UV light. Analytical SEC (Superdex-75 5/150 GL column-GE) was used to analyze purity and aggregation state of Centyrin-siRNA conjugates. Liquid chromatography/mass spectrometry (LC/MS) was used to confirm identity and purity of the conjugates. Samples were analyzed using a Waters Acuity UPLC/Xevo G2-XS TOF mass spectrometer system. The instrument was operated in negative electro-spray ionization mode and scanned from m/z 200 to 3000. Conjugate was seen as two fragments; Antisense and Sense-FN3 polypeptide.

(285) Example 12. Mice were dosed via intravenous administration of a FN3 domain conjugated according to Example 11 at 5 mg/kg. Serum was collected and analyzed via stem-loop PCR to quantify antisense RNA strand of the siRNA molecule. LLOQ for assay determined to be 1 nM. Two FN3-siRNA conjugates were tested in pK studies and in vitro luciferase assays. The pK of the antisense RNA of the siRNA molecules were found to have adequate stability in the blood of the mice. This is illustrated in FIG. 11. The open triangles were SEQ ID NO: 393 linked to siRNA AB03 and found to have an AUC (1 nm baseline) of 1251. The closed circles were SEQ ID NO: 393 linked to siRNA AB15 and found to have an AUC (1 nm baseline) of 4470. This data demonstrates that the siRNA molecule was stable and detectable.

(286) Luciferase assays of the same molecules were performed as described herein and were read using EnduRen substrate 72 hours following administration of the FN3-siRNA conjugates. Proliferation assays were read using CellTiterGlo 14 days following administration of FN3-siRNA conjugates. The activities in various assays is shown in the table below.

(287) TABLE-US-00015 H358- SW620- A549- LUC LUC LUC H358 EC50 EC50 EC50 Proliferation FN3-siRNA Conjugate# (nM) (nM) (nM) (nM) SEQ ID NO: 393 linked 0.55 1.28 11.35 6.44 to siRNA AB03 SEQ ID NO: 393 linked 0.95 2.07 17.27 37.35 to siRNA AB15
These data demonstrate that the FN3-siRNA conjugates were active.

(288) These examples demonstrate the surprising and unexpected ability of the FN3-siRNA conjugates to reduce different mutant forms of a target gene and also inhibit cellular proliferation. The results also demonstrate that it can be done with a composition comprising more than one FN3 domain and still effectively deliver a siRNA molecule, which has not previously been demonstrated. Furthermore, the examples and embodiments provided herein demonstrate FN3 Domain-siRNA conjugates enable receptor specific delivery of siRNA to extra-hepatic cell types; intracellular trafficking and an endosomal depot for FN3 contributes to an extended duration of activity of FN3-siRNA conjugates; FN3-siRNA conjugates have demonstrated potent reduction of mRNA and protein and inhibition of proliferation in epithelial tumor cell lines; and bispecific binding of FN3 domains to tumor cells expressing high levels of targeted receptors improves avidity and activity and can improve selectivity

(289) EXAMPLE 12. Knockdown of mRNA in muscle cells using CD71 FN3 domain-oligonucleotide conjugates. muCD71 binding FN3 domains are conjugated to siRNA oligonucleotides or antisense oligonucleotides (ASOs) using maleimide chemistry via a cysteine that is uniquely engineered into the FN3 domain. The cysteine substitutions can be one such as those provided for herein and also as provided for in U.S. Patent Application Publication No. 20150104808, which is hereby incorporated by reference in its entirety. siRNAs or ASOs are modified with standard chemical modifications and confirmed to enable knockdown of the targeted mRNA in vitro. FN3 domain-oligonucleotide conjugates are dosed intravenously in mice at doses up to 10 mg/kg oligonucleotide payload. At various time points following dosing, mice are sacrificed; skeletal muscle, heart muscle and various other tissues will be recovered and stored in RNAlater™ (Sigma Aldrich) until needed. Target gene knockdown is assessed using standard qPCR ΔΔCT methods and primers specific for the target gene and a control gene. The target gene is found to be knock downed in the muscles and such knockdown is enhanced by conjugating the siRNA or ASO to the CD71 FN3 binding domain.

(290) The results and embodiments provided herein demonstrate that the FN3-siRNA conjugates can provide receptor specific delivery of KRAS siRNA. They provide high potency against tumor cell lines and provide FN3 domain conjugates demonstrate differentiated trafficking vs. antibodies facilitating siRNA delivery. These results also demonstrate that the FN3 domains can be used for delivery of any siRNA payloads or other payloads into tumor cells or other cells that have internalizing receptor positive cells.

(291) General Methods

(292) Standard methods in molecular biology are described Sambrook, Fritsch and Maniatis (1982 & 1989 2.sup.nd Edition, 2001 3.sup.rd Edition) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Sambrook and Russell (2001) Molecular Cloning, 3.sup.rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San Diego, Calif.). Standard methods also appear in Ausbel, et al. (2001) Current Protocols in Molecular Biology, Vols. 1-4, John Wiley and Sons, Inc. New York, N.Y., which describes cloning in bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol. 2), glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).

(293) Methods for protein purification including immunoprecipitation, chromatography, electrophoresis, centrifugation, and crystallization are described (Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York). Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described (see, e.g., Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York; Ausubel, et al. (2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, NY, pp. 16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, Mo.; pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391). Production, purification, and fragmentation of polyclonal and monoclonal antibodies are described (Coligan, et al. (2001) Current Protocols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane, supra). Standard techniques for characterizing ligand/receptor interactions are available (see, e.g., Coligan, et al. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York).

(294) All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g. Genbank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. This statement of incorporation by reference is intended by Applicants, pursuant to 37 C.F.R. § 1.57(b)(1), to relate to each and every individual publication, database entry (e.g. Genbank sequences or GeneID entries), patent application, or patent, each of which is clearly identified in compliance with 37 C.F.R. § 1.57(b)(2), even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.

(295) The present embodiments are not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the embodiments in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.

(296) The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the embodiments. Various modifications of the embodiments in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.