QUANTITATIVE ANTIBODY TEST
20210341479 · 2021-11-04
Assignee
Inventors
- Andrew Ball (Billerica, MA, US)
- Lei Chang (Billerica, MA, US)
- Syrena Fernandes (Billerica, MA, US)
- Joe Johnson (Billerica, MA, US)
- Jeremy Lambert (Billerica, MA, US)
- Dawn Mattoon (Billerica, MA, US)
- Tatiana Plavina (Billerica, MA, US)
- David Wilson (Billerica, MA, US)
Cpc classification
International classification
Abstract
The present disclosure relates to methods and compositions, e.g., kits, for quantitatively detecting an antibody of a subject to an infectious organism. In some embodiments, the present disclosure provides for methods and compositions, e.g., kits, for quantitatively detecting a human antibody to SARS-CoV-2 polypeptide or S (spike) polypeptide. Certain applications and uses of the present methods and compositions, e.g., kits, are also provided.
Claims
1. A method for quantitatively detecting an antibody of a subject to an infectious organism, which method comprises: a) contacting a sample from a subject with an antigen of an infectious organism, or a fragment or analog thereof, to allow binding between an antibody to said antigen of said infectious organism, if present in said sample, and said antigen of said infectious organism, or a fragment or analog thereof; b) assessing a detectable signal due to binding between said antibody and said antigen, or a fragment or analog thereof; and c) comparing said detectable signal to a calibration data set generated using a calibrator antibody that specifically binds to said antigen at multiple concentrations or levels to assess amount, concentration or level of said antibody in said sample, and optionally wherein said calibrator antibody is a chimeric antibody, or a fragment thereof, that comprises a constant region of a species of said subject and a variable region component or a variable region of a different species.
2. The method of claim 1, wherein the sample is selected from the group consisting of a urine, blood, dry blood spot, plasma, serum, saliva, semen, stool, sputum, cerebral spinal fluid, tear, mucus, and amniotic fluid sample.
3. The method of claim 2, wherein the sample is blood, plasma, serum, capillary blood, venous blood, or dried blood sample.
4. The method of any of claims 1-3, wherein the subject is a mammal.
5. The method of claim 4, wherein the mammal is a human.
6. The method of claim 4, wherein the mammal is non-human mammal, e.g., a non-human primate such as a monkey, a rabbit, or a rodent.
7. The method of any of claims 1-6, wherein the antigen comprises a surface antigen or a non-surface antigen of an infectious organism.
8. The method of claim 7, wherein the surface antigen comprises a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of an infectious organism.
9. The method of any of claims 1-8, wherein step a) comprises contacting a sample from a subject with an intact or a whole antigen of an infectious organism.
10. The method of any of claims 1-8, wherein step a) comprises contacting a sample from a subject with a fragment or analog of an antigen of an infectious organism.
11. The method of any of claims 1-10, wherein the infectious organism is selected from the group consisting of a virus, a bacterium, a fungus and a parasite.
12. The method of claim 11, wherein the bacterium is in a genus selected from the group consisting of Bacillus, Bartonella, Bordetella, Borrelia, Brucella, Campylobacter, Chlamydia, Chlamydophila, Clostridium, Corynebacterium, Enterococcus, Escherichia, e.g., Escherichia coli, Francisella, Haemophilus, Helicobacter, Legionella, Leptospira, Listeria, Mycobacterium, Mycoplasma, Neisseria, Pseudomonas, Rickettsia, Salmonella, Shigella, Staphylococcus, Streptococcus, Treponema, Ureaplasma, Vibrio and Yersinia.
13. The method of claim 11, wherein the fungus is in a genus selected from the group consisting of Candida, Aspergillus, Crytococcus, Histoplasma, e.g., Histoplasma capsulatum, Pneumocystis, and Stachybotrys, e.g., Stachybotrys chartarum.
14. The method of claim 11, wherein the parasite is selected from the group consisting of a protozoa, a helminth and an ectoparasite.
15. The method of claim 11, wherein the virus is selected from the group consisting of Adeno-associated virus, Aichi virus, Australian bat lyssavirus, BK polyomavirus, Banna virus, Barmah forest virus, Bunyamwera virus, Bunyavirus La Crosse, Bunyavirus snowshoe hare, Cercopithecine herpesvirus, Chandipura virus, Chikungunya virus, Cosavirus A, Cowpox virus, Coxsackievirus, Crimean-Congo hemorrhagic fever virus, Dengue virus, Dhori virus, Dugbe virus, Duvenhage virus, Eastern equine encephalitis virus, Ebolavirus, Echoviru, Encephalomyocarditis virus, Epstein-Barr virus, European bat lyssavirus, GB virus C/Hepatitis G virus, Hantaan virus, Hendra virus, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Hepatitis E virus, Hepatitis delta virus, Horsepox virus, Human adenovirus, Human astrovirus, Human coronavirus, Human cytomegalovirus, Human enterovirus 68, 70, Human herpesvirus 1, Human herpesvirus 2, Human herpesvirus 6, Human herpesvirus 7, Human herpesvirus 8, Human immunodeficiency virus, Human papillomavirus 1, Human papillomavirus 2, Human papillomavirus 16,18, Human parainfluenza, Human parvovirus B19, Human respiratory syncytial virus, Human rhinovirus, Human SARS coronavirus, Human spumaretrovirus, Human T-lymphotropic virus, Human torovirus, Influenza A virus, Influenza B virus, Influenza C virus, Isfahan virus, JC polyomavirus, Polyomavirus, Japanese encephalitis virus, Junin arenavirus, KI Polyomavirus Polyomavirus, Kunjin virus, Lagos bat virus, Lyssavirus, Lake Victoria Marburgvirus, Langat virus, Lassa virus, Lordsdale virus, Louping ill virus, Lymphocytic choriomeningitis virus, Machupo virus, Mayaro virus, MERS coronavirus, Measles virus, Mengo encephalomyocarditis virus, Merkel cell polyomavirus, Mokola virus, Molluscum contagiosum virus, Monkeypox virus, Orthopoxvirus, Mumps virus, Murray valley encephalitis virus, New York virus, Nipah virus, Norwalk virus, onyong-nyong virus, Orf virus, Oropouche virus, Pichinde virus, Poliovirus, Punta toro phlebovirus, Puumala virus, Rabies virus, Rift valley fever virus, Rosavirus A, Ross river virus, Rotavirus A, Rotavirus B, Rotavirus C, Rubella virus, Sagiyama virus, Salivirus A, Sandfly fever sicilian virus, Sapporo virus, Semliki forest virus, Seoul virus, Simian foamy virus, Simian virus 5, Sindbis virus, Southampton virus, St. louis encephalitis virus, Tick-borne powassan virus, Torque teno virus, Toscana virus, Uukuniemi virus, Vaccinia virus, Varicella-zoster virus, Variola virus, Venezuelan equine encephalitis virus, Vesicular stomatitis virus, Western equine encephalitis virus, WU polyomavirus, Polyomavirus, West Nile virus, Yaba monkey tumor virus, Yaba-like disease virus, Yellow fever virus, and Zika virus.
16. The method of claim 11, wherein the virus is a DNA virus.
17. The method of claim 11, wherein the virus is a RNA virus.
18. The method of claim 17, wherein the virus is a Coronavirus.
19. The method of claim 18, wherein the Coronavirus is an alphacoronavirus, betacoronavirus, a gammacoronavirus or a deltacoronavirus.
20. The method of claim 18, wherein the Coronavirus is a human Coronavirus.
21. The method of claim 20, wherein the human Coronavirus is selected from the group consisting of human coronavirus OC43 (HCoV-OC43), human coronavirus HKU1 (HCoV-HKU1), human coronavirus 229E (HCoV-229E), human coronavirus NL63 (HCoV-NL63), middle east respiratory syndrome-related coronavirus (MERS-CoV), severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1) and severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
22. The method of claim 20, wherein the human Coronavirus is severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
23. The method of any of claims 11 and 16-22, wherein the viral antigen comprises a viral surface antigen or a non-surface antigen.
24. The method of claim 23, wherein the viral surface antigen comprises a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of a virus.
25. The method of any of claims 11 and 16-24, wherein step a) comprises contacting a sample from a subject with an intact or a whole viral antigen.
26. The method of any of claims 11 and 16-24, wherein step a) comprises contacting a sample from a subject with a fragment or analog of a viral antigen.
27. The method of claim 22, wherein the antigen comprises a polypeptide, or a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of SARS-CoV-2.
28. The method of claim 27, wherein the SARS-CoV-2 polypeptide comprise S (spike) polypeptide, E (envelope) polypeptide, M (membrane) polypeptide, N (nucleocapsid) polypeptide, or a fragment thereof.
29. The method of any of claims 22, 27 and 28, wherein step a) comprises contacting a sample from a subject with an intact or a whole antigen of SARS-CoV-2.
30. The method of any of claims 22, 27 and 28, wherein step a) comprises contacting a sample from a subject with a fragment or analog of an antigen of SARS-CoV-2.
31. The method of any of claims 22 and 27-30, wherein the SARS-CoV-2 antigen comprises S (spike) polypeptide, or a fragment thereof.
32. The method of claim 31, wherein step a) comprises contacting a sample from a subject with an intact or a whole antigen of SARS-CoV-2 S (spike) polypeptide.
33. The method of claim 31, wherein step a) comprises contacting a sample from a subject with a fragment or analog of SARS-CoV-2 S (spike) polypeptide.
34. The method of claim 33, wherein the fragment or analog of SARS-CoV-2 S (spike) polypeptide comprises the extracellular domain or fragment of SARS-CoV-2 S (spike) polypeptide, e.g., a fragment comprising an amino acid sequence set forth in SEQ ID NO:1 ([PRO_0000449646; Aa 13-1273; GenBank Accession No. P0DTC2]), or the soluble trimeric version of the SARS-CoV-2 spike protein (e.g., the spike protein of SARS-CoV-2 187 isolate (GenBank: MN908947.3) TABLE-US-00013 >sp|P0DTC2|13-1273 SQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNV TWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSS ANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINL VRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGA AAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGI YQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCV ADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLK PFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPF QQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLY QDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYEC DIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSI AIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQ LNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKP SKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLP PLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVT QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTL VKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQL IRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVF LHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEP QIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSP DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKW PWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE PVLKGVKLHYT
35. The method of any of claims 1-34, wherein step b) comprises contacting a first complex formed between an antibody of a subject and an antigen of an infectious organism, or a fragment or analog thereof, with a binder that binds to the antibody in the first complex, and the binder comprising a detectable label, to form a second complex comprising the antibody, the antigen or a fragment or analog thereof, and the binder comprising the detectable label, optionally the binder being a protein or polypeptide binder, e.g., an antibody, or a non-protein binder, e.g., a binder comprising a peptide or nucleic acid scaffold, such as an aptamer.
36. The method of any of claims 1-34, wherein step b) comprises: 1) contacting a first complex formed between an antibody of a subject and an antigen of an infectious organism, or a fragment or analog thereof, with a binder that binds to the antibody in the first complex, and the binder comprising a first member of a binding pair, to form a second complex comprising the antibody, the antigen or a fragment or analog thereof, and the binder comprising the first member; and 2) contacting the second complex with a second member of the binding pair that comprises a detectable label and binds to the first member of the binding pair to form a third complex comprising the antibody, the antigen or a fragment or analog thereof, the binder comprising the detectable label and the first member of the binding pair, and the second member of the binding pair.
37. The method of claim 36, wherein the binding pair comprises an antigen-antibody binding pair, an avidin (streptavidin)/biotin binding pair, a peptide-binder pair, or a DNA-binder pair.
38. The method of claim 36 or 37, wherein the detectable label is a colorimetric, radioactive, enzymatic, luminescent or fluorescent label.
39. The method of any of claims 35-38, wherein further comprises: 1) applying the second complex comprising the antigen or a fragment or analog thereof, the antibody, and the binder comprising a detectable label; or 2) applying the third complex comprising the antigen or a fragment or analog thereof, the antibody, the binder comprising the detectable label and the first member of the binding pair, and the second member of the binding pair, to a surface, e.g., a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device, or a microfluidic device comprising an array of femtoliter reaction wells and to petition a single second complex or a single third complex in a femtoliter reaction well.
40. The method of any of claims 35-39, wherein the second complex or third complex is formed on a particle, e.g., a bead.
41. The method of claim 40, wherein the particle comprises a magnetic particle, a nanoparticle, or a polystyrene particle.
42. The method of claim 40 or 41, wherein the second complexes or third complexes are immobilized on particles and the particles are applied to a surface, e.g., a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device, or a microfluidic device comprising an array of femtoliter reaction wells and to petition a single second complex or a single third complex in a femtoliter reaction well.
43. The method of any of claims 39-42, wherein step b) further comprises assessing a detectable signal from a single second complex or a single third complex in a femtoliter reaction well.
44. The method of any of claims 1-43, wherein the calibration data set is used in a form of a calibration table or curve.
45. The method of claim 44, wherein a calibration curve is obtained using a curve fitting algorithm, e.g., 4-parameter logistical regression fitting algorithm.
46. The method of any of claims 1-45, wherein the calibrator antibody comprises an intact chimeric antibody.
47. The method of any of claims 1-46, wherein the calibration data set is generated using a calibrator antibody at concentrations or levels ranging from about 0.001 ng/mL to about 10,000 ng/mL.
48. The method of any of claims 1-47, wherein the calibrator antibody is a recombinant chimeric antibody, or a fragment thereof.
49. The method of any of claims 1-48, which is used to quantitatively detect a human antibody to an infectious organism, and wherein the calibrator antibody, or a fragment thereof, comprises a constant region of a human antibody.
50. The method of claim 49, wherein the calibrator antibody comprises a fully human antibody, a humanized antibody, a humanized chimeric antibody, or a fragment thereof.
51. The method of claim 49 or 50, wherein the calibrator antibody, or a fragment thereof, comprises a variable region component or a variable region of a human, mouse, rat, rabbit, goat, pig, chicken, alpaca, donkey, sheep, hamster, Armenian hamster, golden Syrian hamster, guinea pig, cow, horse, llama, dog, cat, monkey, turkey, duck, recombinant, or mixed species antibody.
52. The method of any of claims 1-51, wherein the calibrator antibody comprises a monoclonal antibody, or a fragment thereof.
53. The method of any of claims 1-52, which is used to quantitatively detect a class of IgA, IgD, IgE, IgG, or IgM antibody to an infectious organism.
54. The method of claim 53, which is used to quantitatively detect a class of human IgA, IgD, IgE, IgG, or IgM antibody to an infectious organism.
55. The method of claim 53 or 54, which is used to quantitatively detect a subclass (or isotype) of antibody to an infectious organism.
56. The method of any of claims 35-55, which is used to quantitatively detect a class of IgA antibody to an infectious organism, and wherein the binder binds to the IgA antibody in the complex and the calibrator antibody is a chimeric IgA antibody.
57. The method of any of claims 35-55, which is used to quantitatively detect a class of IgD antibody to an infectious organism, and wherein the binder binds to the IgD antibody in the complex and the calibrator antibody is a chimeric IgD antibody.
58. The method of any of claims 35-55, which is used to quantitatively detect a class of IgE antibody to an infectious organism, and wherein the binder binds to the IgE antibody in the complex and the calibrator antibody is a chimeric IgE antibody.
59. The method of any of claims 35-55, which is used to quantitatively detect a class of IgG antibody to an infectious organism, and wherein the binder binds to the IgG antibody in the complex and the calibrator antibody is a chimeric antibody, e.g., a chimeric humanized mouse IgG antibody or a chimeric humanized mouse IgG specific for COVID-19 S1 spike protein.
60. The method of any of claims 35-55, which is used to quantitatively detect a class of IgM antibody to an infectious organism, and wherein the binder binds to the IgM antibody in the complex and the calibrator antibody is a chimeric IgM antibody.
61. The method of any of claims 1-60, which is used to quantitatively detect a single antibody to an infectious organism.
62. The method of any of claims 1-60, which is used to quantitatively detect multiple antibodies to an infectious organism.
63. The method of claim 62, which is used to quantitatively detect multiple antibodies to a single infectious organism.
64. The method of claim 62, which is used to quantitatively detect multiple antibodies to multiple infectious organisms.
65. The method of any of claims 62-64, which is used to quantitatively detect multiple antibodies in the same class.
66. The method of claim 65, which is used to quantitatively detect multiple antibodies in different subclasses (or isotypes).
67. The method of any of claims 62-64, which is used to quantitatively detect multiple antibodies in different classes.
68. The method of claim 67, which is used to quantitatively detect multiple antibodies in different subclasses (or isotypes).
69. The method of claim 68, which further comprises assessing a ratio between or among concentrations or levels of antibodies in different subclasses (or isotypes).
70. The method of any of claims 1-69, which is used to quantitatively detect an antibody to SARS-CoV-2 in a human.
71. The method of claim 70, which is used to quantitatively detect an IgG antibody to SARS-CoV-2 in a human.
72. The method of any of claims 1-71, which is fully automated.
73. The method of any of claims 1-72, which has a throughput ranging from about 10 tests/hour to about 100 tests/hour.
74. The method of any of claims 1-73, which can be conducted in a time period from about 20 minutes to about 300 minutes, till first result or results of a set number of tests, e.g., about 250-300 samples, are obtained.
75. The method of any of claims 1-74, which is for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and has a detection cut-off from about 2 ng/mL to about 5 ng/mL.
76. The method of any of claims 1-75, which is for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and has a precision (or CV) ranging from about 3% to about 30%, e.g., a between-run precision CV ranging from 5% to about 20%, or a within-run precision CV ranging from 3% to 30%.
77. The method of any of claims 1-76, which is for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and has a sensitivity ranging from about 2 fg/mL to about 1 ng/mL.
78. The method of any of claims 1-77, which is for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and has a specificity, e.g., IgG specificity, ranging from about 70% to about 100%.
79. The method of any of claims 1-78, wherein is for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and the quantitation results from comparable serum and plasma samples are within from about 0% to about 20% of each other.
80. The method of any of claims 1-79, which is used to aid or facilitate diagnosis, prognosis, risk assessment, stratification and/or treatment monitoring of infection by an infectious organism in a subject, and/or for research and drug/vaccine discovery and/or development.
81. The method of any of claims 1-80, which is used to assess an immune response to an infectious organism in a subject.
82. The method of claim 81, which is used to assess an immune response to SARS-CoV-2 in a subject, e.g., a human subject or patient.
83. The method of any of claims 1-80, which is used to assess past infection by an infectious organism in a subject.
84. The method of claim 83, which is used to assess past infection by SARS-CoV-2 in a subject, e.g., a human subject or patient.
85. The method of any of claims 1-80, which is used to assess IgG seroconversion to an infectious organism in a subject.
86. The method of claim 85, which is used to assess IgG seroconversion to SARS-CoV-2 in a subject, e.g., a human subject or patient.
87. The method of any of claims 1-86, wherein an antigen of an infectious organism, or a fragment or analog thereof, is immobilized on a surface to allow binding between the antibody to the antigen of the infectious organism, if present in the sample, and the antigen of the infectious organism, or a fragment or analog thereof, to form a complex between the antibody and the antigen, or a fragment or analog thereof, on the surface.
88. The method of claim 87, wherein the a surface is part of a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device, or a microfluidic device comprising an array of femtoliter reaction wells.
89. The method of claim 87 or 88, which is conducted in an ELISA format.
90. A method for quantitatively detecting a human antibody to BARS-CoV-2 S (spike) polypeptide, which method comprises: a) contacting a sample from a subject with a SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof, to allow binding between an antibody to a SARS-CoV-2 S (spike) polypeptide, if present in said sample, and said SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof; b) assessing a detectable signal due to binding between said antibody and said SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof; and c) comparing said detectable signal to a calibration data set generated using a calibrator antibody that specifically binds to said SARS-CoV-2 S (spike) polypeptide at multiple concentrations or levels to assess amount, concentration or level of said antibody in said sample, and, optionally wherein said calibrator antibody is a chimeric antibody, or a fragment thereof, that comprises a human constant region and a variable region component or a variable region of a non-human species.
91. A kit for quantitatively detecting an antibody of a subject to an infectious organism, which kit comprises: a) an antigen of an infectious organism, or a fragment or analog thereof; and b) a calibrator antibody that specifically binds to said antigen for generating a calibration data set.
92. The kit of claim 91, wherein the calibrator antibody is a chimeric antibody, or a fragment thereof, that comprises a constant region of a species of a subject and a variable region component of a different species.
93. The kit of claim 91 or 92, which comprises the calibrator antibody that specifically binds to the antigen at multiple concentrations or levels for generating a calibration data set.
94. The kit of any of claims 91-93, wherein the antigen comprises a surface antigen or a non-surface antigen of an infectious organism.
95. The kit of claim 94, wherein the surface antigen comprises a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of an infectious organism.
96. The kit of any of claims 91-95, wherein the antigen, or a fragment or analog thereof, is an antigen, or a fragment or analog thereof, of an infectious organism selected from the group consisting of a virus, a bacterium, a fungus and a parasite.
97. The kit of claim 96, wherein the antigen, or a fragment or analog thereof, is an antigen, or a fragment or analog thereof, of a Coronavirus, e.g., a human Coronavirus.
98. The kit of claim 97, wherein the human Coronavirus is selected from the group consisting of human coronavirus OC43 (HCoV-OC43), human coronavirus HKU1 (HCoV-NKU1), human coronavirus 229E (HCoV-229E), human coronavirus NL63 (HCoV-NL63), middle east respiratory syndrome-related coronavirus (MERS-CoV), severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1) and severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
99. The kit of claim 97, wherein the human Coronavirus is severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
100. The kit of any of claims 96-99, wherein the viral antigen comprises a viral surface antigen or a non-surface antigen.
101. The kit of claim 100, wherein the viral surface antigen comprises a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of a virus.
102. The kit of any of claims 91-101, which comprises an intact or a whole antigen, e.g., an intact or a whole viral antigen.
103. The kit of any of claims 91-101, which comprises a fragment or analog of an antigen, e.g., a fragment or analog of a viral antigen.
104. The kit of claim 97, wherein the antigen comprises a polypeptide, or a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of SARS-CoV-2.
105. The kit of claim 104, wherein the SARS-CoV-2 polypeptide comprise S (spike) polypeptide, E (envelope) polypeptide, M (membrane) polypeptide, N (nucleocapsid) polypeptide, or a fragment thereof.
106. The kit of claim 104, wherein the SARS-CoV-2 polypeptide comprises S (spike) polypeptide, or a fragment thereof.
107. The kit of claim 106, wherein the fragment or analog of SARS-CoV-2 S (spike) polypeptide comprises the extracellular domain or fragment of SARS-CoV-2 S (spike) polypeptide, e.g., a fragment comprising an amino acid sequence set forth in SEQ ID NO:1 ([PRO_0000449646; Aa 13-1273; GenBank Accession No. P0DTC2]), or the soluble trimeric version of the SARS-CoV-2 spike protein (e.g., the spike protein of SARS-CoV-2 187 isolate (GenBank: MN908947.3)
108. The kit of any of claims 91-107, which further comprises a binder that binds to an antibody of a subject to an infectious organism.
109. The kit of claim 108, wherein the binder is a protein or polypeptide binder, e.g., an antibody, or a non-protein binder, e.g., a binder comprising a peptide or nucleic acid scaffold, such as an aptamer.
110. The kit of claim 108 or 109, wherein the binder comprises a detectable label.
111. The kit of any of claims 91-107, which further comprises a binder that binds to an antibody of a subject to an infectious organism, the binder comprising a first member of a binding pair.
112. The kit of claim 111, which further comprises a second member of the binding pair.
113. The kit of claim 112, wherein the second member comprises a detectable label.
114. The kit of any of claims 111-113, wherein the binding pair comprises an antigen-antibody binding pair, an avidin (streptavidin)/biotin binding pair, a peptide-binder pair, or a DNA-binder pair.
115. The kit of any of claims 110-114, wherein the detectable label is a colorimetric, radioactive, enzymatic, luminescent or fluorescent label.
116. The kit of any of claims 91-115, which further comprises a particle, e.g., a bead.
117. The kit of claim 116, wherein the particle comprises a magnetic particle, a nanoparticle, or a polystyrene particle.
118. The kit of any of claims 110-117, wherein the calibrator antibody comprises an intact chimeric antibody.
119. The kit of any of claims 110-118, wherein the calibrator antibody comprises a recombinant chimeric antibody, or a fragment thereof.
120. The kit of claim 117 or 118, which comprises a calibrator antibody at concentrations or levels ranging from about 0.001 ng/mL to about 10,000 ng/mL.
121. The kit of any of claims 91-120, which is configured to quantitatively detect a human antibody to an infectious organism, and wherein the calibrator antibody, or a fragment thereof, comprises a constant region of a human antibody.
122. The kit of claim 121, wherein the calibrator antibody comprises a fully human antibody, a humanized antibody, a humanized chimeric antibody, or a fragment thereof.
123. The kit of claim 121 or 122, wherein the calibrator antibody, or a fragment thereof, comprises a variable region component or a variable region of a human, mouse, rat, rabbit, goat, pig, chicken, alpaca, donkey, sheep, hamster, Armenian hamster, golden Syrian hamster, guinea pig, cow, horse, llama, dog, cat, monkey, turkey, duck, recombinant, or mixed species antibody.
124. The kit of any of claims 91-123, wherein the calibrator antibody comprises a monoclonal antibody, or a fragment thereof.
125. The kit of any of claims 91-124, which is configured to aid or facilitate diagnosis, prognosis, risk assessment, stratification and/or treatment monitoring of infection by an infectious organism in a subject, and/or for research and drug/vaccine discovery and/or development.
126. The kit of any of claims 91-124, which is configured to assess an immune response to an infectious organism in a subject.
127. The kit of claim 126, which is configured to assess an immune response to SARS-CoV-2 in a subject, e.g., a human subject or patient.
128. The kit of any of claims 91-124, which is configured to assess past infection by an infectious organism in a subject.
129. The kit of claim 128, which is configured to assess past infection by SARS-CoV-2 in a subject, e.g., a human subject or patient.
130. The kit of any of claims 91-124, which is configured to assess IgG seroconversion to an infectious organism in a subject.
131. The kit of claim 130, which is configured to assess IgG seroconversion to SARS-CoV-2 in a subject, e.g., a human subject or patient.
Description
V. BRIEF DESCRIPTION OF THE DRAWINGS
[0016] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
VI. DETAILED DESCRIPTION
[0033] A detailed description of one or more embodiments of the claimed subject matter is provided below along with accompanying figures that illustrate the principles of the claimed subject matter. The claimed subject matter is described in connection with such embodiments, but is not limited to any particular embodiment. It is to be understood that the claimed subject matter may be embodied in various forms, and encompasses numerous alternatives, modifications and equivalents. Therefore, specific details disclosed herein are not to be interpreted as limiting, but rather as a basis for the claims and as a representative basis for teaching one skilled in the art to employ the claimed subject matter in virtually any appropriately detailed system, structure, or manner. Numerous specific details are set forth in the following description in order to provide a thorough understanding of the present disclosure. These details are provided for the purpose of example and the claimed subject matter may be practiced according to the claims without some or all of these specific details. It is to be understood that other embodiments can be used and structural changes can be made without departing from the scope of the claimed subject matter. It should be understood that the various features and functionality described in one or more of the individual embodiments are not limited in their applicability to the particular embodiment with which they are described. They instead can, be applied, alone or in some combination, to one or more of the other embodiments of the disclosure, whether or not such embodiments are described, and whether or not such features are presented as being a part of a described embodiment. For the purpose of clarity, technical material that is known in the technical fields related to the claimed subject matter has not been described in detail so that the claimed subject matter is not unnecessarily obscured.
[0034] Unless defined otherwise, all terms of art, notations and other technical and scientific terms or terminology used herein are intended to have the same meaning as is commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. Many of the techniques and procedures described or referenced herein are well understood and commonly employed using conventional methodology by those skilled in the art.
[0035] All publications, including patent documents, scientific articles and databases, referred to in this application are incorporated by reference in their entireties for all purposes to the same extent as if each individual publication were individually incorporated by reference. If a definition set forth herein is contrary to or otherwise inconsistent with a definition set forth in the patents, patent applications, published applications or other publications that are herein incorporated by reference, the definition set forth herein prevails over the definition that is incorporated herein by reference. Citation of the publications or documents is not intended as an admission that any of them is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.
[0036] All headings are for the convenience of the reader and should not be used to limit the meaning of the text that follows the heading, unless so specified.
[0037] The practice of the provided embodiments will employ, unless otherwise indicated, conventional techniques and descriptions of organic chemistry, polymer technology, molecular biology (including recombinant techniques), cell biology, biochemistry, and sequencing technology, which are within the skill of those who practice in the art. Such conventional techniques include polypeptide and protein synthesis and modification, polynucleotide synthesis and modification, polymer array synthesis, hybridization and ligation of polynucleotides, and detection of hybridization using a label. Specific illustrations of suitable techniques can be had by reference to the examples herein. However, other equivalent conventional procedures can, of course, also be used. Such conventional techniques and descriptions can be found in standard laboratory manuals such as Green, et al., Eds., Genome Analysis: A Laboratory Manual Series (Vols. I-IV) (1999); Weiner, Gabriel, Stephens, Eds., Genetic Variation: A Laboratory Manual (2007); Dieffenbach, Dveksler, Eds., PCR Primer: A Laboratory Manual (2003); Bowtell and Sambrook, DNA Microarrays: A Molecular Cloning Manual (2003); Mount, Bioinformatics: Sequence and Genome Analysis (2004); Sambrook and Russell, Condensed Protocols from Molecular Cloning: A Laboratory Manual (2006); and Sambrook and Russell, Molecular Cloning: A Laboratory Manual (2002) (all from Cold Spring Harbor Laboratory Press); Ausubel et al. eds., Current Protocols in Molecular Biology (1987); T. Brown ed., Essential Molecular Biology (1991), IRL Press; Goeddel ed., Gene Expression Technology (1991), Academic Press; A. Bothwell et al. eds., Methods for Cloning and Analysis of Eukaryotic Genes (1990), Bartlett Publ.; M. Kriegler, Gene Transfer and Expression (1990), Stockton Press; R. Wu et al. eds., Recombinant DNA Methodology (1989), Academic Press; M. McPherson et al., PCR: A Practical Approach (1991), IRL Press at Oxford University Press; Stryer, Biochemistry (4th Ed.) (1995), W. H. Freeman, New York N.Y.; Gait, Oligonucleotide Synthesis: A Practical Approach (2002), IRL Press, London; Nelson and Cox, Lehninger, Principles of Biochemistry (2000) 3rd Ed., W. H. Freeman Pub., New York, N.Y.; Berg, et al., Biochemistry (2002) 5th Ed., W. H. Freeman Pub., New York, N.Y.; D. Weir & C. Blackwell, eds., Handbook of Experimental Immunology (1996), Wiley-Blackwell; Cellular and Molecular Immunology (A. Abbas et al., W.B. Saunders Co. 1991, 1994); Current Protocols in Immunology (J. Coligan et al. eds. 1991), all of which are herein incorporated in their entireties by reference for all purposes.
[0038] Throughout this disclosure, various aspects of the claimed subject matter are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the claimed subject matter. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, where a range of values is provided, it is understood that each intervening value, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the claimed subject matter. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the claimed subject matter, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the claimed subject matter. This applies regardless of the breadth of the range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub-ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6.
A. Definitions
[0039] As used herein, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. For example, “a” or “an” means “at least one” or “one or more.” It is understood that aspects and variations described herein include “consisting” and/or “consisting essentially of” aspects and variations.
[0040] The term “about” as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X”.
[0041] As used herein, a composition refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.
[0042] The term “antibody” herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen-binding) antibody fragments, including fragment antigen binding (Fab) fragments, F(ab′)2 fragments, Fab′ fragments, Fv fragments, recombinant IgG (rIgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv. Unless otherwise stated, the term “antibody” should be understood to encompass functional antibody fragments thereof. The term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.
[0043] The “class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, and IgA.sub.2. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively.
[0044] Among the provided antibodies are antibody fragments. An “antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′).sub.2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments. In particular embodiments, the antibodies are single-chain antibody fragments comprising a variable heavy chain region and/or a variable light chain region, such as scFvs.
[0045] Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells. In some embodiments, the antibodies are recombinantly-produced fragments, such as fragments comprising arrangements that do not occur naturally, such as those with two or more antibody regions or chains joined by synthetic linkers, e.g., peptide linkers, and/or that are not produced by enzyme digestion of a naturally-occurring intact antibody.
[0046] Among the provided antibodies are monoclonal antibodies, including monoclonal antibody fragments. The term “monoclonal antibody” as used herein refers to an antibody obtained from or within a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical, except for possible variants containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different epitopes, each monoclonal antibody of a monoclonal antibody preparation is directed against a single epitope on an antigen. The term is not to be construed as requiring production of the antibody by any particular method. A monoclonal antibody may be made by a variety of techniques, including but not limited to generation from a hybridoma, recombinant DNA methods, phage-display and other antibody display methods.
[0047] An “individual” or “subject” includes a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). An “individual” or “subject” may include birds such as chickens, vertebrates such as fish and mammals such as mice, rats, rabbits, cats, dogs, pigs, cows, ox, sheep, goats, horses, monkeys and other non-human primates. In certain embodiments, the individual or subject is a human.
[0048] As used herein, the term “sample” refers to anything which may contain an analyte for which an analyte assay is desired. As used herein, a “sample” can be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof. The sample may be a biological sample, such as a biological fluid or a biological tissue. Examples of biological fluids include urine, blood, plasma, serum, saliva, semen, stool, sputum, cerebral spinal fluid, tears, mucus, amniotic fluid or the like. Biological tissues are aggregate of cells, usually of a particular kind together with their intercellular substance that form one of the structural materials of a human, animal, plant, bacterial, fungal or viral structure, including connective, epithelium, muscle and nerve tissues. Examples of biological tissues also include organs, tumors, lymph nodes, arteries and individual cell(s).
[0049] In some embodiments, the sample is a biological sample. A biological sample of the present disclosure encompasses a sample in the form of a solution, a suspension, a liquid, a powder, a paste, an aqueous sample, or a non-aqueous sample. As used herein, a “biological sample” includes any sample obtained from a living or viral (or prion) source or other source of macromolecules and biomolecules, and includes any cell type or tissue of a subject from which nucleic acid, protein and/or other macromolecule can be obtained. The biological sample can be a sample obtained directly from a biological source or a sample that is processed. For example, isolated nucleic acids that are amplified constitute a biological sample. Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples from animals and plants and processed samples derived therefrom. In some embodiments, the sample can be derived from a tissue or a body fluid, for example, a connective, epithelium, muscle or nerve tissue; a tissue selected from the group consisting of brain, lung, liver, spleen, bone marrow, thymus, heart, lymph, blood, bone, cartilage, pancreas, kidney, gall bladder, stomach, intestine, testis, ovary, uterus, rectum, nervous system, gland, and internal blood vessels; or a body fluid selected from the group consisting of blood, urine, saliva, bone marrow, sperm, an ascitic fluid, and subfractions thereof, e.g., serum or plasma.
B. Methods for Quantitatively Detecting an Antibody
[0050] In one aspect, the present disclosure provides for a method for quantitatively detecting an antibody of a subject to an infectious organism, which method comprises: a) contacting a sample from a subject with an antigen of an infectious organism, or a fragment or analog thereof, to allow binding between an antibody to said antigen of said infectious organism, if present in said sample, and said antigen of said infectious organism, or a fragment or analog thereof; b) assessing a detectable signal due to binding between said antibody and said antigen, or a fragment or analog thereof; and c) comparing said detectable signal to a calibration data set generated using a calibrator antibody that specifically binds to said antigen at multiple concentrations or levels to assess amount, concentration or level of said antibody in said sample, and optionally wherein said calibrator antibody is a chimeric antibody, or a fragment thereof, that comprises a constant region of a species of said subject and a variable region component or a variable region of a different species.
[0051] The present methods can be used for quantitatively detecting an antibody of a subject to an infectious organism in any suitable sample. For example, the present methods can be used for quantitatively detecting an antibody of a subject to an infectious organism in a urine, blood, dry blood spot, plasma, serum, saliva, semen, stool, sputum, cerebral spinal fluid, tear, mucus, and amniotic fluid sample. In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to an infectious organism in a blood, plasma, serum, capillary blood, venous blood, or dried blood sample.
[0052] The present methods can be used for quantitatively detecting an antibody of any suitable subject to an infectious organism. For example, the present methods can be used for quantitatively detecting an antibody of a vertebrate or a mammal to an infectious organism. In some embodiments, the mammal is a human. In other embodiments, the mammal is a non-human mammal, e.g., a non-human primate such as a monkey, a rabbit, or a rodent.
[0053] Any suitable antigen of an infectious organism, or a fragment or analog thereof, can be used in the present methods. For example, the antigen can comprise a surface antigen or a non-surface antigen of an infectious organism, or a fragment or analog thereof. In another example, the antigen can comprise a polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of an infectious organism. In some embodiments, the surface antigen comprises a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of an infectious organism.
[0054] In some embodiments, step a) of the present methods comprises contacting a sample from a subject with an intact or a whole antigen of an infectious organism. In some embodiments, step a) of the present methods comprises contacting a sample from a subject with a fragment or analog of an antigen of an infectious organism.
[0055] The present methods can be used for quantitatively detecting an antibody of a subject to any suitable infectious organism. For example, the present methods can be used for quantitatively detecting an antibody of a subject to a virus, a bacterium, a fungus or a parasite, e.g., a pathogenic virus, bacterium, fungus or parasite (See e.g., https://en.wikipedia.org/wiki/List_of_infectious_diseases).
[0056] In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to a bacterium in a genus of Bacillus, Bartonella, Bordetella, Borrelia, Brucella, Campylobacter, Chlamydia, Chlamydophila, Clostridium, Corynebacterium, Enterococcus, Escherichia, e.g., Escherichia coli, Francisella, Haemophilus, Helicobacter, Legionella, Leptospira, Listeria, Mycobacterium, Mycoplasma, Neisseria, Pseudomonas, Rickettsia, Salmonella, Shigella, Staphylococcus, Streptococcus, Treponema, Ureaplasma, Vibrio or Yersinia. In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to a fungus in a genus of Candida, Aspergillus, Cryptococcus, Histoplasma, e.g., Histoplasma capsulatum, Pneumocystis, or Stachybotrys, e.g., Stachybotrys chartarum. In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to a parasite of a protozoa, a helminth or an ectoparasite. In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to a virus that is Adeno-associated virus, Aichi virus, Australian bat lyssavirus, BK polyomavirus, Banna virus, Barmah forest virus, Bunyamwera virus, Bunyavirus La Crosse, Bunyavirus snowshoe hare, Cercopithecine herpesvirus, Chandipura virus, Chikungunya virus, Cosavirus A, Cowpox virus, Coxsackievirus, Crimean-Congo hemorrhagic fever virus, Dengue virus, Dhori virus, Dugbe virus, Duvenhage virus, Eastern equine encephalitis virus, Ebolavirus, Echoviru, Encephalomyocarditis virus, Epstein-Barr virus, European bat lyssavirus, GB virus C/Hepatitis G virus, Hantaan virus, Hendra virus, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Hepatitis E virus, Hepatitis delta virus, Horsepox virus, Human adenovirus, Human astrovirus, Human coronavirus, Human cytomegalovirus, Human enterovirus 68, 70, Human herpesvirus 1, Human herpesvirus 2, Human herpesvirus 6, Human herpesvirus 7, Human herpesvirus 8, Human immunodeficiency virus, Human papillomavirus 1, Human papillomavirus 2, Human papillomavirus 16,18, Human parainfluenza, Human parvovirus B19, Human respiratory syncytial virus, Human rhinovirus, Human SARS coronavirus, Human spumaretrovirus, Human T-lymphotropic virus, Human torovirus, Influenza A virus, Influenza B virus, Influenza C virus, Isfahan virus, JC polyomavirus, Polyomavirus, Japanese encephalitis virus, Junin arenavirus, KI Polyomavirus, Polyomavirus, Kunjin virus, Lagos bat virus, Lyssavirus, Lake Victoria Marburgvirus, Langat virus, Lassa virus, Lordsdale virus, Louping ill virus, Lymphocytic choriomeningitis virus, Machupo virus, Mayaro virus, MERS coronavirus, Measles virus, Mengo encephalomyocarditis virus, Merkel cell polyomavirus, Mokola virus, Molluscum contagiosum virus, Monkeypox virus, Orthopoxvirus, Mumps virus, Murray valley encephalitis virus, New York virus, Nipah virus, Norwalk virus, onyong-nyong virus, Orf virus, Oropouche virus, Pichinde virus, Poliovirus, Punta toro phlebovirus, Puumala virus, Rabies virus, Rift valley fever virus, Rosavirus A, Ross river virus, Rotavirus A, Rotavirus B, Rotavirus C, Rubella virus, Sagiyama virus, Salivirus A, Sandfly fever sicilian virus, Sapporo virus, Semliki forest virus, Seoul virus, Simian foamy virus, Simian virus 5, Sindbis virus, Southampton virus, St. louis encephalitis virus, Tick-borne powassan virus, Torque teno virus, Toscana virus, Uukuniemi virus, Vaccinia virus, Varicella-zoster virus, Variola virus, Venezuelan equine encephalitis virus, Vesicular stomatitis virus, Western equine encephalitis virus, WU polyomavirus, Polyomavirus, West Nile virus, Yaba monkey tumor virus, Yaba-like disease virus, Yellow fever virus, or Zika virus.
[0057] The present methods can be used for quantitatively detecting an antibody of a subject to a DNA virus or a RNA virus. The present methods can be used for quantitatively detecting an antibody of a subject to a Coronavirus. The Coronavirus can be an alphacoronavirus, a betacoronavirus, a gammacoronavirus or a deltacoronavirus. The Coronavirus can be a human Coronavirus. In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to human coronavirus OC43 (HCoV-OC43), human coronavirus HKU1 (HCoV-HKU1), human coronavirus 229E (HCoV-229E), human coronavirus NL63 (HCoV-NL63), middle east respiratory syndrome-related coronavirus (MERS-CoV), severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1) or severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). In some embodiments, the present methods can be used for quantitatively detecting an antibody of a subject to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
[0058] In the present methods for quantitatively detecting an antibody of a subject to a virus, any suitable viral antigen, or a fragment or analog thereof, can be used. For example, the viral antigen can comprise a viral surface antigen or a non-surface antigen. In another example, the viral antigen can comprise a polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of a virus. In some embodiments, the viral surface antigen can comprise a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of a virus. In some embodiments, step a) of the present methods comprises contacting a sample from a subject with an intact or a whole viral antigen. In some embodiments, step a) of the present methods comprises contacting a sample from a subject with a fragment or analog of a viral antigen.
[0059] In the present methods for quantitatively detecting an antibody of a subject to a severe acute respiratory syndrome coronavirus 2 (BARS-CoV-2), any suitable SARS-CoV-2 antigen, or a fragment or analog thereof, can be used. For example, the antigen can comprise a polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of SARS-CoV-2. In some embodiments, the antigen can comprise a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of SARS-CoV-2. Any suitable SARS-CoV-2 polypeptide, or a fragment or analog thereof, can be used in the present methods. For example, the SARS-CoV-2 S (spike) polypeptide, E (envelope) polypeptide, M (membrane) polypeptide, N (nucleocapsid) polypeptide, or a fragment or analog thereof, can be used in the present methods.
[0060] In some embodiments, step a) of the present methods comprises contacting a sample from a subject with an intact or a whole antigen of SARS-CoV-2. In some embodiments, step a) of the present methods comprises contacting a sample from a subject with a fragment or analog of an antigen of SARS-CoV-2.
[0061] Any suitable SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof, can be used in the present methods. In some embodiments, step a) of the present methods comprises contacting a sample from a subject with an intact or a whole antigen of SARS-CoV-2 S (spike) polypeptide. In some embodiments, step a) of the present methods comprises contacting a sample from a subject with a fragment or analog of SARS-CoV-2 S (spike) polypeptide.
[0062] Any suitable fragment or analog of SARS-CoV-2 S (spike) polypeptide can be used in the present methods. For example, the fragment or analog of SARS-CoV-2 S (spike) polypeptide used in the present methods can comprise the extracellular domain or fragment of SARS-CoV-2 S (spike) polypeptide. In some embodiments, a SARS-CoV-2 S (spike) fragment comprising an amino acid sequence set forth in SEQ ID NO:1 ([PRO_0000449646; Aa 13-1273; GenBank Accession No. P0DTC2]), or the soluble trimeric version of the SARS-CoV-2 spike protein (e.g., the spike protein of SARS-CoV-2 187 isolate (GenBank: MN908947.3) (see e.g., medRxiv preprint doi: https://doi.org/10.1101/2020.03.17.20037713, version posted Mar. 18, 2020; and Vector pCAGGS Containing the SARS-Related Coronavirus 2, Wuhan-Hu-1 Spike Glycoprotein Gene.” The following reagent was deposited by the Centers for Disease Control and Prevention and obtained through BEI Resources, NIAID, NIH: SARS-Related Coronavirus 2, Isolate USA-WA1/2020, NR-52281.” (See e.g., Amanat, F., Stadlbauer, D., Strohmeier, S. et al. A serological assay to detect SARS-CoV-2 seroconversion in humans. Nat Med (2020). https://doi.org/10.1038/s41591-020-0913-5.)
TABLE-US-00001 >sp|P0DTC2|13-1273 SEQ ID NO: 1: SQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNV TWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSS ANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINL VRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGA AAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGI YQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCV ADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLK PFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPF QQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLY QDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYEC DIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSI AIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQ LNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKP SKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLP PLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVT QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTL VKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQL IRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVF LHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEP QIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSP DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKW PWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE PVLKGVKLHYT
[0063] The present methods can use any suitable assay format. In some embodiments, step b) of the present methods comprises contacting a first complex formed between an antibody of a subject and an antigen of an infectious organism, or a fragment or analog thereof, with a binder that binds to the antibody in the first complex, and the binder comprising a detectable label, to form a second complex comprising the antibody, the antigen or a fragment or analog thereof, and the binder comprising the detectable label. Any suitable binder can be used. For example, the binder can be a protein or polypeptide binder, e.g., an antibody, or a non-protein binder, e.g., a binder comprising a peptide or nucleic acid scaffold, such as an aptamer.
[0064] In some embodiments, step b) of the present methods comprises 1) contacting a first complex formed between an antibody of a subject and an antigen of an infectious organism, or a fragment or analog thereof, with a binder that binds to the antibody in the first complex, and the binder comprising a first member of a binding pair, to form a second complex comprising the antibody, the antigen or a fragment or analog thereof, and the binder comprising the first member; and 2) contacting the second complex with a second member of the binding pair that comprises a detectable label and binds to the first member of the binding pair to form a third complex comprising the antibody, the antigen or a fragment or analog thereof, the binder comprising the first member of the binding pair, and the second member of the binding pair comprising a detectable label. Any suitable binder pair can be used. For example, the binding pair can comprise an antigen-antibody binding pair, an avidin (streptavidin)/biotin binding pair, a peptide-binder pair, or a DNA-binder pair.
[0065] The present methods can use any suitable detectable label. For example, the present methods can use a colorimetric, radioactive, enzymatic, luminescent or fluorescent label. In some embodiments, the present methods uses a fluorescent label.
[0066] The present methods can further comprise: 1) applying the second complex comprising the antigen or a fragment or analog thereof, the antibody, and the binder comprising a detectable label; or 2) applying the third complex comprising the antigen or a fragment or analog thereof, the antibody, the binder comprising the first member of the binding pair, and the second member of the binding pair comprising a detectable label, to a surface. The second complex or the third complex can be applied to any suitable surface. For example, the second complex or the third complex can be applied to a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device. In some embodiments, the second complex or the third complex can be applied to a microfluidic device comprising an array of femtoliter reaction wells and to petition a single second complex or a single third complex in a femtoliter reaction well. The present methods can further comprise assessing a detectable signal from a single second complex or a single third complex in a femtoliter reaction well.
[0067] The second complex or third complex can be formed in any suitable manner. For example, the second complex or third complex can be formed on a particle, e.g., a bead. Any suitable particle(s) can be used. In some embodiments, the second complex or the third complex can be formed on a magnetic particle, a nanoparticle, or a polystyrene particle.
[0068] In some embodiments, the second complexes or third complexes are immobilized on particles and the particles are applied to a surface. The second complexes or the third complexes immobilized on particles can be applied to any suitable surface. For example, the second complexes or the third complexes immobilized on particles can be applied to a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device. In some embodiments, the second complexes or the third complexes immobilized on particles can be applied to a microfluidic device comprising an array of femtoliter reaction wells and to petition a single second complex or a single third complex in a femtoliter reaction well. The present methods can further comprise assessing a detectable signal from a single second complex or a single third complex in a femtoliter reaction well.
[0069] The present methods can be conducted in an automated and/or digital assay. For example, the present methods can be conducted in an automated digital assay. In some embodiments, the present methods can be conducted using a fully automated digital immunoassay analyzer, e.g., the Simoa HD-1 Analyzer (See e.g., Wilson et al., Journal of Laboratory Automation, 1-15, © 2015 Society for Laboratory Automation and Screening, DOI: 10.1177/2211068215589580.) In some embodiments, the present methods can be conducted using instruments disclosed and/or claimed in U.S. Pat. Nos. 8,222,047, 8,846,415, 9,678,068, 8,415,171, 9,551,663, 9,952,237, 9,110,025, 9,846,155, 9,932,626, 10,640,814, 10,562,032, 10,191,037, 8,020,571, 8,246,760, 8,679,262, 8,685,486, 8,811,704, 7,585,463, 9,527,085; U.S. patent application publication Nos. US-2010-0075862-A1, US-2010-0075439-A1, US-2010-0075355-A1, US-2011-0212848-A1, US-2016-0123969-A1, US-2018-0003703-A1, US-2020-0123592, US-2013-0142710-A1, US-2013-0266969-A1; and PCT patent application publication No. WO2019/060607.
[0070] In some embodiments, an antigen of an infectious organism, or a fragment or analog thereof, is immobilized on a surface to allow binding between the antibody to the antigen of the infectious organism, if present in the sample, and the antigen of the infectious organism, or a fragment or analog thereof, to form a complex between the antibody and the antigen, or a fragment or analog thereof, on the surface. Any suitable surface can be used. For example, the surface can be part of a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device, or a microfluidic device comprising an array of femtoliter reaction wells. In some embodiments, the present methods can be conducted in an ELISA format.
[0071] The calibration data set can be used in any suitable form. For example, the calibration data set can be used in a form of a calibration table or curve. A calibration table or curve can be obtained using any suitable procedure, process or algorithm. In some embodiments, a calibration curve is obtained using a curve fitting algorithm, e.g., 4-parameter logistical regression fitting algorithm. (See e.g., Azadeh et al., Calibration Curves in Quantitative Ligand Binding Assays: Recommendations and Best Practices for Preparation, Design, and Editing of Calibration Curves. AAPS J. 2017; 20(1):22. Published 2017 Dec. 27, doi:10.1208/s122-18-017-0159-4; Findlay et al., Appropriate calibration curve fitting in ligand binding assays. AAPS J. 2007; 9(2):E260-E267. Published 2007 Jun. 29. doi:10.1208/aapsj0902029; and Wilson et al., The Simoa HD-1 Analyzer: A Novel Fully Automated Digital Immunoassay Analyzer with Single-Molecule Sensitivity and Multiplexing. J. Lab Autom. 2016; 21(4):533-547. doi:10.1177/2211068215589580.)
[0072] The calibration data set can be generated using a single calibrator antibody, or using a plurality of calibrator antibodies. The calibration data set can be generated using a calibrator antibody (or a plurality of calibrator antibodies) at any suitable concentrations or levels. In some embodiments, the calibration data set can be generated using a calibrator antibody (or a plurality of calibrator antibodies) at concentrations or levels ranging from about 0.001 ng/mL to about 10,000 ng/mL, e.g., at about 0.001 ng/mL, 0.01 ng/mL, 0.1 ng/mL, 1 ng/mL, 10 ng/mL, 100 ng/mL, 1,000 ng/mL, 10,0000 ng/mL, or any subrange thereof.
[0073] Any suitable calibrator antibody can be used in the present methods. For example, the calibrator antibody can comprise an intact antibody, e.g., an intact chimeric antibody. In another example, the antibody can be a recombinant, e.g., a recombinant chimeric antibody, or a fragment thereof. In some embodiments, the present methods can be used to quantitatively detect a human antibody to an infectious organism, and the calibrator antibody, or a fragment thereof, can comprise a constant region of a human antibody. In some embodiments, the present methods can be used to quantitatively detect a human antibody to an infectious organism, and the calibrator antibody can comprise a fully human antibody, a humanized antibody, a humanized chimeric antibody, or a fragment thereof.
[0074] In some embodiments, the calibrator antibody, or a fragment thereof, can comprise a variable region component or a variable region of a human, mouse, rat, rabbit, goat, pig, chicken, alpaca, donkey, sheep, hamster, Armenian hamster, golden Syrian hamster, guinea pig, cow, horse, llama, dog, cat, monkey, turkey, duck, recombinant, or mixed species antibody. In some embodiments, the calibrator antibody can comprise a monoclonal antibody, or a fragment thereof.
[0075] The present methods can be used to quantitatively detect any suitable class of antibody to an infectious organism. For example, the present methods can be used to detect a class of IgA, IgD, IgE, IgG, or IgM antibody to an infectious organism. In some embodiments, the present methods can be used to quantitatively detect a class of human IgA, IgD, IgE, IgG, or IgM antibody to an infectious organism. The present methods can be used to quantitatively detect a subclass (or isotype) of antibody to an infectious organism.
[0076] In some embodiments, the present methods can be used to quantitatively detect a class of IgA antibody to an infectious organism, and wherein the binder binds to the IgA antibody in the complex and the calibrator antibody is a chimeric IgA antibody. In some embodiments, the present methods can be used to quantitatively detect a class of IgD antibody to an infectious organism, and wherein the binder binds to the IgD antibody in the complex and the calibrator antibody is a chimeric IgD antibody. In some embodiments, the present methods can be used to quantitatively detect a class of IgE antibody to an infectious organism, and wherein the binder binds to the IgE antibody in the complex and the calibrator antibody is a chimeric IgE antibody. In some embodiments, the present methods can be used to quantitatively detect a class of IgG antibody to an infectious organism, and wherein the binder binds to the IgG antibody in the complex and the calibrator antibody is a chimeric antibody, e.g., a chimeric humanized mouse IgG antibody or a chimeric humanized mouse IgG specific for COVID-19 S1 spike protein. In some embodiments, the present methods can be used to quantitatively detect a class of IgM antibody to an infectious organism, and wherein the binder binds to the IgM antibody in the complex and the calibrator antibody is a chimeric IgM antibody.
[0077] The present methods can be used to quantitatively detect any suitable number of antibody or to antibodies an infectious organism. In some embodiments, the present methods can be used to quantitatively detect a single antibody to an infectious organism. In some embodiments, the present methods can be used to quantitatively detect multiple antibodies to an infectious organism. In some embodiments, the present methods can be used to quantitatively detect multiple antibodies to a single infectious organism. In some embodiments, the present methods can be used to quantitatively detect multiple antibodies to multiple infectious organisms. In some embodiments, the present methods can be used to quantitatively detect multiple antibodies in the same class or subclasses (or isotypes).
[0078] In some embodiments, the present methods can be used to quantitatively detect multiple antibodies in different subclasses (or isotypes). In some embodiments, the present methods can be used to quantitatively detect multiple antibodies in different classes. In some embodiments, the present methods can be used to quantitatively detect multiple antibodies in different subclasses (or isotypes). In some embodiments, the present methods can further comprise assessing comparison, e.g., a ratio, between or among concentrations or levels of antibodies in different subclasses (or isotypes).
[0079] In some embodiments, the present methods can be used to quantitatively detect an antibody to SARS-CoV-2 in a human. In some embodiments, the present methods can be used to quantitatively detect an IgG antibody to SARS-CoV-2 in a human.
[0080] In some embodiments, the present methods can be used to quantitatively detect an antibody, e.g., an IgG antibody, to SARS-CoV-2 protein mutant(s) or variant(s) in a subject or a human. The SARS-CoV-2 protein mutant(s) or variant(s) include mutant(s) or variant(s) with amino acid addition(s), deletion(s) and/or substitution(s). In the methods for quantitatively detecting an antibody, e.g., an IgG antibody, to SARS-CoV-2 protein mutant(s) or variant(s), the corresponding SARS-CoV-2 protein mutant(s) or variant(s) can be used as an antigen, or a fragment thereof, to contact with an antibody in a subject or a human.
[0081] In some embodiments, the present methods can be used to quantitatively detect an antibody to SARS-CoV-2 spike (S) protein in a subject or a human. In some embodiments, the present methods can be used to quantitatively detect an IgG antibody to spike (S) protein in a subject or a human. In some embodiments, the present methods can be used to quantitatively detect an antibody, e.g., an IgG antibody, to SARS-CoV-2 spike (S) protein mutant(s) or variant(s) in a subject or a human. The SARS-CoV-2 protein spike (S) mutant(s) or variant(s) include mutant(s) or variant(s) with amino acid addition(s), deletion(s) and/or substitution(s). Exemplary spike (S) protein mutant(s) or variant(s) include D614G, L5F, L8V, V367F, G476S, V483A, H49Y, Y145H/del, Q239K, A831V, D839Y/N/E, P1263L, and/or a combination thereof (See e.g., bioRxiv preprint doi: https://doi.org/10.1101/2020.04.29.069054; posted May 5, 2020). In the methods for quantitatively detecting an antibody, e.g., an IgG antibody, to SARS-CoV-2 spike (S) protein mutant(s) or variant(s), the corresponding SARS-CoV-2 spike (S) protein mutant(s) or variant(s) can be used as an antigen, or a fragment thereof, to contact with an antibody in a subject or a human.
[0082] The present methods can be conducted or performed in any suitable format or manner. For example, the present methods can be conducted or performed manually, can be semi-automated or fully automated.
[0083] The present methods can be conducted or performed with any suitable throughput. For example, the present methods can have a throughput ranging from about 10 tests/hour to about 100 tests/hour, e.g., about 10 tests/hour, 20 tests/hour, 30 tests/hour, 40 tests/hour, 50 tests/hour, 60 tests/hour, 70 tests/hour, 80 tests/hour, 90 tests/hour, 100 tests/hour, or any subrange thereof.
[0084] The present methods can be conducted or performed in any suitable time period. For example, the present methods can be conducted in a time period from about 20 minutes to about 300 minutes, e.g., about 20 minutes, 30 minutes, 40 minutes, 50 minutes, 60 minutes, 70 minutes, 80 minutes, 90 minutes, 100 minutes, 150 minutes, 200 minutes, 250 minutes, 300 minutes, or any subrange thereof, till first result or results of a set number of tests, e.g., about 250-300 samples, are obtained.
[0085] In some embodiments, the present methods can be used for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and has a detection cut-off from about 2 ng/mL to about 5 ng/mL, e.g., about 2 ng/mL, 3 ng/mL, 4 ng/mL, 5 ng/mL, or any subrange thereof.
[0086] In some embodiments, the present methods can be used for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and have a precision (or CV) ranging from about 3% to about 30%, e.g., about 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, or any subrange thereof. In some embodiments, the present methods can have a between-run precision CV ranging from 5% to about 20%, e.g., about 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or any subrange thereof. In some embodiments, the present methods can have a within-run precision CV ranging from 3% to 30%, e.g., about 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, or any subrange thereof.
[0087] In some embodiments, the present methods can be used for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and can have a sensitivity ranging from about 2 fg/mL to about 1 ng/mL, e.g., about 2 fg/mL, 10 fg/mL, 100 fg/mL, 1,000 fg/mL, 1,000 fg/mL, 0.01 ng/mL, 0.1 ng/mL, 1 ng/mL, or any subrange thereof.
[0088] In some embodiments, the present methods can be used for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and can have a specificity, e.g., IgG specificity, ranging from about 70% to about 100%, e.g., about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or any subrange thereof.
[0089] In some embodiments, the present methods can be used for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and the quantitation results from comparable serum and plasma samples are within from about 0% to about 20% of each other, e.g., about 0%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or any subrange thereof.
[0090] The present methods can be used for any suitable purposes or utilities. For example, the present methods can be used to aid or facilitate diagnosis, prognosis, risk assessment, stratification and/or treatment monitoring of infection by an infectious organism in a subject, and/or for research and drug/vaccine discovery and/or development.
[0091] The present methods can be used to assess an immune response to an infectious organism in a subject. For example, the present methods can be used to assess an immune response to SARS-CoV-2 in a subject, e.g., a human subject or patient.
[0092] The present methods can be used to assess past infection by an infectious organism in a subject. For example, the present methods can be used to assess past infection by SARS-CoV-2 in a subject, e.g., a human subject or patient.
[0093] The present methods can be used to assess IgG seroconversion to an infectious organism in a subject. For example, the present methods can be used to assess IgG seroconversion to SARS-CoV-2 in a subject, e.g., a human subject or patient.
[0094] In another aspect, the present disclosure provides for a method for quantitatively detecting a human antibody to SARS-CoV-2 S (spike) polypeptide, which method comprises: a) contacting a sample from a subject with a SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof, to allow binding between an antibody to a SARS-CoV-2 S (spike) polypeptide, if present in said sample, and said SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof; b) assessing a detectable signal due to binding between said antibody and said SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof; and c) comparing said detectable signal to a calibration data set generated using a calibrator antibody that specifically binds to said SARS-CoV-2 S (spike) polypeptide at multiple concentrations or levels to assess amount, concentration or level of said antibody in said sample, and, wherein said calibrator antibody is a chimeric antibody, or a fragment thereof, that comprises a human constant region and a variable region component or a variable region of a non-human species.
C. Kits for Quantitatively Detecting an Antibody
[0095] In still another aspect, the present disclosure provides for a kit for quantitatively detecting an antibody of a subject to an infectious organism, which kit comprises: a) an antigen of an infectious organism, or a fragment or analog thereof; and b) a calibrator antibody that specifically binds to said antigen, optionally at multiple concentrations or levels, for generating a calibration data set.
[0096] The present kits can be used for quantitatively detecting an antibody of a subject to an infectious organism in any suitable sample. For example, the present kits can be used for quantitatively detecting an antibody of a subject to an infectious organism in a urine, blood, dry blood spot, plasma, serum, saliva, semen, stool, sputum, cerebral spinal fluid, tear, mucus, and amniotic fluid sample. In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to an infectious organism in a blood, plasma, serum, capillary blood, venous blood, or dried blood sample.
[0097] The present kits can be used for quantitatively detecting an antibody of any suitable subject to an infectious organism. For example, the present kits can be used for quantitatively detecting an antibody of a vertebrate or a mammal to an infectious organism. In some embodiments, the mammal is a human. In other embodiments, the mammal is a non-human mammal, e.g., a non-human primate such as a monkey, a rabbit, or a rodent.
[0098] The present kits can comprise any suitable antigen of an infectious organism, or a fragment or analog thereof. For example, the antigen can comprise a surface antigen or a non-surface antigen of an infectious organism, or a fragment or analog thereof. In another example, the antigen can comprise a polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of an infectious organism. In some embodiments, the surface antigen comprises a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of an infectious organism. In some embodiments, the present kits comprise an intact or a whole antigen. In some embodiments, the present kits comprise a fragment or analog of an antigen.
[0099] The present kits can be used for quantitatively detecting an antibody of a subject to any suitable infectious organism. For example, the present kits can be used for quantitatively detecting an antibody of a subject to a virus, a bacterium, a fungus or a parasite, e.g., a pathogenic virus, bacterium, fungus or parasite (See e.g., https://en.wikipedia.org/wiki/List_of_infectious_diseases).
[0100] In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to a bacterium in a genus of Bacillus, Bartonella, Bordetella, Borrelia, Brucella, Campylobacter, Chlamydia, Chlamydophila, Clostridium, Corynebacterium, Enterococcus, Escherichia, e.g., Escherichia coli, Francisella, Haemophilus, Helicobacter, Legionella, Leptospira, Listeria, Mycobacterium, Mycoplasma, Neisseria, Pseudomonas, Rickettsia, Salmonella, Shigella, Staphylococcus, Streptococcus, Treponema, Ureaplasma, Vibrio or Yersinia. In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to a fungus in a genus of Candida, Aspergillus, Cryptococcus, Histoplasma, e.g., Histoplasma capsulatum, Pneumocystis, or Stachybotrys, e.g., Stachybotrys chartarum. In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to a parasite of a protozoa, a helminth or an ectoparasite. In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to a virus that is Adeno-associated virus, Aichi virus, Australian bat lyssavirus, BK polyomavirus, Banna virus, Barmah forest virus, Bunyamwera virus, Bunyavirus La Crosse, Bunyavirus snowshoe hare, Cercopithecine herpesvirus, Chandipura virus, Chikungunya virus, Cosavirus A, Cowpox virus, Coxsackievirus, Crimean-Congo hemorrhagic fever virus, Dengue virus, Dhori virus, Dugbe virus, Duvenhage virus, Eastern equine encephalitis virus, Ebolavirus, Echoviru, Encephalomyocarditis virus, Epstein-Barr virus, European bat lyssavirus, GB virus C/Hepatitis G virus, Hantaan virus, Hendra virus, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Hepatitis E virus, Hepatitis delta virus, Horsepox virus, Human adenovirus, Human astrovirus, Human coronavirus, Human cytomegalovirus, Human enterovirus 68, 70, Human herpesvirus 1, Human herpesvirus 2, Human herpesvirus 6, Human herpesvirus 7, Human herpesvirus 8, Human immunodeficiency virus, Human papillomavirus 1, Human papillomavirus 2, Human papillomavirus 16,18, Human parainfluenza, Human parvovirus B19, Human respiratory syncytial virus, Human rhinovirus, Human SARS coronavirus, Human spumaretrovirus, Human T-lymphotropic virus, Human torovirus, Influenza A virus, Influenza B virus, Influenza C virus, Isfahan virus, JC polyomavirus, Polyomavirus, Japanese encephalitis virus, Junin arenavirus, KI Polyomavirus, Polyomavirus, Kunjin virus, Lagos bat virus, Lyssavirus, Lake Victoria Marburgvirus, Langat virus, Lassa virus, Lordsdale virus, Louping ill virus, Lymphocytic choriomeningitis virus, Machupo virus, Mayaro virus, MERS coronavirus, Measles virus, Mengo encephalomyocarditis virus, Merkel cell polyomavirus, Mokola virus, Molluscum contagiosum virus, Monkeypox virus, Orthopoxvirus, Mumps virus, Murray valley encephalitis virus, New York virus, Nipah virus, Norwalk virus, onyong-nyong virus, Orf virus, Oropouche virus, Pichinde virus, Poliovirus, Punta toro phlebovirus, Puumala virus, Rabies virus, Rift valley fever virus, Rosavirus A, Ross river virus, Rotavirus A, Rotavirus B, Rotavirus C, Rubella virus, Sagiyama virus, Salivirus A, Sandfly fever sicilian virus, Sapporo virus, Semliki forest virus, Seoul virus, Simian foamy virus, Simian virus 5, Sindbis virus, Southampton virus, St. louis encephalitis virus, Tick-borne powassan virus, Torque teno virus, Toscana virus, Uukuniemi virus, Vaccinia virus, Varicella-zoster virus, Variola virus, Venezuelan equine encephalitis virus, Vesicular stomatitis virus, Western equine encephalitis virus, WU polyomavirus, Polyomavirus, West Nile virus, Yaba monkey tumor virus, Yaba-like disease virus, Yellow fever virus, or Zika virus.
[0101] The present kits can be used for quantitatively detecting an antibody of a subject to a DNA virus or a RNA virus. The present kits can be used for quantitatively detecting an antibody of a subject to a Coronavirus. The Coronavirus can be an alphacoronavirus, a betacoronavirus, a gammacoronavirus or a deltacoronavirus. The Coronavirus can be a human Coronavirus. In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to human coronavirus OC43 (HCoV-OC43), human coronavirus HKU1 (HCoV-HKU1), human coronavirus 229E (HCoV-229E), human coronavirus NL63 (HCoV-NL63), middle east respiratory syndrome-related coronavirus (MERS-CoV), severe acute respiratory syndrome coronavirus (SARS-CoV or SARS-CoV-1) or severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). In some embodiments, the present kits can be used for quantitatively detecting an antibody of a subject to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2).
[0102] In the present kits for quantitatively detecting an antibody of a subject to a virus, any suitable viral antigen, or a fragment or analog thereof, can be used. For example, the viral antigen can comprise a viral antigen or a non-surface antigen. In another example, the viral antigen can comprise a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of a virus. In some embodiments, the viral surface antigen can comprise a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of a virus. In some embodiments, the present kits comprise an intact or a whole viral antigen. In some embodiments, the present kits comprise a fragment or analog of a viral antigen.
[0103] In the present kits for quantitatively detecting an antibody of a subject to a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), any suitable SARS-CoV-2 antigen, or a fragment or analog thereof, can be used. For example, the antigen can comprise a polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of SARS-CoV-2. In some embodiments, the antigen can comprise a surface polypeptide, lipid, sugar, polysaccharide, a fragment thereof, a combination thereof, of SARS-CoV-2. Any suitable SARS-CoV-2 polypeptide, or a fragment or analog thereof, can be used in the present kits. For example, the SARS-CoV-2 S (spike) polypeptide, E (envelope) polypeptide, M (membrane) polypeptide, N (nucleocapsid) polypeptide, or a fragment thereof, can be used in the present kits.
[0104] In some embodiments, the present kits comprise an intact or a whole antigen of SARS-CoV-2. In some embodiments, the present kits comprise a fragment or analog of an antigen of SARS-CoV-2.
[0105] Any suitable SARS-CoV-2 S (spike) polypeptide, or a fragment or analog thereof, can be used in the present kits. In some embodiments, the present kits comprise an intact or a whole antigen of SARS-CoV-2 S (spike) polypeptide. In some embodiments, the present kits comprise a fragment or analog of SARS-CoV-2 S (spike) polypeptide.
[0106] Any suitable fragment or analog of SARS-CoV-2 S (spike) polypeptide can be used in the present kits. For example, the fragment or analog of SARS-CoV-2 S (spike) polypeptide used in the present kits can comprise the extracellular domain or fragment of SARS-CoV-2 S (spike) polypeptide. In some embodiments, a SARS-CoV-2 S (spike) fragment comprises an amino acid sequence set forth in SEQ ID NO:1 ([PRO_0000449646; Aa 13-1273; GenBank Accession No. P0DTC2]), or the soluble trimeric version of the SARS-CoV-2 spike protein (e.g., the spike protein of SARS-CoV-2 187 isolate (GenBank: MN908947.3) (see e.g., medRxiv preprint doi: https://doi.org/10.1101/2020.03.17.20037713, version posted Mar. 18, 2020; and Vector pCAGGS Containing the SARS-Related Coronavirus 2, Wuhan-Hu-1 Spike Glycoprotein Gene.” The following reagent was deposited by the Centers for Disease Control and Prevention and obtained through BEI Resources, NIAID, NIH: SARS-Related Coronavirus 2, Isolate USA-WA1/2020, NR-52281. (See e.g., Amanat, F., Stadlbauer, D., Strohmeier, S. et al. A serological assay to detect SARS-CoV-2 seroconversion in humans. Nat Med (2020). https://doi.org/10.1038/s41591-020-0913-5.).)
TABLE-US-00002 >sp|P0DTC2|13-1273 SEQ ID NO: 1: SQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNV TWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSS ANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINL VRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGA AAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGI YQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCV ADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLK PFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPF QQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLY QDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYEC DIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSI AIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQ LNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKP SKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLP PLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVT QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTL VKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQL IRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVF LHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEP QIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSP DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKW PWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE PVLKGVKLHYT
[0107] The present kits can further comprises a binder that binds to an antibody of a subject to an infectious organism. Any suitable binder can be used. For example, the binder can be a protein or polypeptide binder, e.g., an antibody, or a non-protein binder, e.g., a binder comprising a peptide or nucleic acid scaffold, such as an aptamer. In some embodiments, the binder can comprise a detectable label, e.g., a colorimetric, radioactive, enzymatic, luminescent or fluorescent label.
[0108] The present kits can further comprise a binder that binds to an antibody of a subject to an infectious organism, the binder comprising a first member of a binding pair. In some embodiments, the present kits can further comprise a second member of the binding pair. In some embodiments, the second member can comprises a detectable label, e.g., a colorimetric, radioactive, enzymatic, luminescent or fluorescent label. Any suitable binder pair can be used. For example, the binding pair can comprise an antigen-antibody binding pair, an avidin (streptavidin)/biotin binding pair, a peptide-binder pair, or a DNA-binder pair.
[0109] The present kits can comprise any suitable detectable label. For example, the present kits can comprise a colorimetric, radioactive, enzymatic, luminescent or fluorescent label. In some embodiments, the present kits comprises a fluorescent label.
[0110] The present kits can further comprise a particle, e.g., a bead. Any suitable particle(s) can be used. In some embodiments, the present kits can comprise a magnetic particle, a nanoparticle, or a polystyrene particle.
[0111] In some embodiments, the present kits can comprise a surface on which an antigen of an infectious organism, or a fragment or analog thereof, can be immobilized to allow binding between the antibody to the antigen of the infectious organism, and the antigen of the infectious organism, or a fragment or analog thereof, to form a complex between the antibody and the antigen, or a fragment or analog thereof, on the surface. Any suitable surface can be used. For example, the surface can be part of a solid surface, a planar surface or a porous surface, or a microtiter plate, e.g., a 96/384 well microtiter plate, a microtiter plate comprising microwells, a microfluidic device, or a microfluidic device comprising an array of femtoliter reaction wells. In some embodiments, the present kits can be configured for an ELISA format.
[0112] The present kits can comprise any suitable calibrator antibody. For example, the present kits can comprise a calibrator antibody that is a chimeric antibody, or a fragment thereof. In some embodiments, the calibrator antibody can comprise a constant region of a species of a subject and a variable region component of a different species.
[0113] The present kits can comprise a single calibrator antibody or a plurality of calibrator antibodies for generating a calibration data set. The present kits can comprise a calibrator antibody (or a plurality of calibrator antibodies) at any suitable multiple concentrations or levels for generating a calibration data set. In some embodiments, the present kits can comprise a calibrator antibody (or a plurality of calibrator antibodies) at concentrations or levels ranging from about 0.001 ng/mL to about 10,000 ng/mL, e.g., at about 0.001 ng/mL, 0.01 ng/mL, 0.1 ng/mL, 1 ng/mL, 10 ng/mL, 100 ng/mL, 1,000 ng/mL, 10,0000 ng/mL, or any subrange thereof.
[0114] The present kits can comprise any suitable calibrator antibody. For example, the calibrator antibody can comprise an intact antibody, e.g., an intact chimeric antibody. In another example, the antibody can be a recombinant, e.g., a recombinant chimeric antibody, or a fragment thereof.
[0115] In some embodiments, the present kits can be configured for quantitatively detecting a human antibody to an infectious organism, and the calibrator antibody, or a fragment thereof, can comprise a constant region of a human antibody. In some embodiments, the present kits can be configured for quantitatively detecting a human antibody to an infectious organism, and the calibrator antibody can comprise a fully human antibody, a humanized antibody, a humanized chimeric antibody, or a fragment thereof.
[0116] In some embodiments, the calibrator antibody, or a fragment thereof, can comprise a variable region component or a variable region of a human, mouse, rat, rabbit, goat, pig, chicken, alpaca, donkey, sheep, hamster, Armenian hamster, golden Syrian hamster, guinea pig, cow, horse, llama, dog, cat, monkey, turkey, duck, recombinant, or mixed species antibody. In some embodiments, the calibrator antibody can comprise a monoclonal antibody, or a fragment thereof.
[0117] The present kits can be configured for quantitatively detecting any suitable class of antibody to an infectious organism. For example, the present kits can be configured for quantitatively detecting a class of IgA, IgD, IgE, IgG, or IgM antibody to an infectious organism. In some embodiments, the present kits can be configured for quantitatively detecting a class of human IgA, IgD, IgE, IgG, or IgM antibody to an infectious organism. The present kits can be configured for quantitatively detecting a subclass (or isotype) of antibody to an infectious organism.
[0118] In some embodiments, the present kits can be configured for quantitatively detecting a class of IgA antibody to an infectious organism, and wherein the binder binds to the IgA antibody in the complex and the calibrator antibody is a chimeric IgA antibody. In some embodiments, the present kits can be configured for quantitatively detecting a class of IgD antibody to an infectious organism, and wherein the binder binds to the IgD antibody in the complex and the calibrator antibody is a chimeric IgD antibody. In some embodiments, the present kits can be configured for quantitatively detecting a class of IgE antibody to an infectious organism, and wherein the binder binds to the IgE antibody in the complex and the calibrator antibody is a chimeric IgE antibody. In some embodiments, the present kits can be configured for quantitatively detecting a class of IgG antibody to an infectious organism, and wherein the binder binds to the IgG antibody in the complex and the calibrator antibody is a chimeric antibody, e.g., a chimeric humanized mouse IgG antibody or a chimeric humanized mouse IgG specific for COVID-19 S1 spike protein. In some embodiments, the present kits can be configured for quantitatively detecting a class of IgM antibody to an infectious organism, and wherein the binder binds to the IgM antibody in the complex and the calibrator antibody is a chimeric IgM antibody.
[0119] The present kits can be configured for quantitatively detecting any suitable number of antibody or to antibodies an infectious organism. In some embodiments, the present kits can be configured for quantitatively detecting a single antibody to an infectious organism. In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies to an infectious organism. In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies to a single infectious organism. In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies to multiple infectious organisms. In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies in the same class or subclasses (or isotypes).
[0120] In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies in different subclasses (or isotypes). In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies in different classes. In some embodiments, the present kits can be configured for quantitatively detecting multiple antibodies in different subclasses (or isotypes).
[0121] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to SARS-CoV-2 in a human. In some embodiments, the present kits can be configured for quantitatively detecting an IgG antibody to SARS-CoV-2 in a human.
[0122] In some embodiments, the present kits can be configured for quantitatively detecting an antibody, e.g., an IgG antibody, to SARS-CoV-2 protein mutant(s) or variant(s) in a subject or a human. The SARS-CoV-2 protein mutant(s) or variant(s) include mutant(s) with amino acid addition(s), deletion(s) and/or substitution(s). In the kits for quantitatively detecting an antibody, e.g., an IgG antibody, to SARS-CoV-2 protein mutant(s) or variant(s), the corresponding SARS-CoV-2 protein mutant(s) or variant(s) can be used as an antigen, or a fragment thereof, to contact with an antibody in a subject or a human.
[0123] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to SARS-CoV-2 spike (S) protein in a subject or a human. In some embodiments, the present kits can be configured for quantitatively detecting an IgG antibody to spike (S) protein in a subject or a human. In some embodiments, the present kits can be configured for quantitatively detecting an antibody, e.g., an IgG antibody, to SARS-CoV-2 spike (S) protein mutant(s) or variant(s) in a subject or a human. The SARS-CoV-2 protein spike (S) mutant(s) or variant(s) include mutant(s) or variant(s) with amino acid addition(s), deletion(s) and/or substitution(s). Exemplary spike (S) protein mutant(s) or variant(s) include D614G, L5F, L8V, V367F, G476S, V483A, H49Y, Y145H/del, Q239K, A831V, D839Y/N/E, P1263L, and/or a combination thereof (See e.g., bioRxiv preprint doi: https://doi.org/10.1101/2020.04.29.069054; posted May 5, 2020). In the kits for quantitatively detecting an antibody, e.g., an IgG antibody, to SARS-CoV-2 spike (S) protein mutant(s) or variant(s), the corresponding SARS-CoV-2 spike (S) protein mutant(s) or variant(s) can be used as an antigen, or a fragment thereof, to contact with an antibody in a subject or a human.
[0124] The present kits can be configured to be conducted or performed with any suitable throughput. For example, the present kits can be configured to have a throughput ranging from about 10 tests/hour to about 100 tests/hour, e.g., about 10 tests/hour, 20 tests/hour, 30 tests/hour, 40 tests/hour, 50 tests/hour, 60 tests/hour, 70 tests/hour, 80 tests/hour, 90 tests/hour, 100 tests/hour, or any subrange thereof.
[0125] The present kits can be configured to be conducted or performed in any suitable time period. For example, the present kits can be configured to be conducted in a time period from about 20 minutes to about 300 minutes, e.g., about 20 minutes, 30 minutes, 40 minutes, 50 minutes, 60 minutes, 70 minutes, 80 minutes, 90 minutes, 100 minutes, 150 minutes, 200 minutes, 250 minutes, 300 minutes, or any subrange thereof, till first result or results of a set number of tests, e.g., about 250-300 samples, are obtained.
[0126] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and has a detection cut-off from about 2 ng/mL to about 5 ng/mL, e.g., about 2 ng/mL, 3 ng/mL, 4 ng/mL, 5 ng/mL, or any subrange thereof.
[0127] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and have a precision (or CV) ranging from about 3% to about 30%, e.g., about 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, or any subrange thereof. In some embodiments, the present kit can be configured to have a between-run precision CV ranging from 5% to about 20%, e.g., about 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or any subrange thereof. In some embodiments, the present kit can be configured to have a within-run precision CV ranging from 3% to 30%, e.g., about 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, or any subrange thereof.
[0128] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and can have a sensitivity ranging from about 2 fg/mL to about 1 ng/mL, e.g., about 2 fg/mL, 10 fg/mL, 100 fg/mL, 1,000 fg/mL, 1,000 fg/mL, 0.01 ng/mL, 0.1 ng/mL, 1 ng/mL, or any subrange thereof.
[0129] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and can have a specificity, e.g., IgG specificity, ranging from about 70% to about 100%, e.g., about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or any subrange thereof.
[0130] In some embodiments, the present kits can be configured for quantitatively detecting an antibody to COVID-19 S1 spike protein, e.g., a class of IgG antibody to COVID-19 S1 spike protein, and the quantitation results from comparable serum and plasma samples are within from about 0% to about 20% of each other, e.g., about 0%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or any subrange thereof.
[0131] The present kits can be configured for any suitable purposes or utilities. For example, the present kits can be configured to aid or facilitate diagnosis, prognosis, risk assessment, stratification and/or treatment monitoring of infection by an infectious organism in a subject, and/or for research and drug/vaccine discovery and/or development.
[0132] The present kits can be configured to assess an immune response to an infectious organism in a subject. For example, the present kits can be configured to assess an immune response to SARS-CoV-2 in a subject, e.g., a human subject or patient.
[0133] The present kits can be configured to assess past infection by an infectious organism in a subject. For example, the present kits can be configured to assess past infection by SARS-CoV-2 in a subject, e.g., a human subject or patient.
[0134] The present kits can be configured to assess IgG seroconversion to an infectious organism in a subject. For example, the present kits can be configured to assess IgG seroconversion to SARS-CoV-2 in a subject, e.g., a human subject or patient.
D. Description of Exemplary Device
[0135] D.1. Assay Biological Principles
[0136] The Simoa COVID-19 IgG Antibody Test is a 3-step paramagnetic microbead-based sandwich ELISA. In the first step, sample is drawn from a sample tube by the instrument pipettor and mixed with COVID-19 spike protein coated paramagnetic capture beads in a reaction cuvette. IgG antibodies in the sample that are specific to COVID-19 spike protein are bound by the capture beads. After an incubation, capture beads are collected with a magnet, and washed. Biotinylated anti-human IgG detector antibodies are then mixed with the capture beads, and the detector antibodies bind to the captured sample IgG. Following a second wash, a conjugate of streptavidin-β-galactosidase (SBG) is mixed with the capture beads. SBG binds to the biotinylated detector antibodies, resulting in enzyme labeling of captured sample IgG. After a third wash, the capture beads are resuspended in a resorufin β-D-galactopyranoside (RGP) substrate solution. Digital processing occurs when beads are transferred to the Simoa array disc which is composed of microarrays of femtoliter reaction wells. Individual capture beads are then sealed within microwells in the array through the addition of oil, which forms a liquid seal trapping the labeled immunocomplexes and RGP within the wells. If anti-spike IgG from the sample has been captured and labeled, the β-galactosidase hydrolyzes the RGP substrate into a fluorescent product that provides the signal for measurement. The concentration of IgG in unknown samples is interpolated from a calibration curve obtained by 4-parameter logistical regression fitting. Total time to first result is 80 minutes.
[0137] D.2. Reagents and Test Components
[0138] D.2.1. Simoa COVID-19 IgG Antibody Test Kit
[0139] The following Table 1 summarizes the reagent components of COVID-19 IgG antibody test kit:
TABLE-US-00003 Bead 1 bottle COVID-19 spike protein (recombinant) coated Reagent (4.5 mL) capture beads in Tris buffer with a protein stabilizer (bovine) and a surfactant. Preservative: ProClin 300. Detector 1 bottle Biotinylated anti-human IgG antibody Reagent (11.8 mL) (mouse monoclonal) in phosphate buffer with a protein stabilizer (bovine) and a surfactant. Preservative: ProClin 300. SBG 1 bottle Conjugate of streptavidin-β-galactosidase Reagent (11.8 mL) (SBG) in phosphate buffer with a protein stabilizer (bovine). Preservative: ProClin 300. Sample 2 bottles Phosphate buffer with a protein stabilizer Diluent (13.1 mL) (bovine), a heterophilic blocker, and a surfactant. Preservative: Sodium azide. RGP 2 bottles Resorufin β-D-galactopyranoside (RGP) Reagent (3.4 mL) in phosphate buffer with a surfactant.
[0140] The 2-8C shelf life of kit reagents has not yet been established.
[0141] D.2.2. Simoa COVID-19 IgG Calibrators
[0142] 8 vials (1 mL each) of Anti-COVID-19 IgG Calibrators. Calibrator A is phosphate buffer with a protein stabilizer (bovine), a surfactant, and sodium azide as a preservative. Calibrators B through H are chimeric humanized mouse IgG (specific for COVID-19 S1 spike protein) in Calibrator A buffer. The chimeric humanized mouse IgG is a monoclonal antibody combining the constant domains of the human IgG1 molecule with mouse variable regions. The variable region was obtained from a mouse immunized with purified, recombinant SARS-CoV S1 spike protein and produced using recombinant antibody technology. The calibrators (and controls) are value-assigned on a lot-by-lot basis comparing to frozen primary reference standards. Manufacturing tolerances for the value-assignment step ensure reproducibility across lots. Primary reference standards are chimeric humanized mouse IgG (specific for COVID-19 S1 spike protein) in human serum. No international reference material is available for anti-COVID-19 IgG, and the chimeric humanized anti-COVID-19 IgG Calibrators are stored frozen and thawed at the point of use. Concentrations of kit calibrator levels below are approximations based on typical values (see Table 2 below):
TABLE-US-00004 Calibrator IgG concentration (ng/mL)* A 0 B 0.02 C 0.1 D 0.4 E 2.0 F 10 G 50 H 250 *Tentative target levels based on current data. Actual concentrations vary slightly from lot-to-lot. Sample results based on chimeric calibrators are proportional to antibody titer, but they may not reflect absolute concentrations of native anti-COVID IgG.
[0143] The frozen shelf life of kit calibrators has not yet been established.
[0144] D.2.3. Simoa COVID-19 IgG Controls
[0145] 2 bottles (1.0 mL each) of Anti-COVID-19 IgG Controls in phosphate buffer with a protein stabilizer (bovine), a surfactant, and sodium azide as a preservative. Controls provide a check on calibration curve validity and are prepared as per Anti-COVID-19 IgG Calibrators, with value-assignments made on a lot-by-lot basis through calibration to primary reference calibrators. Controls are prepared at the following approximate concentrations (see Table 3 below):
TABLE-US-00005 Control IgG concentration (g/mL)* 1 (negative) 0.5 2 (positive) 20 *Tentative target levels based on current data. Actual concentrations vary slightly from lot-to-lot. Sample results based on chimeric calibrators are proportional to antibody titer, but they may not reflect absolute concentrations of native anti-COVID IgG.
[0146] The negative control level was chosen to be below the preliminary cut-off (0.02 ng/mL) and to be representative of non-specific binding of IgG in individuals uninfected by COVID-19. The positive control was chosen to be in the lower range of reactivity (lower 0.2% of the dynamic range). As with the calibrators, controls are stored frozen and thawed at the point of use. The frozen shelf life of kit controls has not yet been established.
[0147] D.2.4. Other Test Components
[0148] Non-specific reagent components are required for the HD-X system to run the Simoa COVID-19 IgG assay. These are listed in Table 4 below:
TABLE-US-00006 System Wash Buffer 1 Phosphate buffer with surfactant. Preservative: ProClin 300. System Wash Buffer 2 Phosphate buffer. Preservative: ProClin 300. Sealing Oil Synthetic fluorinated polymer
[0149] These components are obtained directly from Quanterix.
[0150] D.3. HD-X Analyzer
[0151] D.3.1. Instrument and Operation
[0152] The HD-X system is manufactured by Stratec Biomedical Systems (Birkenfeld, Germany) under ISO 13485. The instrument is a floor-standing fully automated immunoassay analyzer consisting of five main functional areas (
[0153] The HD-X system was designed to minimize operator intervention. To operate the system, the user interfaces routinely with the input and system bays and the flat-screen monitor. Test orders and run load lists are entered through the touchscreen monitor. Samples, assay reagents, and disposables are loaded into their respective bays. The input bays are accessed from the front of the instrument. Samples can be loaded either as tubes (up to 96) or in microtiter plates (up to four 96-well plates). When sample tubes are added to a sample rack and inserted into a lane in the sample bay, an integrated barcode reader reads sample ID barcodes as the rack is inserted.
[0154] During an assay run, the instrument utilizes three dedicated disposables for each sample (two disposable tips, one reaction cuvette) and one array on the 24-array disposable Simoa disc. Pipette tips are acquired and disposed of by the sample pipettor, and reaction cuvettes are retrieved for each sample from the cuvette stacks in the cuvette bay. When tests are completed, reaction cuvettes are automatically removed to the solid-waste container in the system bay. When processing is complete for each sample, results are calculated from image files by software algorithms that include quality control (QC) checks for data quality. Values are flagged if they are not within certain preset parameters (e.g., out of calibration range). The assay sequence is aborted if certain control variables are out of range. Immunoassays and data reduction are performed by the system with a steady state throughput of 66 tests/h. Maximum walkaway time is 4.5 hours before resources need to be replenished or liquid waste needs to be emptied.
[0155] To run the Simoa COVID-19 IgG Antibody assay, users transfer thawed, ready-to-use calibrators and samples to the system by either an ELISA plate or by adding sample tubes to a tube rack. Before a run can be initiated, users must also load required assay reagents, system buffers/consumables and set up the run load list in the instrument software. Upon starting the run, the user can walk away until the assay results are ready in about 90 minutes.
[0156] D.3.2. Instrument Consumables
[0157] The three plastic consumables used by the HD-X system are (see Table 5 below):
TABLE-US-00007 Consumable Description Manufacturer Simoa Disc Single molecule array disc Stratec Biomedical/ enabling single molecule counting Sony DADC (proprietary technology) Reaction Cuvettes in which immunoassay Stratec Biomedical vessels chemistry steps are performed Pipette Low-retention pipettor tips to Axygen, Corning tips eliminate cross-contamination Life Sciences between samples during processing.
[0158] Simoa Disc.
[0159] The Simoa disc has been described in detail elsewhere (3). In brief, it is a DVD-sized disc composed of 24 arrays of femtoliter-sized microwells, arranged radially to enable fabrication using Blu-ray manufacturing processes. Singulation of microbeads is a critical requirement of Simoa technology, and the geometry of the microwells is sufficient to accommodate only single microbeads.
[0160] Cuvettes.
[0161] The system uses a V-shaped, four-sided plastic reaction cuvette for assay processing steps from initial analyte capture to final concentration of microbeads for transfer to the Simoa disc. The V shape facilitates maximum precision of low-volume fluid handling and pellet resuspension by the system pipettor by minimizing cuvette dead volume.
[0162] Pipettor Tips.
[0163] Manufactured using a polished mold to minimize liquid retention in the tip and ensure accurate sample volumes. During sample processing, one tip is used for sample transfer, and a second tip is used for bead resuspension and transfer from the cuvette to the Simoa disc. The manufacturers of these instrument consumables are ISO 13485 certified. These consumables are obtained directly from Quanterix.
[0164] D.3.3. Instrument Software
[0165] The common and technology-specific subsystems of the instrument are controlled by a real-time software scheduling processor. The software controlling the system includes inventory tracking of system consumables, user-editable assay parameters and dilutions, automatic data reduction, customizable report formats, and network connectivity. Data reduction capabilities include calibration curve fitting with level-by-level weighting, calibration curve refitting, curve fitting residuals for feedback on fitting accuracy, and conversion of raw signal to concentrations. While the instrument is currently for RUO, it was designed to be easily convertible to a more controlled IVD instrument.
[0166] The level of safety concern for the Simoa COVID-19 IgG antibody test and the HD-X system is Moderate. The assay results will be provided to healthcare professionals to use in conjunction with other established laboratory results and clinical information. A falsely elevated or depressed Simoa COVID-19 IgG antibody result has a low potential to influence interpretation of immune status and back-to-work dispositioning regarding infection risk. (Note: Labeling will caution against the use of a single Simoa COVID-19 IgG antibody result for infection diagnosis or risk dispositioning independent of other laboratory/clinical disease activity monitoring modalities.)
[0167] D.4. Assay Performance Studies
[0168] D.4.1. Performance Data
[0169] A representative calibration curve for IgG quantification is depicted in
[0170] During the initial phase of assay development, 10 serum samples collected pre-pandemic (presumed to have no antibodies against SARS-CoV-2) and 25 serum samples from people with COVID-19 infection as confirmed by RNA RT-PCR were tested in the quantitative SARS-CoV-2 IgG antibody assay (
[0171] D.4.2. Studies Planned or in Progress
[0172] Studies planned or in progress include (see Table 6 below):
TABLE-US-00008 Parameter Validation Plan Precision Inter- and intra-assay precision for the positive control (PC) and the negative control (NC) samples will be calculated as the coefficient of variation (CV) for the back-calculated from the calibration curve concentration values. Cross- Serum samples from >100 people collected before pandemic (before December reactivity/ 2019) that are expected to be seronegative for SARS-CoV-2 and to have analytical exposure to other coronaviruses and a high prevalence of vaccination specificity against influenza, HBV, and other diseases) or viral exposure will be tested in the assay. If less than 98% specificity is observed, samples from people with known exposure to coronaviruses, influenza and other infectious agents listed below will be tested. Anti-alpha coronavirus (229E, NL63), anti-beta coronaviruses (OC43, HKU1), anti-influenzae, anti-HCV, anti-HBV, ANA, annti-respiratory syncytial virus, anti-rhinovirus (IgG and IgM). IgG class To demonstrate the IgG class specificity of the test, unlabeled anti- Specificity human IgG will be used to demonstrate competition with the labeled anti-human-IgG and subsequent decrease in the IgG signal. Matrix To evaluate the equivalence for serum and plasma samples, 5 sets of equivalency matched serum and plasma samples negative for SARS-CoV-2 IgG will be spiked with the same amount of samples known to have high concentration of SARS-CoV-2 IgG. Samples will be spiked at three levels: below clinical threshold, at low IgG levels (low positive) and high IgG levels (high positive) and evaluated in the assay. Matrices will be deemed comparable if the concentration results will be within 25% of each other Clinical >100 serum and plasma samples collected before SARS-CoV-2 pandemic Validity (before December 2019) that are expected to be seronegative for SARS-CoV-2 will be used as negative controls. >60 serum and plasma samples from people confirmed to be infected by SARS-CoV-2 using RT-PCR will be used as positive controls. Positive and negative percent agreement between the SARS-CoV-2 IgG serology test result and comparator RT-PCR method will be calculated.
REFERENCES CITED
[0173] 1. Rissin D M, Kan C W, Campbell T G, Howes S C, Fournier, D R, Song L, et al. D. C. Single-molecule enzyme-linked immunosorbent assay detects serum proteins at subfemtomolar concentrations. Nature Biotechnol 2010; 28:595-9. [0174] 2. Wilson D H, Rissin D M, Kan C W, Fournier D R, Piech T, Campbell T G, et al. The Simoa HD-1 Analyzer: a novel fully automated digital immunoassay analyzer with single molecule sensitivity and multiplexing. J Lab Autom. 2016 August; 21(4):533-47. [0175] 3. Kan C W, Rivnak A J, Campbell T G, Piech T, Rissin D M, Mosl M, et al. Isolation and detection of single molecules on paramagnetic beads using sequential fluid flows in microfabricated polymer array assemblies. Lab Chip 2012; 12:977-85.
E. Exemplary Embodiment
[0176] Simoa Quantitative SAR-CoV-2 IgG Antibody Test
[0177] Intended Use
[0178] The Simoa™ Quantitative SARS-CoV-2 IgG Antibody Test is an automated paramagnetic microbead-based immunoassay intended for the quantitative detection of human IgG antibodies to SARS-CoV-2 in serum or EDTA plasma using the HD-X immunoassay system. The test detects and quantitates IgG antibodies as indicative of an immune response to SARS-CoV-2 in patients suspected of previous SARS-CoV-2 infection, or for the detection of IgG seroconversion in patients following known recent SARS-CoV-2 exposure. The test is an aid in the diagnosis of patients suspected of prior SARS-CoV-2 in conjunction with clinical presentation and the results of other laboratory tests. Results from Simoa™ Quantitative SARS-CoV-2 IgG Antibody Test should not be used as the sole basis for diagnosis and should not be used for the diagnosis of patients with acute SARS-CoV-2 infection.
[0179] Testing is limited to laboratories certified under the Clinical Laboratory Improvement Amendments of 1988 (CLIA), 42 U.S.C. § 263a, to perform moderate and high complexity tests.
[0180] Results are for the detection and quantitation of IgG antibodies against SARS-CoV-2. Reactive results could occur after infection and can be indicative of acute, or recent or past infection. Laboratories within the United States and its territories are required to report all reactive results to the appropriate public health authorities.
[0181] Non-reactive results do not preclude SARS-CoV-2 infection and should not be used as the sole basis for patient management decisions. Results must be combined with clinical observations, patient history, and epidemiological information. The sensitivity of the Simoa™ Quantitative SARS-CoV-2 IgG Antibody Test early after infection is unknown. False reactive results may occur due to cross-reactivity from pre-existing antibodies or other possible causes. At this time, it is unknown for how long antibodies to SARS-CoV-2 virus may persist following infection.
[0182] The Simoa™ Quantitative SARS-CoV-2 IgG Antibody Test is only for use under the Food and Drug Administration's Emergency Use Authorization.
[0183] Summary and Explanation of Test
[0184] Severe Acute Respiratory Syndrome Coronavirus 2 (SARS-CoV-2) is a recently identified coronavirus strain responsible for the Coronavirus Disease 2019 (COVID-19) and pandemic. SARS-CoV-2 emerged in China in December 2019 and is transmitted mainly through droplets and surface contact routes. The virus infects human cells through interaction between angiotensin converting enzyme 2 (ACE2) on respiratory cells and spike or S-protein on the outer envelope of the virion particle. COVID-19 affects people in different ways. Symptoms can include signs and symptoms of acute respiratory illness, such as fever, cough, shortness of breath, but the infection can also be asymptomatic. Symptomatic, pre-symptomatic and asymptomatic infected individuals all can be sources for viral transmission. The current gold standard for diagnosis of SARS-CoV-2 infection is real-time reverse transcription polymerase chain reaction (rRT-PCR), which detects the presence of SARS-CoV-2 nucleic acid material in upper respiratory specimens, such as nasopharyngeal swab and oropharyngeal swab. In contrast, anti-SARS-CoV-2 antibody detection detects exposure to the virus after the host immune response and seroconversion. Classes of antibodies detected by antibody tests are generally IgM and IgG. SARS-CoV-2 immunity status assessment is expected to play an important role in understanding the pandemic and potential infection risk at an individual and population level..sup.1
[0185] Principles of the Procedure
[0186] The Simoa Quantitative SARS-CoV-2 IgG Antibody Test is a 3-step paramagnetic microbead-based sandwich ELISA that uses single molecule array (Simoa) technology..sup.2 In the first step, sample is drawn from a sample tube by the instrument pipettor and mixed with COVID-19 spike protein coated paramagnetic capture beads in a reaction cuvette. IgG antibodies in the sample that are specific to COVID-19 spike protein are bound by the capture beads. After an incubation, capture beads are collected with a magnet, and washed. Biotinylated anti-human IgG detector antibodies are then mixed with the capture beads, and the detector antibodies bind to the captured sample IgG. Following a second wash, a conjugate of streptavidin-β-galactosidase (SBG) is mixed with the capture beads. SBG binds to the biotinylated detector antibodies, resulting in enzyme labeling of captured sample IgG. After a third wash, the capture beads are resuspended in a resorufin β-D-galactopyranoside (RGP) substrate solution. Digital processing occurs when beads are transferred to the Simoa array disc which is composed of microarrays of femtoliter reaction wells. Individual capture beads are then sealed within microwells in the array through the addition of oil, which forms a liquid seal trapping the labeled immunocomplexes and RGP within the wells. If anti-spike IgG from the sample has been captured and labeled, the β-galactosidase hydrolyzes the RGP substrate into a fluorescent product that provides the signal for measurement. The concentration of IgG in unknown samples is interpolated from a calibration curve obtained by 4-parameter logistical regression fitting. Total time to first result is 80 minutes.
[0187] For additional information on system and assay technology, refer to the Simoa HD-X Analyzer User Guide.
[0188] Reagents
[0189] Reagent Kit
[0190] Simoa Quantitative SARS-CoV-2 IgG Antibody Test kit (see Table 7 below):
Simoa Quantitative SARS-CoV-2 IgG Antibody Test kit
[0191]
TABLE-US-00009 Bead 1 bottle SARS-CoV-2 spike protein (recombinant) Reagent (4.4 mL) coated capture beads in Tris buffer with a protein stabilizer (bovine) and a surfactant. Preservative: ProClin 300. Detector 1 bottle Biotinylated anti-human IgG antibody Reagent (12.3 mL) (goat polyclonal) in phosphate buffer with a protein stabilizer (bovine) and a surfactant. Preservative: ProClin 300. SBG 1 bottle Conjugate of streptavidin-β-galactosidase Reagent (12.3 mL) (SBG) in phosphate buffer with a protein stabilizer (bovine). Preservative: ProClin 300. Sample 4 bottles Phosphate buffer with a protein stabilizer Diluent (30 mL ea) (bovine), a heterophilic blocker, and a surfactant. Preservative: Sodium azide. RGP 2 bottles Resorufin β-D-galactopyranoside (RGP) Reagent (3.4 mL) in phosphate buffer with a surfactant. Calibrators 8 vials Anti-SARS-CoV/CoV-2 IgG in phosphate A-H (0 (1 mL buffer with a protein stabilizer (bovine), plus 7 each) a surfactant, and sodium azide as a levels) preservative. Negative 1 vial Pooled normal human serum with ProClin control (0.125 mL 300 as a preservative. each) Positive 1 vial IgG antigen in pooled normal human control (0125 mL serum with ProClin 300 as a preservative. each)
[0192] Materials Required but not Provided
[0193] Materials Required but Not Provided include: [0194] Simoa HD-X Analyzer [0195] Simoa HD-X System Wash Buffer 1 [0196] Simoa HD-X System Wash Buffer 2 [0197] Simoa HD-X Sealing Oil [0198] Simoa cuvettes [0199] Simoa disposable pipettor tips; and [0200] Simoa Discs.
[0201] Warnings and Precautions
[0202] For in vitro diagnostic and laboratory professional use. For emergency authorization use only
[0203] Safety Precautions
[0204] Caution:
[0205] This product requires the handling of human specimens. It is recommended that all human-sourced materials be considered potentially infectious and be handled in accordance with the OSHA Standard on Bloodborne Pathogens..sup.3 Biosafety Level 2.sup.4 or other appropriate biosafety practices.sup.15 should be used for materials that contain or are suspected of containing infectious agents.
[0206] Simoa reagents contain methylisothiazolones, which are components of ProClin and are classified per applicable European Community (EC) Directives as: Irritant (Xi). The following are the appropriate Risk (R) and Safety (S) phrases. [0207] Simoa reagents contain methylisothiazolones, which are components of ProClin and are classified per applicable European Community (EC) Directives as: Irritant (Xi). The following are the appropriate Risk (R) and Safety (S) phrases. [0208] [0209] R43 May cause sensitization by skin contact. [0210] S24 Avoid contact with skin. [0211] S35 This material and its container must be disposed of in a safe way. [0212] S37 Wear suitable gloves. [0213] S46 If swallowed, seek medical advice immediately and show this container or label. [0214] For a detailed discussion of safety precautions during instrument operation, refer to the Simoa HD-X Analyzer User Guide. [0215] Package insert instructions must be carefully followed. Reliability of assay results cannot be assured if there are deviations from the instructions in this package insert.
[0216] Handling Precautions
[0217] Handling Precautions: [0218] Do not use reagent kits beyond the expiration date. When stored and handled as directed, reagents and calibrator are stable until the expiration date [0219] Do not pool reagents within a kit or between reagent kits. [0220] Remaining Simoa reagents should be removed from the instrument upon completion of the assay run and stored at 2-8° C. upright with caps on. [0221] Calibrators and controls are 1-time use; any remaining material should be discarded appropriately. [0222] Do not attempt to reuse tips, cuvettes, or Simoa Discs, as this will cause significant data quality deterioration.
[0223] Storage Instructions
[0224] Storage Instructions: [0225] Simoa Quantitative SARS-CoV-2 IgG Antibody Test reagents must be stored at 2-8° C. in an upright position; see,
[0229] Indications of Reagent Deterioration
[0230] If a control sample returns a concentration value out of the expected range, this may indicate deterioration of reagents or errors in technique. Associated test results may be invalid and may require retesting. Assay recalibration may be necessary. Refer to the calibrators and controls section of this document.
[0231] Specimen Collection and Preparation for Analysis
[0232] Specimen Collection and Preparation for Analysis: [0233] Insufficient sample processing may cause inaccurate results. [0234] For optimal results, specimens should be free of fibrin, red blood cells, or other particulate matter. Do not use grossly hemolyzed specimens. [0235] Specimens thawed after frozen storage must always be mixed THOROUGHLY by low-speed vortexing or inverting 10 times. Visually inspect the specimens. If layering or stratification is observed, continue mixing until specimens are visibly homogeneous. [0236] Specimens may be stored for up to 24 hours at 2-8° C. prior to being tested. If testing will be delayed for more than 24 hours, specimens should be frozen at −20° C. or colder. [0237] The Simoa HD-X Analyzer does not provide the capability to verify specimen type. It is the responsibility of the operator to verify that the correct specimen type is used in the Simoa Quantitative SARS CoV-2 IgG Antibody test. [0238] For freshly drawn serum specimens, ensure that complete clot formation has taken place prior to centrifugation. If specimens are centrifuged before a complete clot forms, the presence of fibrin or particulate matter may cause erroneous results. [0239] Centrifuge all specimens prior to assay. Centrifugation conditions should be sufficient to efficiently remove particulate matter and to clarify the sample, for example 5 minutes at 10,000 g for serum or plasma. Note that interfering levels of fibrin may be present in samples that do not have obvious or visible particulate matter. [0240] Centrifuged specimens with a lipid layer on the top should be transferred to a secondary tube. Care must be taken to transfer only the clarified specimen without the lipemic material. [0241] Serum and plasma should be immediately removed from the red cells (after centrifugation) and put in a separate tube that can then be aliquoted and frozen for future use. For freshly drawn serum specimens, ensure that complete clot formation has taken place prior to centrifugation. [0242] For optimal results, inspect all samples for bubbles. Remove bubbles with an applicator stick prior to analysis. Use a new applicator stick for each sample to prevent cross-contamination. [0243] Use caution when handling patient specimens to prevent cross-contamination. Use of disposable pipettes or pipette tips is recommended. [0244] Multiple freeze-thaw cycles of specimens should be avoided. [0245] Specimens with obvious microbial contamination should not be used. [0246] Specimen stability in different storage conditions has not been validated for this assay.
[0247] Procedure
[0248] Assay Procedure
[0249] The Simoa Quantitative SARS-CoV-2 IgG Antibody Test assay definition must be downloaded from the customer portal and installed on the Simoa HD-X Analyzer prior to performing the assay. Note: Assay definitions for the Simoa HD-1 and HD-X are different and not interchangeable.
[0250] Calibrators, controls, and samples must be allowed to come to room temperature and mixed thoroughly before loading onto the Simoa HD-X Analyzer.
[0251] Simoa reagents must be allowed to come to room temperature before loading onto the Simoa HD-X Analyzer. This is not necessary if using the HD-X DX model, which is equipped with a cooling reagent bay.
[0252] To improve run-to-run reproducibility, solubilize RGP fully by heating at 30-37° C. with constant vigorous shaking for a minimum of 30 minutes. Refer to TECH-0051: RGP Substrate Preparation for Simoa Assays for more details.
[0253] Before loading on the Simoa HD-X Analyzer, the Bead Reagent bottle must be mixed to resuspend the capture beads that may have settled. To resuspend the beads, vortex for a minimum of 30 seconds.
[0254] Note: The bead diluent is formulated with an antifoam agent, but vortexing can still create foaming. If the foam does not dissipate within a few minutes, remove excess foam with a pipette prior to loading bead reagent onto the Simoa HD-X Analyzer.
[0255] Set up the assay run on the instrument (see the Simoa HD-X Analyzer User Guide). Load the Simoa Quantitative SARS-CoV-2 IgG Antibody Test reagents (Bead Reagent, Detector Reagent, SBG Reagent, Sample Diluent) into the reagent bay.
[0256] Load samples, calibrators, controls, and RGP into the sample bay. (Note: Only one bottle of RGP is needed per 96-sample run. One bottle of RGP may be used for multiple smaller runs, but total time on board the instrument should be limited to no more than 8 hours and one work shift.)
[0257] In the run set up screen, specify ‘neat’ protocol. The samples will be diluted off-line prior to running the assay, and the instrument will not perform additional pre-dilutions. Follow the guidelines in the Specimen Dilution Procedure section of this package insert to set up sample dilutions.
[0258] Replenish consumables and system resources as needed prior to initiating the run, as described in the Simoa HD-X Analyzer User Guide.
[0259] Initiate the run.
[0260] Specimen Dilution Procedure
[0261] The minimum sample volume needed depends on the number of replicates desired, and whether samples will be introduced to the instrument in tubes or Quanterix-supplied 96-well plates. If a sample tube is used, the type and volume of the tube may determine the dead volume. Samples introduced in 5-mL Nalgene Cryogenic sample tubes have a dead volume of 50 μL. Samples introduced in a Quanterix-supplied 96-well plate have a dead volume of 30 μL. Note: The maximum recommended sample volume for the Quanterix-supplied 96-well plates is 400 μL.
[0262] Treat specimens and assay Controls the same way.
[0263] Perform a 1:1000 pre-dilution of specimens and controls with Sample Diluent. Given the large dilution, it is recommended to perform the dilution in two steps to maximize pipetting accuracy.
[0264] Note: If an alternative procedure is followed, volume transfers should be no less than 10 μL to achieve the best accuracy.
[0265] Note: If samples are left on board the instrument or pipetted samples are left on a lab bench for more than an hour, evaporation effects may influence the results depending on the volume of sample. As a general guideline, at room temperature and normal humidity, a 60 μL sample will lose approximately 5% of its weight per hour. A 120 μL sample may lose 5% of its weight in approximately 3 hours.
[0266] To minimize evaporation when using microtiter plates for sample input, Quanterix recommends use of X-Pierce™ Sealing Films (cat #XP-100). No other plate seal is compatible with the Simoa HD-1/HD-X Analyzer. The maximum
[0267] Calibration
[0268] To perform a Quantitative SARS-CoV-2 IgG Antibody Test calibration, test Calibrators A through H in duplicate or triplicate. A single sample of all levels of Quantitative SARS-CoV-2 IgG Controls must be tested to evaluate the assay calibration. Ensure that all that assay control values are within expected concentration ranges.
[0269] Once a Quantitative SARS-CoV-2 IgG Antibody Test calibration is accepted and stored, all subsequent samples may be tested without further calibration unless Controls are out of range or a reagent kit with a new lot number is used.
[0270] Preparing Calibrators
[0271] Calibrators should be brought to room temperature prior to pipetting. Do not heat the vial to accelerate thawing.
[0272] When the solution is fully thawed, THOROUGHLY mix by multiple gentle inversions or vortexing. Frozen protein solutions can partition during freezing, so complete mixing of thawed material is critical for accurate calibrators.
[0273] Preparing Controls
[0274] Controls should be brought to room temperature prior to pipetting. Do not heat the vial to accelerate thawing.
[0275] When the solution is fully thawed, THOROUGHLY mix by multiple gentle inversions or vortexing. Frozen protein solutions can partition during freezing, so complete mixing of thawed material is critical for accurate controls.
[0276] Controls should be included in each run and should follow the same dilution scheme selected for samples.
[0277] Quality Control Procedures
[0278] It is recommended that the Quantitative SARS-CoV-2 IgG Antibody Test Negative Control and Positive Control be included in every batch run to assess calibration curve storage integrity and run validity. If the results from one or more of the controls are outside an expected range, the stored calibration curve may no longer be valid, and the assay may need to be re-calibrated. The length of time calibration curves may be stored must be validated for each laboratory. Alternatively, calibration can be performed with every batch run. It is recommended that Controls be run with every calibration to assess calibration accuracy and run validity. Follow the specific quality control procedures in your laboratory.
[0279] Results
[0280] The Quantitative SARS-CoV-2 IgG Antibody Test utilizes a 4 Parameter Logistic Curve fit data reduction method to generate a calibration curve. Specimen results are interpolated from the calibration curve.
[0281] Interpretation of Results
[0282] Specimens with concentration values <0.77 μg/mL are considered nonreactive for IgG by the criteria of Quantitative SARS-CoV-2 IgG Antibody Test.
[0283] Specimens with concentration values ≥0.77 μg/mL are considered reactive for IgG by the criteria of Quantitative SARS-CoV-2 IgG Antibody Test.
[0284] A negative result may indicate that IgG antibodies are present in concentrations below the detection limit of the assay. This can occur during acute infection prior to seroconversion. A positive result indicates the presence of IgG antibodies to SARS-CoV-2 due to exposure to SARS-CoV-2.
[0285] Note: Some results may contain information in the Flags field. For a description of the flags that may appear in this field, refer to the Simoa HD-X Analyzer User Guide.
[0286] Limitations of the Procedure
[0287] For in vitro diagnostic use under Emergency Use Authorization Only.
[0288] Bacterial contamination of specimens may affect the test results.
[0289] Therapeutic doses of biotin can interfere with assays that utilize biotinylated reagents.
[0290] Heterophilic antibodies in human serum can react with reagent immunoglobulins, interfering with immunoassays. People routinely exposed to animals or animal serum products can be prone to this interference, and anomalous values may be observed.
[0291] Specimens may contain human anti-mouse antibodies (HAMA). Such specimens may show either falsely elevated or falsely depressed values when tested with assay kits that employ mouse monoclonal antibodies. Simoa reagents contain a component that reduces the effect of HAMA-reactive specimens.
[0292] Conditions of Authorization for the Laboratory
[0293] The Simoa Quantitative SARS-CoV-2 IgG Antibody Test Letter of Authorization, along with the authorized Fact Sheet for Healthcare Providers, the authorized Fact Sheet for Patients, and authorized labeling are available on the FDA website: https://wwwfda.gov/medical-devices/emergency-situations-medical-devices/emergency-use-authorizations#covid19ivd.
[0294] Specimens with concentration Authorized laboratories using the Simoa Quantitative SARS-CoV-2 IgG Antibody Test (“your product” in the conditions below), must adhere to the Conditions of Authorization indicated in the Letter of Authorization as listed below: [0295] Authorized laboratories using your product will include with result reports of your product, all authorized Fact Sheets. Under exigent circumstances, other appropriate methods for disseminating these Fact Sheets may be used, which may include mass media. [0296] Authorized laboratories using your product will use your product as outlined in the Instructions for Use. Deviations from the authorized procedures, including the authorized instruments, authorized clinical specimen types, authorized control materials, authorized other ancillary reagents and authorized materials required to use your product are not permitted. [0297] Authorized laboratories that receive your product will notify the relevant public health authorities of their intent to run your product prior to initiating testing. [0298] Authorized laboratories using your product will have a process in place for reporting test results to healthcare providers and relevant public health authorities, as appropriate. [0299] Authorized laboratories will collect information on the performance of your product and report to DMD/OHT7-OIR/OPEQ/CDRH (via email: CDRH-EUA-Reporting@fda.hhs.gov) and Quanterix Corporation at www.Quanterix.com any suspected occurrence of false reactive or false non-reactive results and significant deviations from the established performance characteristics of your product of which they become aware. [0300] All laboratory personnel using your product must be appropriately trained in automated immunoassay techniques and use appropriate laboratory and personal protective equipment when handling this kit and use your product in accordance with the authorized labeling. All laboratory personnel using the assay must also be trained in and be familiar with the interpretation of results of the product. [0301] Quanterix Corporation., authorized distributors, and authorized laboratories using your product will ensure that any records associated with this EUA are maintained until otherwise notified by FDA. Such records will be made available to FDA for inspection upon request. [0302] The letter of authorization refers to, “Laboratories certified under the Clinical Laboratory Improvement Amendments of 1988 (CLIA), 42 U.S.C. § 263a, to perform moderate and high complexity tests” as “authorized laboratories.”
[0303] Performance Characteristics
[0304] Precision
[0305] Five precision panel members were prepared by serial dilution of 10 pooled SARS-CoV-2 positive (PCR+) patient sera. Controls were diluted in Sample Diluent, and 6 runs performed in triplicate across 4 HD-X instruments. Inter and intra-run precision is depicted in Tables 8 and 9 respectively:
TABLE-US-00010 TABLE 8 Positive Pool Run 1 Run 2 Run 3 Run 4 Run 5 Run 6 Avg Inter-run Dilution (μg/mL) (μg/mL) (μg/mL) (μg/mL) (μg/mL) (μg/mL) (μg/mL) CV 1 5.52 5.81 5.89 4.99 5.38 5.42 5.50 5.9% 2 2.27 2.77 2.77 2.48 2.67 2.78 2.62 8.0% 3 1.12 1.23 1.23 1.23 1.32 1.33 1.24 6.2% 4 0.25 0.25 0.23 0.26 0.29 0.32 0.27 12.1% 5 0.03 0.02 0.02 0.03 0.03 0.03 0.03 20.0%
TABLE-US-00011 TABLE 9 Positive Pool Run 1 Run 2 Run 3 Run 4 Run 5 Run 6 Intra-run Dilution (CV) (CV) (CV) (CV) (CV) (CV) Avg CV 1 5.3% 3.9% 2.5% 4.9% 4.0% 6.3% 4.5% 2 0.2% 5.2% 1.0% 8.2% 4.3% 2.0% 3.5% 3 6.3% 10.3% 3.0% 4.6% 3.5% 7.2% 5.8% E 4 7.9% 13.4% 20.1% 14.7% 20.2% 18.5% 15.8% 5 44.3% 25.6% 22.1% 26.6% 8.5% 20.1% 24.5%
[0306] Clinical Sensitivity
[0307] One hundred twenty seven (127) serum and plasma samples from 31 people with COVID-19 infection as confirmed by RNA RT-PCR were tested in the assay. Samples from people positive for SARS-CoV-2 were broken into several categories based on the duration from the positive PCR test to sample collection. Cut-off for seropositivity was established based on the ROC analysis of the data with optimization for high specificity. The positive and negative percent agreement between the results obtained with the developed test and the RT-PCR results was calculated. Table 10 summarizes the data for all PCR positive samples.
TABLE-US-00012 TABLE 10 First Serial Second Serial Third Serial Measurement Measurement Measurement Days from Samples Samples Samples Total positive Samples with pos Samples with pos Samples with pos PPA/Sensitivity PCR test tested results tested results tested results (95% CI) 0-7 30 13 22 15 16 13 60.3% (48.42-71.07) 8-14 17 15 12 10 11 10 87.5% (73.89-94.54) ≥15 10 10 5 5 4 4 100% (83.18-100.0) Note: A positive PCR result confirms the presence of virus, but seroconversion to IgG reactivity follows a latency period of undetermined length. Therefore, samples collected early in the infection are expected to be non-reactive for anti-SARS-CoV-2 IgG.
[0308] Clinical Specificity
[0309] To support cross reactivity verification testing, 496 pre-pandemic serum and plasma samples (collected before December 2019) from apparently healthy individuals residing in the United States were tested. The tested population is expected to have high prevalence of vaccination against influenza, HBV, and Haemophilus influenzae. Cut-off for seropositivity was established to maximize specificity to >99%. A cut-off of 0.77 μg/mL resulted in 99.2% specificity (95% CI 97.95-99.69).
BIBLIOGRAPHY
Bibliography
[0310] 1 “Immunity passports” in the context of COVID-19 https://www.who.int/news-room/commentaries/detail/immunity-passports-in-the-context-of-covid-19 [0311] 2 Rissin D M, Kan C W, Campbell T G, et al. Single-molecule enzyme-linked immunosorbent assay detects serum proteins at subfemtomolar concentrations. Nat Biotech 2010; 28:595-99. [0312] 3 US Department of Health and Human Services. Biosafety in micro-biological and biomedical laboratories, 4th ed. Washington, D.C.: US Government Printing Office, May 1999. [0313] 4 World Health Organization. Laboratory biosafety manual. Geneva: World Health Organization, 2004. [0314] 5 Clinical and Laboratory Standards Institute. Protection of laboratory workers from occupationally acquired infections: Approved guideline, 3rd ed. CLSI Document M29-A3. Wayne, Pa.: Clinical and Laboratory Standards Institute, 2005.