SPLIT INTEIN MEDIATED PROTEIN POLYMERIZATION FOR MICROBIAL PRODUCTION OF MATERIALS
20230287065 · 2023-09-14
Inventors
Cpc classification
B29K2089/00
PERFORMING OPERATIONS; TRANSPORTING
C12N15/70
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure is directed to systems and methods for synthesizing a spidroin. In some embodiments, the methods comprise synthesizing a monomer in vivo in a heterologous host, the monomer comprising an N-terminus IntC domain and a C-terminus IntN domain, and post-translationally polymerizing the synthesized monomer via in vitro split-intein mediated polymerization.
Claims
1. A system for synthesizing a spidroin in vivo, the system comprising: a host cell; a seed cassette encoding a seed protein comprising a C-terminus Int.sup.N domain; and a monomer cassette encoding a monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain.
2. The system of claim 1, wherein the heterologous host is a protein-expressing microbial host.
3. The system of claim 1, wherein the heterologous host is E. coli.
4. The system of claim 1, wherein the monomer is a silk amino acid sequence from a spider species.
5. The system of claim 1, wherein the monomer is a spidroin fragment.
6. The system of claim 1, wherein the monomer cassette encodes a monomer comprising an N-terminus Int.sup.C domain comprising an amino acid sequence of SEQ ID NO: 10 and a C-terminus Int.sup.N domain comprising an amino acid sequence of SEQ ID NO: 11.
7. The system of claim 1, wherein the synthesized spidroin is a linear polymer.
8. The system of claim 1, wherein the synthesized spidroin has a molecular weight of at least 300 kDa.
9. The system of claim 1, wherein the synthesized spidroin may be spun into fibers.
10. The system of claim 9, wherein the fibers have a tensile strength of from about 150 MPa to about 350 MPa.
11. The system of claim 9, wherein the fibers have a tensile strength of from about 170 MPa to about 310 MPa.
12. The system of claim 9, wherein the fibers have an extensibility of from about 5% to about 35%.
13. The system of claim 9, wherein the fibers have an extensibility of from about 10% to about 25%.
14. The system of claim 9, wherein the fibers have a toughness of from about 25 MJ/m.sup.3 to about 150 MJ/m.sup.3.
15. The system of claim 9, wherein the fibers have a toughness of from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3.
16. The system of claim 9, wherein the fibers have a β-sheet content of from about 20% to about 60%.
17. The system of claim 9, wherein the fibers have a β-sheet content of from about 35% to about 45%.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011] The embodiments described herein may be better understood by referring to the following description in conjunction with the accompanying drawings.
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION OF THE DISCLOSURE
Microbially Produced Spidroins Replicate Mechanical Properties of Natural Spider Silk
[0041] Dragline spider silk is among the strongest and toughest bio-based materials, capable of outperforming most synthetic polymers and even some metal alloys. These remarkable properties have resulted in a growing list of potential applications for spider silks that, when coupled with the impracticalities of spider farming, have driven a decades-long effort to produce recombinant spider silk proteins (spidroins) in engineered heterologous hosts. However, these efforts have so far been unable to yield synthetic silk fibers with all the desired mechanical properties of natural spider silk, largely due to an inability to stably produce highly repetitive, high molecular weight (MW) spidroins in heterologous hosts. These challenges are addressed herein with a synthetic biology approach combining standardized DNA part assembly and split intein (SI)-mediated ligation to bioproduce spidroins with unprecedented MW (556 kDa), containing 192 repeat motifs of the Nephila clavipes MaSp1 dragline spidroin. Fibers spun from the synthetic spidroins described herein display ultimate tensile strength (σ), modulus (E), extensibility (ε), and toughness (UT) of 1.03±0.11 GPa, 13.7±3.0 GPa, 18±6%, and 114±51 MJ/m.sup.3, respectively. This demonstrates for the first time that microbially produced silk fibers can match the performance of natural N. clavipes dragline silk by all common metrics (σ, E, ε, UT), providing a more dependable source of high performance fibers to replace natural spider silks for a variety of mechanically-demanding applications. Furthermore, the developed platform may be expanded for the assembly and production of other protein-based materials with high MW and repetitive sequences that have so far been challenging to synthesize by genetic means alone.
[0042] In some embodiments of the present disclosure, a method for synthesizing a spidroin. The method comprises synthesizing a monomer in vivo in a heterologous host, the monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain, and post-translationally polymerizing the synthesized monomer via in vitro split-intein mediated polymerization.
[0043] In some embodiments the heterologous host is a protein-expressing microbial host and/or the monomer is a silk amino acid sequence from a spider species. In some embodiments, the heterologous host is E. coli, and/or the monomer is an N. clavipes spidroin. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa, at least about 400 kDA, at least about 500 kDa, or at least about 600 kDa. In some embodiments the methods further comprise spinning the synthesized spidroin into fibers. In some embodiments, the fibers have a tensile strength of from about 0.5 GPa to about 2.0 GPa, or from about 0.9 GPa to about 1.3 GPa, the fibers have a modulus of about 10 GPa to about 17 GPa, the fibers have an extensibility of from about 5% to about 35%, or from about 10% to about 25% the fibers have a toughness of from about 30 MJ/m.sup.3 to about 200 MJ/m.sup.3, or from about 60 MJ/m.sup.3 to about 170 MJ/m.sup.3, and/or the fibers have a β-sheet content of from about 20% to about 60%, or from about 35% to about 45%.
[0044] In some embodiments, a method for synthesizing a spidroin comprises: synthesizing silk fragments (called monomers) in heterologous hosts, the monomers comprising either an N-terminus Int.sup.C domain or a C-terminus Int.sup.N domain; and undergoing in vitro split-intein mediated protein ligation reactions, forming a high molecular weight protein containing multiple monomer sequences. In some embodiments, the heterologous host is E. coli, or other protein expressing microbial hosts. In some embodiments, the monomers contain a fragment of silk amino acid sequence from N. clavipes spidroin or other spider species. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa. In some embodiments, the method further comprises spinning the synthesized spidroin into fibers. In some embodiments, the fibers have a tensile strength of from about 0.9 GPa to about 1.3 GPa, or at least about 1.0 GPa. In some embodiments, the fibers have an extensibility of from about 10% to about 25%, or at least about 20%. In some embodiments, the fibers have a toughness of from about 60 MJ/m.sup.3 to about 170 MJ/m.sup.3, or at least about 150 MJ/m.sup.3. In some embodiments, the fibers have a β-sheet content of from about 35% to about 45% or at least about 40%.
[0045] Spidroins (e.g., dragline spidroins) are typically very large (>300 kDa), highly repetitive proteins, containing hundreds of tandem repeats of glycine- and alanine-rich sequences. As with most polymers, the size of these spidroins is expected to positively correlate with tensile strength due to an increased density of interchain interactions and entanglements and fewer chain-end defects. Indeed, there is a clear correlation between MW and strength for recombinant N. clavipes dragline fibers, with the largest spidroin (96-mer, 285 kDa) yielding the strongest recombinant fiber reported to date (σ≈550 MPa). However, despite the apparent need for even larger spidroins to yield fibers with mechanical properties on par with natural silk systems (σ=0.8-1.2 GPa for N. clavipes dragline, see Table 1), spidroins larger than 285 kDa have yet to be produced in quantities sufficient for fiber testing due to major challenges in recombinant production of high MW spidroins (e.g. instability of long and highly repetitive DNA/mRNA sequences in heterologous hosts, translation inhibition by complex mRNA secondary structures, a high demand for glycine and alanine tRNAs, and overall metabolic burden).
TABLE-US-00001 TABLE 1 Averaged mechanical properties for fibers spun from synthetic spidroins compared to natural N. clavipes dragline fibers. Tensile Young's Breaking MW Strength Modulus Toughness Strain Diameter Spidroin (kDa) (MPa).sup.a (GPa).sup.a (MJ/m.sup.3).sup.a (%).sup.a (μm).sup.a Source Synthetic 277 525 ± 83 7.8 ± 1.3 91 + 30 23 ± 7 6.3 ± 0.7 Present 96-mer Study Synthetic 373 767 ± 92 10.3 ± 1.7 115 ± 58 22 ± 8 6.6 ± 0.9 Present 128-mer Study Synthetic 556 1031 ± 111 133.7 ± 3.0 114 ± 51 18 ± 6 5.7 ± 1.3 Present 192-mer study Natural >300 829 ± 334 10.3 ± 4.4 NA 16.6 ± 5.3 4.7 ± 1.3 Zemlin, N. clavipes 1968.sup.b, 10 Dragline Natural >300 850 12.7 NA 20 4.2 Ko, 2001.sup.31 N. clavipes Dragline Natural >300 1215 ± 233.sup.c 13.8 ± 3.6 111.2 ± 30 17.2 ± 3.5 NA Swanson, N. clavipes 2006.sup.19 Dragline .sup.aFor all mechanical measurements from the present study, n = 14. .sup.bDiameters were converted from originally reported units of denier. Strength and modulus were converted from originally reported units of grams per denier. .sup.c“True” stress values rather than the more commonly reported “engineering stress” values. True stress calculates strength based on the final diameter of the fiber assuming constant volume deformation, thus true stress values are expected to be significantly higher than engineering stress values as calculated in the present study. NA: values not found in the referenced study.
[0046] To confront these long-standing challenges, using split intein (SI)-mediated reactions was envisioned to post-translationally ligate the largest spidroins that can be stably expressed in engineered Escherichia coli, i.e. 96-mer (
[0047]
[0048] SIs are peptide auto processing domains that, when fused to separately expressed proteins, catalyze spontaneous splicing reactions, covalently linking their fusion partners via a peptide bond and leaving only a few residues (6 amino acids) at the ligation site. These few residues are unlikely to affect the properties of the much larger ligated spidroins (6720 amino acids total). Given the tendency of high MW spidroins to form inclusion bodies in microbial hosts, a recently engineered SI pair (Cfa) was employed that retains catalytic activity in the presence of 8 M urea, a denaturant often used to extract and solubilize spidroins from E. coli. Thus, ligating an N-intein (Int.sup.N)-fused 96-mer spidroin (96.sup.N) with a C-intein (Int.sup.C)-fused 96-mer (.sup.C96) would yield a 556 kDa, 192-mer spidroin (
[0049] To facilitate microbial production of highly repetitive, SI-fused material proteins, a standardized DNA part assembly system termed SI-Bricks was developed, as described herein below (see also
[0050]
[0051] Design of SI-Bricks standardized DNA part assembly system. SI-Bricks is meant to facilitate design and microbial production of SI-fused material proteins. SI-Bricks were developed based on five principle design considerations. (1) The system allows for in situ (i.e. within the final expression vector/host) recursive directional genetic assembly of material protein repeat motifs up to the maximum genetically-permissible size (e.g. 96-mer for MaSp1 described herein). (2) The system allows for selective swapping of the three SI-Bricks parts necessary for post-translational, SI-mediated ligation: (a) 5′ UTR/RBS/Int.sup.C, (b) multimeric material protein, (c) Int.sup.N/3′ UTR. (3) No restriction sites within the coding sequence should introduce amino acids likely to be detrimental to SI ligation or final material properties. (4) For maximum convenience, the system allows simultaneous “one-pot” assembly of all three protein parts. (5) The system also allows for selective swapping of the promoter, antibiotic marker, and replication origin.
[0052] SI-Bricks is based on existing BglBricks vectors which have been extensively used to construct multi-enzyme metabolic pathways for metabolic engineering. BglBricks vectors employ compatible “sticky end” restriction sites Bg1II/BamHI for recursive directional genetic assembly. However, this enzyme pair is not ideal for use with SI-fused multimeric proteins as the Bg1II site would introduce an arginine residue between Int.sup.C and the multimeric material protein. This bulky, positively charged residue would be proximal to the folded SI active site, which may negatively affect SI ligation—violating the design criterium (3). To solve this problem, it was chosen to flank material protein repeat sequences with an alternative pair of compatible sticky end restriction sites, NheI and SpeI, for recursive assembly. NheI and SpeI code amino acids alanine-serine and threonine-serine, respectively, which are less likely to affect SI ligation. During repetitive silk assembly, the cohesive end “scar” sequence from NheI/SpeI ligation is ACTAGC, encoding a threonine-serine linker that is not detrimental to silk properties. Finally, because NheI/SpeI have compatible sticky ends, flanking material proteins with NheI/SpeI alone would not allow for single-pot assembly of all parts, failing to meet design criterium (4). Thus, it was further chosen to flank multimeric material protein parts with an additional pair of orthogonal restriction sites, KpnI and Kpn2I.
[0053]
[0054] Thus, with SI-Bricks, material protein repeat motifs can be iteratively assembled in situ through digestion and enzymatic ligation using NheI and SpeI (
[0055] SI-Bricks allows for rapid genetic swapping of the core components of the envisioned SI-mediated ligation system (i.e. N-inteins, material proteins, C-inteins, and fusion domains/purification tags) in addition to common standardized biological parts (e.g. promoters, ribosomal binding sites, replication origins, and selection markers), all through simple restriction enzyme digestion and enzymatic ligation. To construct the SI-Bricks parts necessary, 64-mer and 96-mer spidroin DNA sequences were first assembled by recursive directional genetic assembly of a single codon-optimized repeat unit (1-mer) of the N. clavipes dragline spidroin MaSp1. The assembled spidroin sequences, flanked by SI-Bricks restriction sites, were genetically combined with codon-optimized SI DNA sequences and other necessary expression parts (
[0056]
[0057] Spidroin inter- and intramolecular interactions can be highly sensitive to salt and pH, even in the presence of 8 M urea. It was expected that unwanted spidroin interactions would lower SI ligation efficiency. Thus, to test optimum conditions for the ligation of SI-fused spidroins, 8 M urea extracts of E. coli expressing 64.sup.N or .sup.C64 were mixed at several salt concentrations, temperatures, and pH values (
[0058]
[0059] Under all tested conditions, SI-mediated spidroin ligation was both rapid and robust, with the highest ligation yields observed at 37° C., 300 mM NaCl, pH 7. Thus, for all subsequent ligations, these conditions were maintained, giving ligation yields of 68% and 62% for 128-mer and 192-mer spidroins, respectively (
[0060]
[0061] Ligation products were initially separated from most cellular proteins by selective ammonium sulfate precipitation and then further separated from unreacted 64-mer or 96-mer by size exclusion chromatography (SEC) for a final product purity>90% (
[0062]
[0063] As a standard for mechanical properties, a 96-mer spidroin with no SIs was also expressed and purified following identical procedures. Spinning dope was prepared from lyophilized powder of each purified protein and fibers were spun and mechanically tested following well-documented wet-spinning protocols detailed in Methods.
[0064] Comparing post-drawn 96-mer and 192-mer fibers, mechanical testing revealed significant, nearly two-fold increases in both tensile strength (from 525 to 1031 MPa, P<0.0001, two-tailed unpaired t-test, n=14) and modulus (from 7.8 to 13.7 GPa, P<0.0001, two-tailed unpaired t-test, n=14) (
[0065] To gain insight into the origins of the exceptional strength and toughness of 192-mer fibers, fiber physical characteristics were examined at both micro and molecular scales. At the micro scale, light microscopy images confirmed that fibers had consistent diameters along the fiber axes and that diameters did not vary significantly with MW (P=0.055, one-way ANOVA, Table 1,
[0066]
[0067] Fiber diameters were also similar to those of natural dragline fibers, which have been reported to range from 1-8 μm (
[0068]
[0069] To quantify this trend, the surface roughness of fiber exteriors and interiors was estimated using greyscale pixel values from six micrographs for each spidroin MW (
[0070]
is presented as an inset.
TABLE-US-00002 TABLE 2 Quantification of morphological differences between fibers of different molecular weight. Fiber Circularity Exterior Roughness Interior Roughness 96-mer 0.55 ± 0.14 0.52 ± 0.18 1.00 ± 0.21 128-mer 0.82 ± 0.10 0.31 ± 0.05 0.86 ± 0.13 192-mer 0.89 ± 0.05 0.30 ± 0.04 0.64 ± 0.17
[0071] To further investigate fiber characteristics at the molecular scale, the 192-mer fibers were analyzed by Fourier-transform infrared spectroscopy (FTIR) and polarized Raman spectromicroscopy. Deconvolution of the amide I band (1600-1700 cm.sup.−1) of the FTIR spectra confirmed a high percentage (37.9±2.3%) of β-sheet content in the 192-mer fibers (
of 1.42±0.12, indicative of substantial β-sheet anisotropy and in close agreement with reported values for natural dragline fibers following the same method (
[0072] In summary, the synthetic silk fibers produced from the SI-mediated ligation approach described herein not only replicate all major mechanical properties of natural dragline silk (strength, modulus, extensibility, and toughness) but also display similar physical properties, including microscale morphology, β-sheet content, and axial alignment of β-sheet crystals. Additionally, the observed persistence of correlation between spidroin MW and fiber strength and modulus up to 556 kDa suggests value in further pursuing the production of larger spidroins to potentially yield synthetic fibers even stronger than natural dragline silks. The fibers produced by the approach described herein may accelerate the development of applications that demand high-strength and toughness silk fibers, such as projectile protection in defense sectors, lightweight cables and ropes in aerospace sectors, or thin monofilament fibers for medical sutures. Such applications are especially likely with further improvements in process yield and perhaps through combination with recent advances in biomimetic spinning. Lastly, the platform developed and described herein may be applied to other large and highly repetitive material proteins (e.g. collagens, elastins, sucker ring teeth proteins), facilitating their microbial production from inexpensive and renewable feedstock.
[0073] Methods
[0074] Strains and growth conditions. E. coli NEB 10-beta (NEB10β) was used for all plasmid cloning and protein production. For all cloning, E. coli strains were cultured in Terrific Broth (TB) containing 24 g/L yeast extract, 20 g/L tryptone, 0.4% v/v glycerol, 17 mM KH.sub.2PO.sub.4, and 72 mM K.sub.2HPO.sub.4 at 37° C. with appropriate antibiotics (50 μg/mL kanamycin and 30 μg/mL chloramphenicol). M9 glucose medium with tryptone supplement (2% w/v glucose, 1× M9 Salts, 75 mM MOPS pH 7.4, 12 g/L tryptone, 5 mM sodium citrate, 2 mM MgSO.sub.4.Math.7H2O, 100 μM FeSO.sub.4.Math.7H2O, 100 μM CaCl.sub.2.Math.2H.sub.2O, 3 μM thiamine, 1× micronutrients [40 μM ZnSO.sub.4.Math.7H.sub.2O, 20 μM CuSO.sub.4.Math.5H.sub.2O, 10 μM MnC.sub.12.Math.4H.sub.2O, 4 μM H.sub.3BO.sub.3, 0.4 μM (NH.sub.4).sub.6Mo.sub.7O.sub.24.Math.4H.sub.2O, and 0.3 μM CoCl.sub.2.Math.6H.sub.2O]) was used for protein production in bioreactors.
[0075] Chemicals and reagents. Unless otherwise noted, all chemicals and reagents were obtained from MilliporeSigma. Plasmid purification and gel extraction kits were purchased from iNtRON Biotechnology. FastDigest restriction enzymes and T4 DNA ligase were purchased from Thermo Fisher Scientific and used for all digestions and ligations following the manufacturer's suggested protocols.
[0076] Genetic assembly of 64- and 96-mer spidroins. The multimeric spidroin DNA sequences were constructed as SI-Bricks genetic parts based on a method modified as described herein elsewhere (see also
[0077] Construction and sequence optimization of silk-SI-fusion proteins. N- and C-intein amino acid sequences (Cfa.sup.N and Cfa.sup.C, respectively) were obtained from a recent publication and prepared as SI-Bricks standard parts as described below. To ensure substantial production of the final SI-fused silk proteins, the SI coding sequences were optimized for E. coli expression within the genetic context of all flanking sequences using a combination of computational approaches. Specifically, an initial DNA sequence was computationally designed that contains (from 5′ to 3′) a 5′ UTR/RBS containing the EcoRI/Bg1II sites, a short coding sequence (5′-ATGGCTAAGACTAAA-3′) intended to increase translation initiation rate, the Cfa.sup.C coding sequence, the KpnI/NheI sites, and the multimeric silk sequence. Within this genetic context, only the Cfa.sup.C sequence was set variable and optimized using a modified E. coli codon usage table with extra weight given to 5′ mRNA structure minimization within the sequence optimization algorithm. The resulting optimized Cfa.sup.C sequence (including 5′ UTR/RBS and necessary SI-Bricks restriction sites; Table 3) was synthesized as a gblock fragment by Integrated DNA Technologies and was inserted 5′ of the 64-mer or 96-mer sequences by digestion/ligation with EcoRI/KpnI to yield plasmids p.sup.C64 and p.sup.C96, which encode fusion proteins C64 and .sup.C96, respectively (Table 4,
TABLE-US-00003 TABLE 3 Primers, UTRs, and coding sequences. Primer/ UTR/ Coding Sequence (CDS) Name Sequence Purpose 5′ UTR NA ATCAGCAGGACGCACTGACCGAATTCAAAAG Previously optimized 5′ ATCTTTTAAGAAGGAGATATACAT UTR including strong (SEQ NO ID: 1) RBS for high rate of translation initiation 3′ UTR NA GGATCCAAACTCGAGTAAGGATCTCCAGGCAT Previously optimized 3′ CAAATAAAACGAAAGGCTCAGTCGAAAGACT UTR including two strong GGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGA transcription terminators ACGCTCTCTACTAGAGTCACACTGGCTCACCTT rmB T1 and T7Te) CGGGTGGGCCTTTCTGCG (SEQ NO ID: 2) CDS Cfa.sup.N TCCGGAGCAGAATATTGCCTGTCTTACGACAC Final optimized C- AGAGATTCTGACCGTTGAATATGGATTCCTTC terminal SI sequence for CTATCGGTAAGATCGTGGAGGAACGGATTGAA assembly with 64-mer or TGCACAGTCTATACGGTAGATAAAAATGGCTT 96-mer silk sequences TGTGTATACACAACCTATTGCTCAGTGGCATA ACCGGGGAGAACAGGAAGTTTTCGAATACTGC TTAGAAGACGGTTCGATTATCCGTGCAACGAA AGATCACAAATTTATGACGACCGACGGTCAGA TGTTACCGATTGATGAGATTTTCGAACGGGGG TTAGACCTGAAACAAGTTGATGGTTTGCCGTA AGGATCC (SEQ NO ID: 3) CDS Cfa.sup.C AGATCTTTTAAGAAGGAGATATACATATGGCT Final optimized N- AAGACTAAAGTCAAGATCATTAGTCGTAAGAG terminal SI sequence for TCTGGGCACTCAAAACGTCTACGATATTGGAG assembly with 64-mer or TAGAAAAAGATCATAATTTTTTGCTGAAGAAT 96-mer silk sequences GGGCTGGTGGCCTCTAACTGCTTCAACGGTAC C (SEQ NO ID: 4) Primer GlyV-F CGGAACGACGTCAATTTTTCCTGGTCACGTAA Amplification of GlyV GCG (SEQ NO ID: 5) from E. coli genome and cloning into pAk backbone Primer GlyV-R GGCTACCTCGAGTTGGGTGGTCTGTGCTTTGC Amplification of GlyV AG (SEQ NO ID: 6) from E. coli genome and cloning into pAk backbone
TABLE-US-00004 TABLE 4 Plasmids Plasmid Plasmid Name ORI Promoter Resistance Gene Source pB6c pBBR1 P.sub.LlacO1 Cm.sup.R — Lee et al. 2011.sup.2 p96 pBBR1 P.sub.LlacO1 Cm.sup.R 96-mer Present study p64.sup.N pBBR1 P.sub.LlacO1 Cm.sup.R 64-mer + Present optimized study 3′ Cfa.sup.N p.sup.C64 pBBR1 P.sub.LlacO1 Cm.sup.R 64-mer + Present optimized study 5′ Cfa.sup.C p96.sup.N pBBR1 P.sub.LlacO1 Cm.sup.R 96-mer + Present optimized study 3′ Cfa.sup.N p.sup.C96 pBBR1 P.sub.LlacO1 Cm.sup.R 96-mer + Present optimized study 5′ Cfa.sup.C pA2k p15A P.sub.Tet Kan.sup.R — Lee et al. 2011.sup.2 pGlyV p15A Native Kan.sup.R Native Present glyV, X, Y E. coli study promoter glyV and promoter
[0078] Similarly, to codon-optimize Cfa.sup.N, an initial DNA sequence was computationally designed containing (from 5′ to 3′) the multimeric silk sequence, the SpeI/Kpn2I restriction sites, a Cfa.sup.N coding sequence, and the BamHI/XhoI sites. Within this context, only Cfa.sup.N was subjected to the optimization process. The resulting Cfa.sup.N sequence (Table 2), including SI-Bricks restriction sites, was synthesized and inserted 3′ of the 64-mer and 96-mer sequences by digestion/ligation with Kpn2I/XhoI to yield plasmids p64.sup.N and p96.sup.N, which encode fusion proteins 64.sup.N and 96.sup.N, respectively (
[0079] Upregulation of GlyV tRNA production. In addition to sequence optimizations, cellular .sup.glycyltRNA levels were also unregulated to meet the high demands on .sup.glycyltRNA posed by spidroin overexpression. The glyV tRNA coding sequence and its native promoter were PCR-amplified from the NEB10β genomic DNA (Table 3) and cloned between AatII/XhoI sites of a medium copy vector carrying p15A replication origin and Kanamycin resistance (Kan.sup.R), yielding plasmid pGlyV (Table 4). For all spidroin expression, pGlyV was co-transformed with the spidroin plasmid.
[0080] Shake flask cultures. For initial ligation tests as shown in
[0081] Bioproduction in fed-batch bioreactors. All spidroins were ultimately produced in 2 L fed-batch bioreactors (Bioflo120, Eppendorf). Transformants were cultured overnight in 50 mL TB medium at 37° C. on an orbital shaker. The overnight cultures were then used to inoculate 1 L glucose M9 medium with tryptone supplement at an initial OD.sub.600=0.08. After overnight incubation at 37° C. with orbital shaking, 1 L cultures were pelleted by centrifugation at 4500×g for 10 min and resuspended in 300 mL sterile resuspension medium (250 mM MOPS pH 7.4, 2.5% w/v glucose, 60 g/L tryptone, 25 mM sodium citrate, 10 mM MgSO.sub.4, 500 μM FeSO.sub.4.Math.7H.sub.2O, 15 μM thiamine, 5× micronutrients). The resuspended cultures were then added to an autoclaved 2 L Bioflo120 heat-blanketed bioreactor containing 1.2 L water and 1.15× M9 salts. Sterile CaCl.sub.2.Math.2H.sub.2O was added to a final concentration of 100 μM. Antifoam 204 was added as needed to minimize foaming (approximately 0.01% v/v). Agitation and air flow was regulated to maintain approximately 70% dissolved oxygen (DO). After consumption of the initial 0.5% w/v glucose (as judged by ΔDO), a sterile substrate feed (20% w/v glucose, 48 g/L tryptone, and 10 g/L MgSO.sub.4.Math.7H.sub.2O) was initiated to maintain a linear growth rate. Reactors were induced at OD.sub.600=80 by addition of 1 mM IPTG and culture temperature was reduced to 30° C. Cultures were collected four hours after induction. Titers were estimated from densitometric analysis of Coomassie Blue-stained SDS-PAGE gels (
[0082] Protein ligation. Cell cultures were pelleted by centrifugation at 4500×g for 30 min. Pellets from complimentary SI-fused spidroins (e.g. 96.sup.N and .sup.C96 or 64.sup.N and .sup.C64) were combined at a 1:1 reactant ratio based on densitometric analysis of Coomassie Blue-stained SDS-PAGE gels. Mixed pellets were resuspended in sonication buffer (300 mM NaCl, 20 mM MOPS pH 7.4, 2 mM TCEP, 1 mM PMSF) and sonicated using a QSonica Q700 sonicator (Qsonica) for 10 min (5 s on, 10 s off). Sonicated resuspensions were pelleted by centrifugation at 25,000×g for 30 min to remove supernatants. Pellets were resuspended in ligation buffer (8 M urea, 20 mM MOPS pH 7.4, 300 mM NaCl, and 2 mM TCEP) and stirred at 37° C. for 24 h to dissolve SI-fused spidroins and ensure complete ligation. The mixtures were then centrifuged at 25,000×g for 1 h to remove cell debris and undissolved proteins.
[0083] Protein purification. Specifically, ligated spidroins in ligation buffer were acidified to pH 4.0 with acetic acid. Ammonium sulfate was then added to a final concentration of 1.2 M. The mixture was then centrifuged at 40,000×g for 30 min. The pellet was discarded, and additional ammonium sulfate was added to the supernatant to a final concentration of 2.3 M. After stirring for 1 h, the mixture was centrifuged again at 40,000×g for 15 min. The supernatant was discarded, and the pellet was resuspended in SEC buffer (8 M urea, 10 mM ammonium bicarbonate pH 10) for further purification by size-exclusion chromatography. SEC purifications were performed on an AKTA Pure Chromatography System (GE Healthcare Life Sciences) using a HiPrep 16/60 Sephacryl S-500 HR column (for 128-mer and 192-mer) or a HiPrep 16/60 Sephacryl S-400 HR column (for 96-mer). Proteins were separated using an isocratic elution with SEC buffer at a flow rate of 0.5 mL/min. Fractions containing greater than 90% ligation product, as determined by SDS-PAGE gel densitometry, were collected. SEC-purified fractions were combined and dialyzed in 10K MWCO SnakeSkin dialysis tubing (ThermoFisher Scientific), followed by lyophilization.
[0084] Ligation kinetics analysis. For kinetics analysis, 64-mer protein concentrations in crude lysates were estimated by densitometric analysis of Coomassie Blue-stained SDS-PAGE gels. Based on estimated concentrations, fully sonicated resuspensions of 64.sup.C and .sup.N64 in ligation buffer were combined to give final concentrations of 100 μM for both 64.sup.C and .sup.N64 in a final volume of 500 μL. These mixtures were pelleted by centrifugation, and pellets were resuspended in 500 μL of desired test buffer pre-incubated at the desired test temperature. Reactions were quenched by transferring 5 μL of reaction to 95 μL of Laemmli sample buffer preheated to 100° C. and continuing boiling for 10 min.
[0085] SDS-PAGE and densitometric analysis. All SDS-PAGE gels were 1 mm thick, discontinuous with 3% stacking gel, and hand cast at the indicated percentages. Samples were prepared at 1 mg/mL or 5 μM total protein in Laemmli sample buffer (2% SDS, 10% glycerol, 60 mM Tris pH 6.8, 0.01% bromophenol blue, 100 μM DTT). Gels were run on Mini-PROTEAN Tetra Cells (Bio-Rad) in 1× Tris-glycine SDS buffer (25 mM Tris base, 250 mM glycine, 0.1% w/v SDS), until just before the dye front exited the gel. Gels were stained in Coomassie Blue solution (50% methanol, 10% w/v acetic acid, 1 g/L Coomassie Brilliant Blue) for a minimum of one hour at room temperature with gentle agitation and destained in Coomassie Blue destain buffer (40% v/v methanol, 10% v/v acetic acid) for a minimum of one hour. Gels were imaged on an Azure c600 Imager (Azure Biosystems). All densitometry analysis was performed with the AzureSpot Analysis Software (Azure Biosystems). Images were background subtracted with a built-in automatic lane edge subtraction algorithm. Protein band intensities were integrated by the AzureSpot software. Ligation yield was calculated as the integrated intensity of the product band over the sum of both reactant and product band areas. Purity was calculated as the integrated intensity of the product band over the integrated intensity of all other bands. Spidroin titer was calculated as the integrated intensity of the spidroin band over the integrated intensity of all other bands multiplied by the measured cell density (OD.sub.600) of culture at the time of sampling and 150 mg/L/OD.sub.600 (150 mg/L/OD.sub.600 is an average typical total protein titer for E. coli grown in glucose minimal medium).
[0086] Fiber spinning and mechanical testing. Fiber spinning and mechanical testing were performed following a modified protocol. Lyophilized spidroin powders were dissolved in hexafluorisopropanol (HFIP) to 17% w/v. This protein dope was loaded to a 100 μL Hamilton gastight syringe (Hamilton Robotics) fitted with a 23 s gauge (116 μm inner diameter, 1.71 inch length) needle. The syringe was fitted to a Harvard Apparatus Pump 11 Elite syringe pump (Harvard Apparatus), and the dope was extruded into a 95% v/v methanol bath at 5 μL/min. Extruded fibers were then transferred to a 75% v/v methanol bath and carefully extended at approximately 1 cm/s to the maximum draw ratio without fiber fracture. Extended fibers were removed from the bath and held under tension until visibly dry. Segments of post-drawn fibers (20 mm) were carefully laid exactly vertical across a 5 mm (vertical)×15 mm (horizontal) opening cut into a 20 mm×20 mm piece of cardstock and fixed with adhesive tape at both ends of the opening. Diameters of mounted fibers were then measured by light microscopy, averaging measurements at three points along the fiber axis (Tables 5-7,
TABLE-US-00005 TABLE 5 Diameter measurements and mechanical properties for 96-mer fibers Avg. Diam. Diam. Diam. Di- U.sub.T A B C ameter σ E ε (MJ/ FIBER (μm) (μm) (μm) (μm) (MPa) (GPa) (%) m.sup.3) 1 6.53 6.22 5.57 6.11 566.7 7.4 25.4 110.0 2 5.89 6.22 5.58 5.90 526.6 7.6 21.8 90.0 3 7.80 7.33 7.48 7.54 401.3 5.6 26.7 90.0 4 6.69 7.21 7.50 7.13 520.8 8.1 33.0 130.0 5 6.53 5.93 6.40 6.29 475.2 6.9 32.2 120.0 6 5.91 6.05 6.85 6.27 447.9 6.6 22.9 70.0 7 7.86 6.38 8.61 7.62 515.4 8.7 36.1 140.0 8 6.24 6.08 6.69 6.34 558.8 8.9 15.3 60.0 9 5.58 5.26 5.42 5.42 672.2 8.6 21.7 110.0 10 5.57 4.94 5.10 5.20 670.3 9.8 18.3 90.0 11 6.58 7.35 6.42 6.78 397.1 5.3 15.6 40.0 12 5.42 6.53 6.42 6.12 504.4 7.8 16.2 60.0 13 5.42 5.73 6.05 5.73 574.3 9.1 22.1 100.0 14 6.21 6.53 5.42 6.05 524.3 9.1 15.2 60.0
TABLE-US-00006 TABLE 6 Diameter measurements and mechanical properties for 128-mer fibers Avg. Diam. Diam. Diam. Di- U.sub.T A B C ameter σ E ε (MJ/ FIBER (μm) (μm) (μm) (μm) (MPa) (GPa) (%) m.sup.3) 1 7.33 7.05 6.63 7.00 874.4 11.4 39.2 260.0 2 6.56 7.68 6.03 6.76 886.1 9.5 18.9 100.0 3 7.96 5.47 5.65 6.36 650.2 8.4 12.7 50.0 4 7.49 5.87 6.00 6.45 652.1 8.0 29.5 150.0 5 4.98 3.54 4.66 4.39 642.9 12.9 9.5 40.0 6 7.18 6.42 7.07 6.89 877.2 12.6 33.3 200.0 7 6.76 6.91 6.34 6.67 654.3 9.0 19.4 80.0 8 5.77 5.74 6.55 6.02 843.0 9.5 16.8 90.0 9 6.36 6.53 5.75 6.21 816.2 10.7 15.2 110.0 10 7.01 6.85 7.66 7.17 750.4 9.6 22.0 90.0 11 7.91 7.91 7.37 7.73 744.8 8.2 27.3 130.0 12 6.41 5.65 5.59 5.88 817.5 11.8 17.4 90.0 13 6.69 7.50 8.13 7.44 717.0 10.7 25.5 120.0 14 7.41 8.51 8.20 8.04 816.7 12.3 20.0 100.0
TABLE-US-00007 TABLE 7 Diameter measurements and mechanical properties for 192-mer fibers Avg. Diam. Diam. Diam. Di- U.sub.T A B C ameter σ E ε (MJ/ FIBER (μm) (μm) (μm) (μm) (MPa) (GPa) (%) m.sup.3) 1 3.02 3.04 2.75 2.94 1078.6 14.7 11.7 70.0 2 6.56 7.68 7.34 7.19 892.9 9.0 15.3 70.0 3 4.98 7.41 7.37 6.59 1034.8 17.8 28.0 200.0 4 6.91 6.89 6.72 6.84 1135.6 11.8 17.7 110.0 5 7.32 7.33 7.64 7.43 911.5 12.2 14.0 80.0 6 6.34 5.50 6.13 5.99 1324.6 18.9 27.2 220.0 7 3.19 3.38 3.06 3.21 1130.5 17.2 15.6 100.0 8 5.25 5.89 5.10 5.41 982.8 10.5 18.4 100.0 9 4.80 5.12 5.81 5.24 987.6 10.3 24.6 140.0 10 5.73 5.73 7.01 6.16 1003.0 14.3 12.2 70.0 11 5.65 5.91 6.15 5.90 961.7 14.5 21.8 140.0 12 5.78 5.91 5.92 5.87 1016.0 11.9 12.1 70.0 13 6.53 5.89 5.57 6.00 1016.6 13.1 12.8 70.0 14 5.09 5.29 4.94 5.11 952.4 15.2 24.3 160.0
[0087] Mechanical properties were measured by axial pull tests on an MTS Criterion Model 41 universal test frame fitted with a 1 .sup.N load cell (MTS Systems Corporation). Cardstock holders were mounted between two opposing spring-loaded grips, and the supporting edges were carefully cut. Pull tests were conducted at a relative humidity of 30%, with a constant crosshead speed of 10 mm/min. Stress-strain curves were recorded by the MTS TW Elite test suite at a sampling rate of 50 Hz. Fiber breaks were recorded when a 90% drop from peak stress was detected. All mechanical properties were automatically calculated by the MTS TW Elite test suite. Ultimate tensile strength was calculated as the maximum measured load over the initial fiber cross-sectional area (A=πr.sup.2), as determined from measured initial diameters. Modulus was calculated as the slope of a linear least squares fit to the stress/strain data of the initial elastic region. Toughness was calculated as the area under the total stress/strain curve divided by the initial fiber volume (V=πr.sup.2 h) as calculated from measured initial fiber diameters and set initial gage length of 5 mm. For each protein, a total of 14 fibers were measured in this manner.
[0088] Light microscopy. Fiber diameters were measured using images acquired with a Zeiss Axio Observer ZI Inverted Microscope equipped with a phase contrast 20× objective lens and the Axiovision LE software (Zeiss). For morphological analysis and further confirmation of fiber diameters, additional images were acquired with a Nikon Eclipse TiE Inverted Microscope equipped with a 60×objective and analyzed using the Nis-Elements software (Nikon;
[0089] Scanning Electron Microscopy. Following tensile tests, silk fibers were mounted onto a sample holder using conductive tape. The sample holder was sputter coated with a 10 nm gold layer using a Leica EM ACE600 high vacuum sputter coater (Leica Microsystems). Fibers were imaged using a Nova NanoSEM 230 Field Emission Scanning Electron Microscope (Field Electron and Ion Company, FEI) at an accelerating voltage of 7-10 kV. Fiber surface roughness (both exterior and interior) was calculated using MountainsMap SEM Topo software (Digital Surf). The root mean square height (Sq) of each surface was determined from single images using greyscale values, normalized by the entire range of values in each micrograph. To remove fiber curvature from consideration, a standard Gaussian filter with a threshold of 2.5 μm was applied when analyzing exterior surfaces. For convenience, exterior and interior surface roughness values are presented relative to each other, with the highest interior value set at 1. Fiber circularity was calculated from cross-sectional areas and perimeters as
where a perfect circle gives a value of 1.
[0090] Polarized Raman spectromicroscopy. An adapted molecular alignment in spider silk fibers is reported herein. Silk fibers were carefully fixed to glass microscope slides with microscale markings to ensure that spectra were acquired at the same location before and after stage rotation. Raman spectra were acquired with a Renishaw RM1000 InVia Confocal Raman Spectrometer (Renishaw) coupled to a Leica DM LM microscope with rotating stage (Leica Microsystems). Silk fibers were initially oriented along the x-axis (
[0091]
[0092] Fibers were irradiated at a fixed point with the 514 nm line of an argon laser with polarization fixed along the x-axis and focused through a 50×objective (NA=0.75). Spectra were recorded from 1150-1750 cm.sup.−1 with an 1800 lines/mm grating. For each acquisition, a total of 16 spectra were accumulated, each for 10 s. The stage was then rotated to orient fibers along the y-axis with the same laser polarization, and spectra were acquired a second time at the same fixed point. No signs of thermal degradation were apparent either visually or within recorded spectra. All recorded spectra were analyzed using Fityk 0.9.8. Baselines were subtracted from all spectra using the built-in Fityk automatic convex hull algorithm. For intensity ratio calculations, all spectra were normalized to the intensity of the 1450 cm.sup.−1 peak, which arises from CH.sub.2 bending and is insensitive to protein conformation. For each fiber, the normalized intensity of the peak at 1670 cm.sup.−1 when oriented along the Y-axis was divided by the normalized intensity of the peak when oriented along the X-axis to give the intensity ratio (I Y/X). This procedure was performed on a total of three separate fibers and calculated intensity ratios were averaged. Spectra were also averaged and presented in
[0093] Fourier Transform Infrared Spectroscopy. For secondary structure determination, FTIR spectra were acquired with a Thermo Nicolet 470 FT-IR spectrometer (ThermoFisher Scientific) fitted with a Smart Performer ATR accessory with Ge crystal. Spectra were acquired from 1350-1750 cm.sup.−1 at 4 cm.sup.−1 resolution. A total of 254 scans were accumulated for each sample. All recorded spectra were analyzed using Fityk 0.9.8. Baselines were subtracted from all spectra using the built-in Fityk convex hull algorithm. The amide I band (1600-1700 cm.sup.−1) was deconvolved into a set of five Lorentzian peaks centered at 1626.5, 1646.5, 1659, 1679.5, and 1700 cm.sup.−1 for β-sheet, random coil, α-helix, β-turn, and β-sheet components, respectively. Component peak assignments were based on known assignments. Peak areas were integrated and percentages were calculated as the component peak area over the sum of all peak areas. Percentages were averaged from measurements of three fibers.
[0094] Statistical analysis. GraphPad Prism 7 (GraphPad Software) was used for statistical data analysis, using both two-tailed unpaired t-tests (26 degrees of freedom) and one-way ANOVA tests (41 degrees of freedom) to compare data sets.
[0095] Plasmid maps are shown in
TABLE-US-00008 TABLE 8 Peptide sequences Peptide Original Peptide Name Sequence Purpose Sequence Source MaSp1 SGRGGLGGQGAGMAAAAAMG 1-mer sequence used Sezla et al. 2000.sup.3 1-mer GAGQGGYGGLGSQG for assembly of 64- (SEQ NO ID: 7) mer and 96-mer spidroins Cfa.sup.N AEYCLSYDTEILTVEYGFLPIGK N-intein sequence Stevens et al. 2016.sup.4 IVEERIECTVYTVDKNGFVYTQ for ligation of 64- PIAQWHNRGEQEVFEYCLEDG mer or 96-mer SIIRATKDHKFMTTDGQMLPID spidroins EIFERGLDLKQVDGLP* (SEQ NO ID: 8) Cfa.sup.C MVKIISRKSLGTQNVYDIGVEK C-intern sequence for Stevens et al. 2016.sup.4 DHNFLLKNGLVASNCFN ligation of 64-mer or (SEQ NO ID: 9) 96-mer spidroins
TABLE-US-00009 TABLE 9 Strain Name Genotype Strain Source NEB10β F′ proA + B + lacIq NEB Δ(lacZ)M15 zzf::Tn10 (TetR) Δ(ara-leu) 7697 araD139 fhuA ΔlacX74 galK16 galE15 e14- Φ80dlacZΔM15 recA1 relA1 endA1 nupG rpsL (StrR) rph spoT1 Δ(mrr-hsdRMS-mcrBC) s96 NEB10β containing Present study p96 + pGlyV s64.sup.N NEB10β containing Present study p64.sup.N + pGlyV s.sup.C64 NEB10β containing Present study p.sup.C64 + pGlyV s96.sup.N NEB10β containing Present study p96.sup.N + pGlyV s.sup.C96 NEB10β containing Present study p.sup.C96 + pGlyV
[0096] In vivo Seeded Chain-Growth Polymerization for the Bioproduction of High Molecular Weight Spidroins
[0097] Microbially produced protein-based materials are appealing due to renewable feedstocks, low-energy production, precisely tunable side-chain chemistries, biocompatibility, and biodegradability. However, the production of high strength protein-based materials typically requires the production of high molecular weight, repetitive proteins that are difficult to efficiently produce in microbial hosts due to genetic instability and metabolic burden. As described herein the development of a modular biosynthetic platform is reported, termed seeded chain growth polymerization, for production of high molecular weight protein-based materials via post-translational split-intein mediated polymerization of relatively small, genetically stable material protein subunits. As a proof of concept, seeded chain growth polymerization was applied to the production of biosynthetic spider silk proteins in E. coli. While unseeded polymerization yielded primarily low molecular cyclic byproducts, seeded chain growth polymerization generated native-sized, linear dragline spidroin polymers (>300 kDa)—permitting efficient production of biosynthetic spider silk fibers of high strength, modulus, and toughness. By allowing efficient production of large, repetitive material proteins from more easily expressed, genetically stable subunits, the seeded chain growth method can facilitate production of a variety of high performance protein-based materials for practical commercial applications.
[0098] Disclosed herein is a unique method for efficient post-translational assembly of repetitive proteins in living bacterial cells through SI-based polymerization. An in vivo protein polymerization method, termed seeded chain-growth polymerization (SCP), mimics the chain-growth polymerization in organic polymer science. SCP effectively blocks the formation of cyclic proteins that are otherwise a major product of uncontrolled SI-based polymerization. As a proof of concept for this platform, the application of SCP to the production of high MW dragline spidroins in engineered E. coli was demonstrated.
[0099] In some embodiments, the present disclosure is directed to a method for synthesizing a spidroin. The method comprises synthesizing a seed protein in vivo in a heterologous host, the seed protein comprising a C-terminus Int.sup.N domain, synthesizing a monomer in vivo in the heterologous host, the monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain, and co-translationally polymerizing the monomer via in vivo split-intein mediated polymerization.
[0100] In some embodiments the heterologous host is a protein-expressing microbial host and/or the monomer is a silk amino acid sequence from a spider species. In some embodiments, the heterologous host is E. coli, and/or the monomer is an N. clavipes spidroin. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa, at least about 400 kDA, at least about 500 kDa, or at least about 600 kDa. In some embodiments the method further comprises spinning the synthesized spidroin into fibers. In some embodiments, the fibers have a tensile strength of from about 150 MPa to about 350 MPa, or from about 170 MPa to about 310 MPa. In some embodiments, the fibers have a modulus of about 3.0 GPa to about 5.5 GPa. In some embodiments, the fibers have a toughness of from about 25 MJ/m.sup.3 to about 150 MJ/m.sup.3, or from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3. In some embodiments, the fibers have a β-sheet content of from about 20% to about 60%, or from about 35% to about 45%. In some embodiments, the synthesized spidroin has a molecular weight of In some embodiments, the fibers have an extensibility of from about 5% to about 35%, or from about 10% to about 25%.
[0101] In some embodiments, a method for synthesizing a spidroin comprises: synthesizing a seed protein in vivo in a heterologous host, the seed protein comprising a C-terminus Int.sup.N domain; synthesizing a monomer in vivo in the heterologous host, the monomer comprising both an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain; and undergoing multiple steps of co-translational ligation of the monomer via in vivo split-intein mediated reaction. In some embodiments, the heterologous host is E. coli, or other protein expressing microbial hosts. In some embodiments, the monomer contains a fragment of silk amino acid sequence from N. clavipes spidroin or other spider species. In some embodiments, the synthesized spidroin is a linear polymer. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa. In some embodiments, the method further comprises spinning the synthesized spidroin into fibers. In some embodiments, the fibers have a tensile strength of from about 170 MPa to about 310 MPa, or at least about 300 MPa. In some embodiments, the fibers have a toughness of from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3, or at least about 100 MJ/m.sup.3.
[0102] In some embodiments, the present disclosure is directed to a system for synthesizing a spidroin in vivo. The system comprises a host cell, a seed cassette encoding a seed protein comprising a C-terminus Int.sup.N domain, and a monomer cassette encoding a monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain.
[0103] In some embodiments the host cell is a protein-expressing microbial host and/or the monomer is a silk amino acid sequence from a spider species. In some embodiments, the host cell is E. coli, and/or the monomer is an N. clavipes spidroin. In some embodiments, the fibers have a tensile strength of from about 150 MPa to about 350 MPa, or from about 170 MPa to about 310 MPa. In some embodiments, the fibers have a toughness of from about 25 MJ/m.sup.3 to about 150 MJ/m.sup.3, or from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3. In some embodiments, the fibers have a β-sheet content of from about 20% to about 60%, or from about 35% to about 45%. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa, at least about 400 kDA, at least about 500 kDa, or at least about 600 kDa. In some embodiments, the fibers have an extensibility of from about 5% to about 35%, or from about 10% to about 25%.
[0104] In some embodiments, a system for synthesizing a spidroin in vivo comprises: a host cell; a seed cassette encoding a seed protein comprising a C-terminus Int.sup.N domain; and a monomer cassette encoding a monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain. In some embodiments, the host cell is E. coli, or other protein expressing microbial hosts. In some embodiments, the monomer contains a fragment of silk amino acid sequence from N. clavipes spidroin or other spider species.
[0105] Results and Discussion
[0106] SI-based polymerization of dragline spidroins in E. coli. To first test the feasibility of SI-based polymerization of material proteins in E. coli, a 27.5 kDa “monomer” was employed containing 10 repeats of an N. clavipes MaSp1 dragline spidroin consensus sequence with a histidine tag for protein detection and purification purposes (
[0107]
[0108] The sequence was genetically optimized for efficient expression in E. coli and flanked by a pair of complementary, fast reacting gp41-1 SIs in the form of Int.sup.C-monomer-Int.sup.N (
[0109]
[0110] Interestingly, the polymerization products were primarily low MW oligomers (
[0111] Development of SCP for production of HMW linear dragline spidroins in E. coli. To prevent cyclization and shift production toward HMW linear spidroins, a method termed seeded chain-growth polymerization (SCP) was devised, which mimics chain-growth polymerization in organic polymer science by first inducing a “seed protein”, which only contains one reactive Int.sup.N domain fused at the C-terminus of the seed (
[0112]
[0113] After a certain time, the Int.sup.C-monomer-Int.sup.N cassette is subsequently expressed. Provided sufficient intracellular concentrations of reactive seed or growing linear chains, the Int.sup.C domain at the N-terminus of a nascent monomer react with seed or linear chain before its C-terminal Int.sup.N domain can be translated, resulting in linear intermolecular ligation without cyclization. As a seed protein for dragline spidroin production, the non-repetitive N-terminal domain of N. clavipes MaSp1 dragline silk (termed NTD, 25.2 kDa) was chosen. Thus, Int.sup.N was genetically fused to the C-terminus of NTD, yielding a “seed cassette” in the form of NTD-Int.sup.N (
[0114] Optimization of SCP. To test SCP in living E. coli cells and optimize reaction conditions, cells were induced with a range of anhydrotetracycline (ATc) concentrations (50-175 nM) for 1 h followed by addition of 1 mM IPTG to induce monomer cassette. Cells were then incubated for 0-6 h to monitor silk polymerization (
[0115]
[0116] At the lowest ATc concentration (50 nM), seed protein was observed 1 h after ATc induction. However, as the monomer was continuously expressed, the seed protein was fully consumed by 3 h post ATc induction. Instead, cyclic monomer and dimer accumulated over the remainder of the time course, indicating insufficient seed production. At the highest tested ATc concentration (175 nM), IPTG induction of monomer cassette led to continuous accumulation of higher MW products over the entire time course and products exhibited apparent MWs consistent with the formation of linear NTD-(7×).sub.n-Int.sup.N polymers, indicating successful seeded chain-growth polymerization. However, excess seed protein also was observed under this ATc concentration throughout the time course. At intermediate ATc concentrations (100-125 nM), seed protein was mostly consumed by the end of the time course along with continuous production of HMW linear products and very little cyclic byproducts. Ultimately, the best tradeoff between high MW linear products, residual seed protein, and cyclic byproducts was observed with 125 nM ATc, which yielded linear products up to 326 kDa (
[0117] Confirmation of elimination of cyclic byproducts by SCP. To definitively designate the observed polymerization products as being either cyclic or linear, a cysteine-specific fluorescent labeling reaction was employed. Neither NTD nor silk monomer contain any cysteine residues, while the Int.sup.N sequence contains three cysteine residues. Because all linear products contain an unreacted Int.sup.N at their C-termini, the linear products are fluorescently labeled at the cysteine sidechains, while cyclic products (which have lost both Int.sup.N and Int.sup.C), are not. To label the polymerization products, overexpressed proteins were purified by nickel-affinity chromatography and reacted with a maleimide-Cy5 dye that specifically reacts with the thiol group of cysteine. Subsequent fluorescence imaging of products resolved by SDS-PAGE revealed specific labelling of linear products only formed when SCP was employed, while the unseeded polymerization produced cyclic products that exhibited no detectable fluorescent labeling (
[0118]
[0119] MW distribution of spidroins produced via SCP. To demonstrate the value of producing HMW linear spidroins via SCP, the in vivo SCP reaction in 1 L shake flask cultures was next performed. The over-produced high MW silk products were then separated from E. coli native proteins using nickel-affinity and ion-exchange chromatography (
[0120]
[0121]
[0122] Based on densitometry analysis of Coomassie-stained SDS-PAGE gels (see methods), the fully purified SCP products have a mass-average MW (M.sub.w) of 147±6 KDa and a dispersity of 1.5, while the purified unseeded polymerization products exhibit M.sub.w of only 52±4 KDa and dispersity of 1.3 (
[0123]
[0124] Mechanical properties of wet spun fibers from seeded spidroins. The purified HMW spidroins were then lyophilized, dissolved in hexafluoroisopropanol (HFIP) and spun into fibers following standard methods. Tensile tests were used to evaluate the mechanical performance of fibers. While fibers from the unseeded, cyclic spidroins displayed very weak mechanical performance, fibers from the SCP-produced spidroins displayed greatly enhanced fiber strength (245±63 MPa), modulus (4.1±1.1 GPa), and toughness (80±20 MJ/m.sup.3), representing 24-, 41-, and 89-fold enhancements compared to those from unseeded spidroins, respectively (
[0125]
[0126] Additionally, fibers produced from unseeded polymers are quite brittle, typically fracturing at approximately 10% elongation, while the fibers produced from seeded polymers exhibit substantial extensibility, with typical breaking strains>30%. The observed enhancements in mechanical properties are most likely the result of the drastically increased MW of SCP products. Indeed, a positive correlation between MW and strength/modulus of dragline spidroin fibers is well documented. It is also worth noting that the linear polymers produced herein contain a 6× histidine tag in each monomer unit and an Int.sup.N sequence at their C-termini. Yet despite the presence of these sequences, high strength, modulus, and toughness are still obtained, suggesting tolerance of dragline spidroin fibers to the presence of a few non-native sequences. Alternatively, it is also possible that mechanical properties be further improved by removal of these sequences and/or further purification to remove low MW species. Regardless, these results clearly demonstrate the value of SCP as a more scalable production of HMW dragline spidroins from relatively small, genetically stable sequences in a one-step fermentation process.
[0127] Spectroscopic analysis of fibers produced from seeded polymers. Next structural differences were examined between fibers produced by the two methods via Fourier transform infrared spectroscopy (FT-IR) and scanning electron microscopy (SEM). Interestingly, comparison of the FT-IR spectra of fibers spun from seeded and unseeded polymers showed relatively little difference in their general secondary structure and β-sheet content. Deconvolutions of the amide I bands of FT-IR spectra suggest that both fibers contain roughly 25-30% β-sheet content, which is similar to both natural spidroins and reported synthetic dragline spidroins (
[0128]
[0129] These results suggest that neither MW nor cyclization of dragline spidroin polymers have substantial effect on the β-sheet formation through the wet-spinning process and that differences in β-sheet content are not the main factor contributing to the observed differences in mechanical properties.
[0130] On the other hand, comparison of SEM micrographs of the fibers produced by the two methods reveal marked differences in microscale morphology, with fibers produced from unseeded polymers exhibiting relatively smooth and flat fracture surfaces, while fibers produced from seeded polymers exhibit a noticeably rougher and uneven fracture surface (
[0131] Overall, the results demonstrate that SCP enabled the production of linear spidroin polymers with MW up to at least 326 kDa, roughly the size of the largest natural dragline spidroins. SCP allows multiple rounds of SI-catalyzed ligation reactions to occur in living cells of one cell culture, significantly reducing the number of steps that in vitro ligation would otherwise require to obtain products with similar MW, thus greatly decreasing process complexity and increasing the potential scalability of fiber production. Furthermore, SCP permits production of high repetitive proteins from much smaller, more genetically stable and more easily expressed subunits, which can also facilitate practical production of PBMs for industrial applications. In the case of spidroin, although SCP yielded a mixture of products and the monomer sequence contains a 6× His-tag that may affect fiber properties, fibers spun from such a mixture exhibited high strength, modulus, and toughness, comparable to reported synthetic silk fibers with uniform size and similar MW. Continued optimization of SCP parameters such as monomer sequence and size, SI reaction rate, culture temperature, and induction timing may permit production of spidroins of even higher MW and yield with further improved mechanical properties. Finally, this approach may ultimately be applied to the production of numerous other highly repetitive, high MW PBMs to further advance their production for materials applications.
[0132] Materials and Methods
[0133] Strains and growth conditions. For plasmid cloning and protein production, E. coli NEB 10-beta (NEB10β) was used (Table 10). Strains were cultured in Terrific Broth (TB) containing 24 g/L yeast extract, 20 g/L tryptone, 0.4% v/v glycerol, 17 mM KH.sub.2PO.sub.4, and 72 mM K.sub.2HPO.sub.4 at 37° C. with appropriate antibiotics (50 μg/mL kanamycin and/or 30 μg/mL chloramphenicol).
TABLE-US-00010 TABLE 10 Strains. Strain Name Genotype Strain Source NEB10β F′ proA + B + lacIq Δ(lacZ)M15 NEB zzf::Tn10 (TetR) Δ(ara-leu) 7697 araD139 fhuA ΔlacX74 galK16 galE15 e14- Φ80dlacZΔM15 recA1 relA1 endA1 nupGrpsL (StrR) rph spoT1 Δ(mrr-hsdRMS-mcrBC) s10x NEB10β containing p10x Present study sSCP NEB10β containing p7x + pNTD Present study
[0134] Chemicals and reagents. Unless otherwise noted, reagents were obtained from MilliporeSigma. Plasmid purification and gel extraction kits were obtained from iNtRON Biotechnology. FastDigest restriction enzymes and T4 DNA ligase were purchased from Thermo Fisher Scientific and used for all digestions and ligations following the manufacturer's suggested protocols.
[0135] Genetic assembly of monomer and seed cassettes. To construct the 10× and 7× monomer cassettes, 10 or 7 repeats of the N. clavipes MaSp1 dragline spidroin (Table 11) were computationally designed, flanked at the 5′ end by KpnI and at the 3′ end by Kpn2I, and sequence optimized as described herein elsewhere. Optimized sequences were chemically synthesized by Integrated DNA Technologies. The synthesized sequences were separately inserted between restriction sites KpnI/Kpn2I of a medium copy (pBBR1 replication origin), chloramphenicol resistance (Cm.sup.R) SI-Bricks expression vector containing optimized gp41-1 SI coding sequences (Table 11), resulting in plasmids pB6c-Int.sup.C-10×-Int.sup.N (p10×) and pB6c-Int.sup.C-7×-Int.sup.N (p7×) (Table 12).
TABLE-US-00011 TABLE 11 Amino acid sequences of proteins Name Sequence Gp41-1 MAKTKMLKKILKIEELDERELIDIEVSGNHLFYAND Int.sup.C ILTHN (SEQ NO ID: 10) Gp41-1 CLDLKTQVQTPQGMKEISNIQVGDLVLSNTGYNEVLN Int.sup.N VFPKSKKKSYKITLEDGKEIICSEEHLFPTQTGEMNI SGGLKEGMCLYVKE* (SEQ NO ID: 11) 10x MaSp1 SSSDVGTHHHHHHAAAAAGGAGQGGYGGLGSQGAGRG Monomer GLGGQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQ GAGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQGAGAA AAAGGAGQGGYGGLGSQGAGRGGLGGQGAGAAAAAGG AGQGGYGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGG YGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGAGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGAG RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLG GQGAGAAAAASGTRSGY (SEQ NO ID: 12) 7x MaSp1 SSSDVGTHHHHHHGGGGSAGRGGLGGQGAGAAAAAGG Monomer AGQGGYGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGG YGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGAGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGAG RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLG GQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQGAG AAAAAGGAGQGGYGGLGSQGSGTRSGY (SEQ NO ID: 13) NTD MAKTKQNTPWSSTELADAFINAFMNEAGRTGAFTADQ LDDMSTIGDTIKTAMDKMARSNKSSKGKLQALNMAFA SSMAEIAAVEQGGLSVDAKTNAIADSLNSAFYQTTGA ANPQFVNEIRSLINMFAQSSANEVSYGGSGTRSGY (SEQ NO ID: 14)
TABLE-US-00012 TABLE 12 Plasmids Plasmid Pro- Plasmid Name ORI moter Resistance Gene Source pB6c pBBR1 P.sub.LlacO1 Cm.sup.R — Lee et al. 2011 pA2k p15A P.sub.Tet Kan.sup.R — Lee et al. 2011 p10x pBBR1 P.sub.LlacO1 Cm.sup.R SI-flanked 10-mer Present N. clavipes dragline study spidroin p7x pBBR1 P.sub.LlacO1 Cm.sup.R SI-flanked 7-mer Present N. clavipes study dragline spidroin pNTD p15A P.sub.Tet Kan.sup.R Native N. clavipes Present N-terminal domain +3′ study Gp41-1.sup.N
[0136] To construct the seed cassette, the amino acid sequence of the NTD of N. clavipes dragline spidroin MaSp1 was computationally redesigned for E. coli expression and chemically synthesized by Integrated DNA Technologies. The seed sequence was inserted between restriction sites Bg1II/Kpn2I of a medium copy (p15A replication origin), kanamycin resistance (Kan.sup.R) SI-Bricks expression vector containing optimized gp41-1 Int.sup.N, resulting in plasmid pA2k-NTD-Int.sup.N (pNTD) (Table 12).
[0137] SCP optimization. For SCP optimization, cultures were grown in 50 mL volumes of TB medium in 250 mL shake flasks with orbital shaking. Cultures were initially incubated at 37° C. until reaching an OD.sub.600=2.0. Cultures were then induced with varied concentrations of ATc and incubated at 30° C. After one hour, monomer production was induced by addition of 1 mM IPTG, and cultures were incubated at 30° C. for varied time period.
[0138] Shake flask cultures. Protein production was performed in 2 L shake flasks. Transformants were cultured overnight in 50 mL TB medium at 37° C. on an orbital shaker. Overnight 50 mL cultures were then used to inoculate 500 mL fresh TB medium in 2 L Erlenmeyer flasks at an initial OD.sub.600=0.08. Cultures were grown at 37° C. with orbital shaking to OD.sub.600=2. In the case of unseeded polymer production, cultures were induced by addition of 1 mM IPTG and cultured for an additional 6 hours at 30° C. with orbital shaking. In the case of SCP, seed production was first induced by addition of 125 nM ATc, cultured for one hour at 30° C., followed by monomer induction with 1 mM IPTG and continued culture for additional 6 hours at 30° C.
[0139] Protein purification. Cell pellets were directly solubilized in lysis buffer (8M urea, 20 mM potassium phosphate, 10 mM imidazole, pH 7.4). The mixture was stirred overnight at 22° C. and centrifuged at 25,000×g for 20 min. The pellet was discarded and the supernatant was sonicated for a total of 10 min. (70% amplitude, 5 s. on, 10 s. off). The sonicated supernatant was then centrifuged at 40,000×g for 30 min. The pellet was discarded, and the supernatant was filtered through a 0.2 μm filter. The filtered solution was applied to a 5 mL His-Trap column at a flow rate of 1 mL/min. The column was then washed with 5 CV of wash buffer (lysis buffer+50 mM imidazole) followed by elution with 5 CV of elution buffer (lysis buffer+300 mM imidazole). Eluent was then dialyzed against cation exchange (IEX) binding buffer (8M urea, 10 mM HEPES, pH 8.0) in 10K MWCO SnakeSkin dialysis tubings (ThermoFisher Scientific). The eluent was loaded to a 5 mL HiTrap SPFF cation exchange column at a flow rate of 1 mL/min. The column was then washed with 5 CV of IEX wash buffer (binding buffer+40 mM guanidinium hydrochloride). Bound proteins were eluted with 5 CV IEX elution buffer (binding buffer+200 mM guanidinium hydrochloride). IEX eluent was then dialyzed extensively against 5% acetic acid at 4° C. in 10K MWCO SnakeSkin dialysis tubings, and lyophilized.
[0140] Fluorescence Labelling. After purification by His-Trap affinity chromatography, purified products were dialyzed into 8 M urea, 10 mM HEPES pH 7.4, and 100 μM TCEP, at a final protein concentration of approximately 10 μM. Sulfo-Cyanine5 (Lumiprobe Life science solutions) was pre-dissolved in DMSO at a concentration of 100 mM and then added to the protein solution to a final concentration of 200 μM. The reaction mixture was incubated overnight at 4° C. in dark with periodic mixing. After overnight incubation, the reaction was mixed 1:1 with 2×Laemmli sample buffer, run on a SDS-PAGE (see below) and imaged with an Azure c600 Imager (Azure Biosystems) in the Cy5 channel.
[0141] SDS-PAGE. All SDS-PAGE gels were 1 mm thick, discontinuous with 3% stacking gel, and hand cast at the indicated percentages. Samples were prepared at 1 mg/mL or 5 μM total protein in Laemmli sample buffer (2% SDS, 10% glycerol, 60 mM Tris pH 6.8, 0.01% bromophenol blue, 100 μM DTT). Gels were run on Mini-PROTEAN Tetra Cells (Bio-Rad) in 1× Tris-glycine SDS buffer (25 mM Tris base, 250 mM glycine, 0.1% w/v SDS), until just before the dye front exited the gel. Gels were stained in Coomassie Blue solution (50% methanol, 10% w/v acetic acid, 1 g/L Coomassie Brilliant Blue) for a minimum of one hour at room temperature with gentle agitation and destained in Coomassie Blue destain buffer (40% v/v methanol, 10% v/v acetic acid) for a minimum of one hour. Gels were imaged on an Azure c600 Imager (Azure Biosystems).
[0142] Western blotting. Western blotting was performed with an OWL HEP-3 semi-dry electroblotting system (Thermo Scientific). SDS-PAGE gels, blotting paper (10 cm thickness, Bio-Rad), and blotting membrane (PVDF, 0.2 μm pore size, Roche) were soaked for 15 minutes in semi-dry transfer buffer (1× Tris-glycine SDS buffer+20% methanol). After soaking blot sandwiches were stacked onto the OWL system and proteins were transferred at 20 mA constant current for 1 h. Blots were then washed briefly in 1× TBS Tween (50 mM Tris-Cl pH 7.6, 150 mM NaCl, 0.1% Tween 20) and then blocked in 1× TBS Tween+5% dried milk powder for 2 h with gentle rocking at room temperature. Blots were then soaked overnight at 4C with gentle rocking in 1× TBS Tween+2% dried milk and 1:5000 dilution of mouse anti H.sub.6 monoclonal antibody (ThermoFisher). Blots were washed 4×in TBS Tween and then incubated for 45 min. with gentle rocking at room temperature in 1× TBS-Tween+2% dried milk and 1:10000 dilution of goat anti mouse AzureSpectra 700 antibody (Azure Biosystems). Finally, blots were washed 4× in TBS-Tween and imaged on an Azure c600 Imager (Azure Biosystems) in the IR700 imaging channel.
[0143] Densitometry analysis and calculation of M.sub.w, M.sub.n, and PDI. Coomassie stained SDS-PAGE gels of polymerization products after ion exchange purification were imaged on an Azure c600 Imager (Azure Biosystems) (
[0144]
where ΣM.sub.i.sup.N.sub.i is treated as the sum of each species' MW (M.sub.i) multiplied by its integrated band intensity (N.sub.i), and ΣN.sub.i is the sum of all band intensities. Weight-average MW (M.sub.w) was calculated as M.sub.w=Σw.sub.iM.sub.i, where w.sub.i is the weight fraction of each species calculated as the total weight of a species (M.sub.i.sup.N.sub.i) divided by the total weight of all species Lastly, PDI was calculated as the ratio of M.sub.w to M.sub.n.
[0145] Fiber spinning and mechanical testing. Fiber spinning and mechanical testing were performed following a protocol modified from known methods. Lyophilized spidroin powders were dissolved in HFIP to 20% w/v. This protein dope was loaded to a 100 μL Hamilton gastight syringe (Hamilton Robotics). The syringe was fitted to a Harvard Apparatus Pump 11 Elite syringe pump (Harvard Apparatus), and the dope was extruded into a 95% v/v methanol bath at 5 μL/min. Extruded fibers were then transferred to a 75% v/v methanol bath and carefully extended at approximately 1 cm/s to the maximum draw ratio without fiber fracture. Extended fibers were removed from the bath and held under tension until visibly dry. Segments of post-drawn fibers (20 mm) were carefully laid exactly vertical across a 5 mm (vertical)×15 mm (horizontal) opening cut into a 20 mm×20 mm piece of cardstock and fixed with adhesive tape at both ends of the opening. Diameters of mounted fibers were then measured by light microscopy, averaging measurements at three points along the fiber axis (Table 13 and Table 14).
TABLE-US-00013 TABLE 13 Diameter measurements and mechanical properties for un-seeded fibers Avg. Diam. Diam. Diam. Di- U.sub.T A B C ameter σ E ε (MJ/ FIBER (μm) (μm) (μm) (μm) (MPa) (GPa) (%) m.sup.3) 1 14.59 14.45 15.79 14.94 154.2 2.983 38.137 52 2 14.58 13.79 14.43 14.27 171.8 3.381 33.429 49 3 13.78 12.34 12.66 12.93 213.1 4.536 35.892 67 4 14.15 15.44 13.44 14.34 356.5 5.672 19.486 106 5 14.90 16.03 16.35 15.76 316.6 5.463 35.577 96 6 16.25 18.04 17.64 17.31 272.4 4.256 40.319 92 7 16.06 15.35 14.63 15.35 286.3 5.298 27.417 71 8 17.34 18.05 17.34 17.58 245.1 3.905 21.157 76 9 19.71 18.27 17.95 18.64 217 3.024 44.747 83 10 19.09 21.32 19.12 19.84 217.2 2.693 52.923 103
TABLE-US-00014 TABLE 14 Diameter measurements and mechanical properties for seeded fibers Avg. Diam. Diam. Diam. Di- U.sub.T A B C ameter σ E ε (MJ/ FIBER (μm) (μm) (μm) (μm) (MPa) (GPa) (%) m.sup.3) 1 58.81 59.18 61.71 59.90 3.8 0.052 6.9 0.22 2 75.36 73.38 76.63 75.12 4.1 0.05 8.6 0.26 3 67.48 67.32 68.82 67.87 10.2 0.115 9.3 0.66 4 65.10 59.14 63.71 62.65 14.5 0.196 10.5 1.78 5 77.18 82.25 82.81 80.75 6.4 0.048 13.8 0.54 6 51.83 55.59 53.85 53.76 6.8 0.038 21.0 0.88 7 59.73 60.10 60.85 60.23 13.6 0.167 8.5 1.07 8 47.56 47.63 47.45 47.55 19.8 0.139 14.2 1.70 9 55.13 51.77 51.62 52.84 10.5 0.086 13.5 1.05 10 57.79 57.29 57.25 57.44 11.4 0.122 9.7 0.82
[0146] Mechanical properties were measured by axial pull tests on an MTS Criterion Model 41 universal test frame fitted with a 1 .sup.N load cell (MTS Systems Corporation). Cardstock holders were mounted between two opposing spring-loaded grips, and the supporting edges were carefully cut. Pull tests were conducted at a relative humidity of 30% and temperature of 22° C., with a constant crosshead speed of 10 mm/min. Stress-strain curves were recorded by the MTS TW Elite test suite at a sampling rate of 50 Hz. Fiber breaks were recorded when a 90% drop from peak stress was detected. All mechanical properties were automatically calculated by the MTS TW Elite test suite. Ultimate tensile strength was calculated as the maximum measured load over the initial fiber cross-sectional area (A=πr.sup.2), as determined from measured initial diameters. Modulus was calculated as the slope of a linear least squares fit to the stress/strain data of the initial elastic region. Toughness was calculated as the area under the total stress/strain curve divided by the initial fiber volume (V=πr.sup.2 h) as calculated from measured initial fiber diameters and set initial gage length of 5 mm. For each protein, a total of 10 fibers were measured in this manner.
[0147] Light microscopy. Fiber diameters were measured using images acquired with a Zeiss Axio Observer ZI Inverted Microscope equipped with a phase contrast 20× objective lens and the Axiovision LE software (Zeiss).
[0148] Scanning Electron Microscopy. Following tensile tests, silk fibers were mounted onto a sample holder using conductive tape. The sample holder was sputter coated with a 10 nm gold layer using a Leica EM ACE600 high vacuum sputter coater (Leica Microsystems). Fibers were imaged using a Nova NanoSEM 230 Field Emission Scanning Electron Microscope (Field Electron and Ion Company, FEI) at an accelerating voltage of 7-10 kV.
[0149] Fourier Transform Infrared Spectroscopy. For secondary structure determination, FTIR spectra were acquired with a Thermo Nicolet 470 FT-IR spectrometer (ThermoFisher Scientific) fitted with a Smart Performer ATR accessory with Ge crystal. Spectra were acquired from 1350-1750 cm.sup.−1 at 4 cm.sup.−1 resolution. A total of 254 scans were accumulated for each sample. All recorded spectra were analyzed using Fityk 0.9.8. Baselines were subtracted from all spectra using the built-in Fityk convex hull algorithm. The amide I band (1600-1700 cm.sup.−1) was deconvolved into a set of eleven Lorentzian peaks centered at 1610, 1618.5, 1624.5, 1632.5, 1642, 1651, 1659, 1666.5, 1678, 1690.5, and 1700 cm.sup.−1 corresponding to amide I shifts characteristic of either β-sheet, random coil, α-helix, or β-turn. Specific assignments are listed in Table 15. Peak areas were integrated and percentages were calculated as the component peak area over the sum of all peak areas. Percentages were averaged from measurements of three fibers each for unseeded and seeded polymers.
TABLE-US-00015 TABLE 15 Amide I secondary structure assignments. Wavenumber (cm.sup.-1) Secondary structure 1,605-1,615 Side chains/aggregated strands 1,616-1,621 β-strands/sheets (weak) 1,622-1,627 β-sheets (strong) 1,628-1,637 β-sheets (strong) 1,638-1,646 Random coil 1,647-1,655 Random coil 1,656-1,662 α-helix 1,663-1,670 Turn 1,671-1,685 Turn 1,686-1,695 Turn 1,697-1,703 β-sheets (weak)
Seeded Chain-Growth Polymerization of Proteins in Living Bacterial Cells
[0150] Microbially produced protein-based materials (PBMs) are appealing due to use of renewable feedstock, low energy requirements, tunable side-chain chemistry, and biodegradability. However, high-strength PBMs typically have high molecular weights (HMW) and repetitive sequences that are difficult to microbially produce due to genetic instability and metabolic burden. The development of a biosynthetic strategy is reported herein, termed seeded chain-growth polymerization (SCP) for synthesis of HMW PBMs in living bacterial cells. SCP uses split intein (SI) chemistry to co-translationally polymerize relatively small, genetically stable material protein subunits, effectively preventing intramolecular cyclization. SCP was applied to bioproduction of spider silk in Escherichia coli, generating HMW spider silk proteins (spidroins) up to 300 kDa, resulting in spidroin fibers of high strength, modulus, and toughness. SCP provides a modular strategy to synthesize HMW, repetitive material proteins and may facilitate bioproduction of a variety of high-performance PBMs for broad applications.
[0151] Microbial biopolymers are attractive alternatives to traditional petroleum-based polymers due to use of renewable feedstock and environmentally friendly production/processing. Protein-based materials (PBMs) are especially appealing biopolymers because they can fold into a diversity of structures with versatile functions and properties. Spider silks, for example, can exhibit tensile strength and toughness superior to steel and are used by spiders for prey capture/storage, egg protection, adhesion, and even flight.
[0152] As with organic polymers, mechanical properties of PBMs are typically dependent on the molecular weight (MW) of constituent proteins. In general, higher MW promotes more extensive intermolecular interactions and reduces chain-end density, thereby decreasing probability of chain slippage and fracture and increasing material strength. Consequently, high performance PBMs (e.g. silks, keratin, elastin, suckerin, and mussel foot protein) are often composed of high MW (HMW), repetitive protein sequences or protein complexes, where HMW is critical to mechanical performance.
[0153] Engineered microbial synthesis of HMW PBMs is extremely challenging due primarily to genetic instability of repetitive coding sequences and low translation efficiency of complex mRNA secondary structures. While creative strategies have been developed to enhance microbial production of HMW PBMs (e.g. extensive optimization of codon usage, metabolic engineering of aminoacyl-tRNA supplies, or protein cross-linking and complexation), the core challenge of genetic instability in HMW PBM production remains largely unaddressed.
[0154] To help bypass these challenges, an engineered microbial synthesis termed Seeded Chain-growth Polymerization (SCP) was developed involving co-translational, split intein (SI) catalyzed polymerization of relatively small, genetically stable material proteins in living microbes. While a handful of biochemical tools are available for in vivo post-translational protein cross-linking (e.g. SpyTag-SpyCatcher, Sortase A, disulfide linkage), these tools have been used primarily for one-step reactions, and no method is available for controlled linear polymerization of proteins into HMW polymers in living cells. Alternatively, SIs are well suited for microbial production of HMW PBMs because they allow for in vivo self-cleavage of the catalytic domain from the resulting ligated protein polymer, resulting in linear, backbone peptide bond formation, thereby minimizing modification to the resulting PBM's sequence and structure, which might otherwise negatively affect the resulting material's properties.
[0155] In some embodiments, the present disclosure is directed to a method for synthesizing a spidroin. The method comprises synthesizing a seed protein in vivo in a heterologous host, the seed protein comprising a C-terminus Int.sup.N domain, synthesizing a monomer in vivo in the heterologous host, the monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain, and co-translationally polymerizing the monomer via in vivo split-intein mediated polymerization.
[0156] In some embodiments the heterologous host is a protein-expressing microbial host and/or the monomer is a silk amino acid sequence from a spider species. In some embodiments, the heterologous host is E. coli, and/or the monomer is an N. clavipes spidroin. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa, at least about 400 kDA, at least about 500 kDa, or at least about 600 kDa. In some embodiments the method further comprises spinning the synthesized spidroin into fibers. In some embodiments, the fibers have a tensile strength of from about 150 MPa to about 350 MPa, or from about 170 MPa to about 310 MPa. In some embodiments, the fibers have a modulus of about 3.0 GPa to about 5.5 GPa. In some embodiments, the fibers have a toughness of from about 25 MJ/m.sup.3 to about 150 MJ/m.sup.3, or from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3. In some embodiments, the fibers have a β-sheet content of from about 20% to about 60%, or from about 35% to about 45%. In some embodiments, the fibers have an extensibility of from about 5% to about 35%, or from about 10% to about 25%.
[0157] In some embodiments, a method for synthesizing a spidroin comprises: synthesizing a seed protein in vivo in a heterologous host, the seed protein comprising a C-terminus Int.sup.N domain; synthesizing a monomer in vivo in the heterologous host, the monomer comprising both an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain; and undergoing multiple steps of co-translational ligation of the monomer via in vivo split-intein mediated reaction. In some embodiments, the heterologous host is E. coli, or other protein expressing microbial hosts. In some embodiments, the monomer contains a fragment of silk amino acid sequence from N. clavipes spidroin or other spider species. In some embodiments, the synthesized spidroin is a linear polymer. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa. In some embodiments, the method further comprises spinning the synthesized spidroin into fibers. In some embodiments, the fibers have a tensile strength of from about 170 MPa to about 310 MPa, or at least about 300 MPa. In some embodiments, the fibers have a toughness of from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3, or at least about 100 MJ/m.sup.3.
[0158] In some embodiments, the present disclosure is directed to a system for synthesizing a spidroin in vivo. The system comprises a host cell, a seed cassette encoding a seed protein comprising a C-terminus Int.sup.N domain, and a monomer cassette encoding a monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain.
[0159] In some embodiments the heterologous host is a protein-expressing microbial host and/or the monomer is a silk amino acid sequence from a spider species. In some embodiments, the heterologous host is E. coli, and/or the monomer is an N. clavipes spidroin. In some embodiments, the fibers have a tensile strength of from about 150 MPa to about 350 MPa, or from about 170 MPa to about 310 MPa. In some embodiments, the fibers have a toughness of from about 25 MJ/m.sup.3 to about 150 MJ/m.sup.3, or from about 55 MJ/m.sup.3 to about 105 MJ/m.sup.3. In some embodiments, the fibers have a β-sheet content of from about 20% to about 60%, or from about 35% to about 45%. In some embodiments, the synthesized spidroin has a molecular weight of at least about 300 kDa, at least about 400 kDA, at least about 500 kDa, or at least about 600 kDa. In some embodiments, the fibers have an extensibility of from about 5% to about 35%, or from about 10% to about 25%.
[0160] In some embodiments, a system for synthesizing a spidroin in vivo comprises: a host cell; a seed cassette encoding a seed protein comprising a C-terminus Int.sup.N domain; and a monomer cassette encoding a monomer comprising an N-terminus Int.sup.C domain and a C-terminus Int.sup.N domain. In some embodiments, the host cell is E. coli, or other protein expressing microbial hosts. In some embodiments, the monomer contains a fragment of silk amino acid sequence from N. clavipes spidroin or other spider species.
[0161] Results and Discussion
[0162] SI-based polymerization of dragline spider silk proteins in E. coli. Initially, production of HMW repetitive material proteins in E. coli was demonstrated via unseeded SI-based polymerization of dragline spider silk proteins (spidroins). As a proof of concept, a 27.5 kDa “monomer” containing 10 repeats of a Nephila clavipes MaSp1 dragline spidroin consensus sequence with a histidine tag was employed for protein detection and purification. The sequence was genetically optimized for efficient expression in E. coli and flanked by a pair of complementary, fast reacting gp41-1 SIs in the form of Int.sup.C-monomer-Int.sup.N (see
[0163]
[0164] As described herein above,
[0165] This “monomer cassette” was placed under the control of an IPTG-inducible P.sub.LacO1 promoter and induced for expression during exponential growth. Anti-His-Tag western blotting was used to analyze products, which revealed primarily low MW oligomers (see
[0166] As described above,
[0167] These products ran slightly faster than expected for linear products, suggesting the formation of cyclic proteins instead of linear HMW products. SI-catalyzed protein cyclization has been reported, with products migrating faster than linear proteins on SDS-PAGE. Intramolecular cyclization is preferred over intermolecular ligation if monomer structural flexibility permits N- and C-termini to reach reactive proximity. In the case of the N. clavipes MaSp1 dragline spidroin, its observed intrinsically disordered structure may promote cyclization over linear polymerization.
[0168] Development of SCP for production of HMW linear dragline spidroins in E. coli. To prevent cyclization and shift production toward HMW linear spidroins, SCP was devised to mimic chain-growth polymerization reactions commonly employed in organic polymer synthesis by first inducing a “seed protein,” which contains only one reactive Int.sup.N domain fused at the C-terminus of the seed (
[0169] Optimization of SCP. To optimize SCP reaction conditions in E. coli, cells were induced with a range of anhydrotetracycline (ATc) concentrations (50-175 nM) for seed synthesis followed by the addition of 1 mM IPTG to induce monomer cassette (
[0170]
[0171] As described above,
[0172]
[0173]
[0174] MW distribution of spidroins produced via SCP. Further MW analysis of purified SCP products suggested a mass-average MW (MW) of 147±6 kDa and a poly dispersity index (PDI) of 1.5, while the purified unseeded polymerization products exhibit Mw of only 52±4 kDa and a PDI of 1.3 (
[0175] To better understand the kinetic process and gain insight into the factors that affect product distribution, a simple kinetic model of SCP was constructed. The model assumes a constant second order ligation rate constant (k) based on reported experimental measurement of in vitro ligation rate between IntN.sup.Gp1 and IntC.sup.Gp1. The model also considers time-dependent cell growth rate (μ) and monomer production rate (r), which were estimated from experimental measurement of cell growth and GFP production. The model neglects effects of protein aggregation, formation of inclusion bodies, cyclic products from SI side reactions, and metabolic burden from silk synthesis.
TABLE-US-00016 TABLE 16 Parameter definitions. Parameter Definition Value Source k Second order ligation 1.45 × 10.sup.8M.sup.-1h.sup.-1 Carvajal-Vallejos rate constant et al. S.sub.0 Initial seed low - 1 μM — concentration medium - 100 μM high - 1000 μM S(t) Time dependent seed Determined by — concentration equation 1 M.sub.1(t) Time dependent Determined by — monomer equation 2 concentration SM.sub.i(t) Time dependent Determined by — polymer concentration equation 3 of -mer length.sub.i
[0176] The model considers a seed protein (S) of initial concentration (S.sub.0) which is consumed and diluted as cells divide:
[0177] Monomer (M.sub.1) is constantly synthesized, consumed to form polymers (SM.sub.i), and diluted as cells divide:
where μ is specific cell growth rate, r is monomer synthesis rate, k is the second order ligation rate constant, and SM.sub.i is the concentration of polymer containing N-terminal seed and i copies of monomer. Polymer production is calculated by considering each species' generation, consumption, and dilution. Polymers with molecular weights up to 626 kDa (Seed+30mer) were considered:
[0178] Polymer distributions at relatively low, medium, and high seed induction levels were simulated and the results are shown in
[0179] Confirmation of elimination of cyclic byproducts by SCP. To confirm the observed polymerization products are in fact cyclic or linear, a cysteine-specific fluorescent labeling reaction was employed. Neither the NTD nor silk monomer contain cysteine residues, while the Int.sup.N sequence contains three cysteines. Because all linear products contain an unreacted C-terminal Int.sup.N, the linear products are fluorescently labeled at their cysteine sidechains, while cyclic products, which no longer contain SIs, are not. To label the polymerization products, overexpressed proteins were purified by nickel-affinity chromatography and reacted with a maleimide-Cy5 dye that specifically reacts with the thiol group of cysteine. Subsequent fluorescence imaging of products resolved by SDS-PAGE revealed that linear products were formed only when SCP was employed, while unseeded polymerization produced cyclic products that exhibited no detectable fluorescent labeling (
[0180] Mechanical properties of wet-spun fibers from seeded spidroins. To demonstrate the practical value of producing HMW linear spidroins via SCP, polymerized protein products were purified from E. coli native proteins using nickel-affinity and ion-exchange chromatography. The purified HMW spidroins were then lyophilized, dissolved in hexafluoroisopropanol (HFIP), and spun into fibers following standard methods (see methods). In brief, lyophilized powder was dissolved in HFIP to 20% w/v and extruded into a methanol bath. After post-spin draw, fibers were mounted to test frames and tensile tests were used to evaluate the mechanical performance of these fibers. While fibers from the unseeded, cyclic spidroins displayed very weak mechanical performance, fibers from the SCP-produced spidroins displayed greatly enhanced fiber strength (245±63 MPa), modulus (4.1±1.1 GPa), and toughness (80±20 MJ/m.sup.3), representing 24-, 41-, and 89-fold enhancements compared to those from unseeded spidroins, respectively (
[0181] As described above,
[0182] Additionally, fibers produced from unseeded polymers were quite brittle, typically fracturing at approximately 10% elongation, while fibers produced from SCP exhibited substantial extensibility, with typical breaking strains>30%. The observed enhancements in mechanical properties are likely the result of the drastically increased MW of SCP products. Indeed, a positive correlation between MW and strength/modulus of dragline spidroin fibers is well documented. It is also worth noting that the linear polymers produced herein contain a 6× histidine tag in each monomer unit and an Int.sup.N sequence at their C-termini. Despite the presence of these sequences, high strength, modulus, and toughness are still obtained. These results clearly demonstrate the value of SCP as a strategy to biosynthesize HMW, highly repetitive spidroins from relatively small, genetically stable sequences in a one-step fermentation process.
[0183] Structural analysis of fibers produced from seeded polymers. To further elucidate the benefits of employing SCP, structural differences were next examined between fibers produced by the two polymerization methods using Fourier-transform infrared spectroscopy (FT-IR) and scanning electron microscopy (SEM). Interestingly, comparison of FT-IR spectra of fibers spun from seeded and unseeded polymers suggests relatively little difference in secondary structure. Deconvolutions of the amide I band suggest both fibers consist of roughly 25-30% β-sheet secondary structure, which is typical of both natural and synthetic dragline spidroins (
[0184] As described above,
[0185] These results suggest that neither MW nor cyclization of dragline spidroin polymers substantially affect β-sheet formation during the wet-spinning process and that differences in β-sheet content are not the main factor contributing to the observed mechanical differences of the synthetic fibers.
[0186] Meanwhile, comparison of SEM micrographs of the fibers produced by the two methods revealed marked differences in microscale morphology, with fibers produced from unseeded polymers exhibiting relatively smooth, flat fracture surfaces, while fibers produced from seeded polymers exhibit a noticeably rougher, more uneven fracture surface (
[0187] Taken together, herein is described a strategy to perform protein polymerization in living bacterial cells and demonstrates the production of linear spidroin polymers with MW up to at least 326 kDa—roughly the size of the largest natural dragline spidroins. SCP allows multiple rounds of SI-catalyzed ligation reactions in a single microbial culture, significantly reducing the number of steps that in vitro ligation would otherwise require to obtain products with similar MW and thus greatly decreasing process complexity and increasing potential scalability of fiber production. Furthermore, SCP permits production of highly repetitive proteins from much smaller, more genetically stable and easily expressed subunits, which facilitates practical production of high performance PBMs for industrial applications. In the case of spidroin, although SCP yields a mixture of product MW and the monomer sequence contains a 6× histidine tag that may affect fiber properties, fibers spun from this mixture nonetheless exhibited high strength, modulus, and toughness. Continued optimization of SCP parameters such as monomer sequence and size, SI reaction rate, culture temperature, and induction timing may permit production of spidroins of even higher MW, yield, and mechanical performance. Lastly, the modularity of SCP makes it possible to be applied to numerous other highly repetitive HMW PBMs, further advancing PBM production for materials applications.
[0188] Materials and Methods
[0189] Strains and growth conditions. For plasmid cloning and protein production, E. coli NEB 10-beta (NEB10β) was used. Strains were cultured in Terrific Broth (TB) containing 24 g/L yeast extract, 20 g/L tryptone, 0.4% v/v glycerol, 17 mM KH2PO4, and 72 mM K2HPO4 at 37° C. with appropriate antibiotics (50 μg/mL kanamycin and/or 30 μg/mL chloramphenicol).
[0190] Chemicals and reagents. Unless otherwise noted, reagents were obtained from MilliporeSigma. Plasmid purification and gel extraction kits were obtained from iNtRON Biotechnology. FastDigest restriction enzymes and T4 DNA ligase were purchased from Thermo Fisher Scientific and used for all digestions and ligations following the manufacturer's suggested protocols.
[0191] Genetic assembly of monomer and seed cassettes. To construct the 10× and 7× monomer cassettes, 10 or 7 repeats of the N. clavipes MaSp1 dragline spidroin (Table 17) were computationally designed, flanked at the 5′ end by KpnI and at the 3′ end by Kpn2I, and sequence optimized as described herein elsewhere. Optimized sequences were chemically synthesized by Integrated DNA Technologies. The synthesized sequences were separately inserted between KpnI and Kpn2I restriction sites of a medium copy (pBBR1 replication origin), chloramphenicol resistance (Cm.sup.R) SI-Bricks expression vector containing optimized gp41-1 SI coding sequences (Table 17), resulting in plasmids pB6c-Int.sup.C-10×-Int.sup.N (p10×) and pB6c-Int.sup.C-7×-Int.sup.N (p7×) (Table 18).
TABLE-US-00017 TABLE 17 Amino acid sequences and estimated charges at pH 8 of proteins. Estimated Charge at Name Sequence pH 8 Gp41-1 Int.sup.C MAKTKMLKKILKIEELDERELIDIEVSGNHLFYANDILTHN −2.5 (SEQ NO ID: 10) Gp41-1 Int.sup.N CLDLKTQVQTPQGMKEISNIQVGDLVLSNTGYNEVLNVFPK −3.3 SKKKSYKITLEDGKEIICSEEHLFPTQTGEMNISGGLKEGMC LYVKE* (SEQ NO ID: 11) 10x MaSp1 SSSDVGTHHHHHHAAAAAGGAGQGGYGGLGSQGAGRGGL 8.6 Monomer GGQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQGAG AAAAAGGAGQGGYGGLGSQGAGRGGLGGQGAGAAAAAG GAGQGGYGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGG YGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGGYGGLGS QGAGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGAGRG GLGGQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQG AGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQGAGAAAA ASGTRSGY (SEQ NO ID: 12) 7x MaSp1 SSSDVGTHHHHHHGGGGSAGRGGLGGQGAGAAAAAGGAG 6.6 Monomer QGGYGGLGSQGAGRGGLGGQGAGAAAAAGGAGQGGYGG LGSQGAGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGA GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLG GQGAGAAAAAGGAGQGGYGGLGSQGAGRGGLGGQGAGA AAAAGGAGQGGYGGLGSQGAGRGGLGGQGAGAAAAAGG AGQGGYGGLGSQGSGTRSGY (SEQ NO ID: 13) NTD MAKTKQNTPWSSTELADAFINAFMNEAGRTGAFTADQLDD −2.6 MSTIGDTIKTAMDKMARSNKSSKGKLQALNMAFASSMAEI AAVEQGGLSVDAKTNAIADSLNSAFYQTTGAANPQFVNEIR SLINMFAQSSANEVSYGGSGTRSGY (SEQ NO ID: 14)
TABLE-US-00018 TABLE 18 Plasmids. Plasmid Plasmid Name ORI Promoter Resistance Gene Source pB6c pBBR1 P.sub.LlacO1 Cm.sup.R — Lee et al. 2011 pA2k p15A P.sub.tet Kan.sup.R — Lee et al. 2011 p10x pBBR1 P.sub.LlacO1 Cm.sup.R SI-flanked 10-mer Present N. clavipes study dragline spidroin p7x pBBR1 P.sub.LlacO1 Cm.sup.R SI-flanked 7-mer Present N. clavipes study dragline spidroin pNTD p15A P.sub.tet Kan.sup.R Native N. clavipes Present N-terminal study domain + gp41-1.sup.N
[0192] To construct the seed cassette, the amino acid sequence of the NTD of N. clavipes dragline spidroin MaSp1 was computationally redesigned for E. coli expression and chemically synthesized by Integrated DNA Technologies. The seed sequence was inserted between restriction sites Bg1II/Kpn2I of a medium copy (p15A replication origin), kanamycin resistance (Kan.sup.R) SI-Bricks expression vector containing optimized gp41-1 Int.sup.N, resulting in plasmid pA2k-NTD-Int.sup.N (pNTD) (Table 18).
[0193] SCP optimization. For SCP optimization, cultures were grown in 50 mL volumes of TB medium in 250 mL shake flasks with orbital shaking. Cultures were initially incubated at 37° C. until reaching an OD.sub.600=2.0. Cultures were then induced with a range of concentrations of ATc and incubated at 30° C. After 1 h, monomer production was induced by addition of 1 mM IPTG, and cultures were incubated at 30° C. for varied time periods.
[0194] Shake flask cultures. Protein production was performed in 2 L shake flasks. Transformants were cultured overnight in 50 mL TB medium at 37° C. on an orbital shaker. Overnight 50 mL cultures were then used to inoculate 500 mL fresh TB medium in 2 L Erlenmeyer flasks at an initial OD.sub.600=0.08. Cultures were grown at 37° C. with orbital shaking to OD.sub.600=2. In the case of unseeded polymer production, cultures were induced by addition of 1 mM IPTG and cultured for an additional 6 h at 30° C. with orbital shaking. In the case of SCP, seed production was first induced by addition of 125 nM ATc and cultured for 1 h at 30° C., followed by monomer induction with 1 mM IPTG and continued culturing for an additional 6 h at 30° C.
[0195] Protein purification. Cell pellets were directly solubilized in lysis buffer (8 M urea, 20 mM potassium phosphate, 10 mM imidazole, pH 7.4). The mixture was stirred overnight at 22° C. and centrifuged at 25,000×g for 20 min. The pellet was discarded, and the supernatant was sonicated for a total of 10 min (70% amplitude, 5 s on, 10 s off). The sonicated supernatant was then centrifuged at 40,000×g for 30 min. The pellet was discarded, and the supernatant was filtered through a 0.2 μm filter. The filtered solution was applied to a 5 mL His-Trap column at a flow rate of 1 mL/min. The column was then washed with 5 CV of wash buffer (lysis buffer+50 mM imidazole), followed by elution with 5 CV of elution buffer (lysis buffer+300 mM imidazole). Eluent was then dialyzed against cation exchange (IEX) binding buffer (8 M urea, 10 mM HEPES, pH 8.0) in 10K MWCO SnakeSkin dialysis tubing (ThermoFisher Scientific). The dialyzed eluent was loaded onto a 5 mL HiTrap SPFF cation exchange column at a flow rate of 1 mL/min. The column was then washed with 5 CV of IEX wash buffer (binding buffer+40 mM guanidinium hydrochloride). Bound proteins were eluted with 5 CV IEX elution buffer (binding buffer+200 mM guanidinium hydrochloride). IEX eluent was then dialyzed extensively against 5% acetic acid at 4° C. in 10K MWCO SnakeSkin dialysis tubing and lyophilized.
[0196] SDS-PAGE. All SDS-PAGE gels were 1 mm thick, discontinuous with 3% stacking gel, and hand cast at the indicated percentages. Samples were prepared at 1 mg/mL or 5 μM total protein in Laemmli sample buffer (2% SDS, 10% glycerol, 60 mM Tris pH 6.8, 0.01% bromophenol blue, 100 μM DTT). Gels were run on Mini-PROTEAN Tetra Cells (Bio-Rad) in 1× Tris-glycine SDS buffer (25 mM Tris base, 250 mM glycine, 0.1% w/v SDS) until just before the dye front exited the gel. Gels were stained in Coomassie Blue solution (50% methanol, 10% w/v acetic acid, 1 g/L Coomassie Brilliant Blue) for a minimum of 1 h at room temperature with gentle agitation and destained in Coomassie Blue destain buffer (40% v/v methanol, 10% v/v acetic acid) for a minimum of 1 h. Gels were imaged on an Azure c600 Imager (Azure Biosystems).
[0197] Western blotting. Western blotting was performed with an OWL HEP-3 semi-dry electroblotting system (Thermo Scientific). SDS-PAGE gels, blotting paper (10 cm thickness, Bio-Rad), and blotting membrane (PVDF, 0.2 μm pore size, Roche) were soaked for 15 minutes in semi-dry transfer buffer (1× Tris-glycine SDS buffer+20% methanol). Soaking blot sandwiches were stacked onto the OWL system, and proteins were transferred at 20 mA constant current for 1 h. Blots were then washed briefly in 1× TBS Tween (50 mM Tris-Cl pH 7.6, 150 mM NaCl, 0.1% Tween 20) and then blocked in 1× TBS Tween+5% dried milk powder for 2 h with gentle rocking at room temperature. Blots were then soaked overnight at 4° C. with gentle rocking in 1× TBS Tween+2% dried milk and 1:5000 dilution of mouse anti-H.sub.6 monoclonal antibody (ThermoFisher). Blots were washed 4 times in 1× TBS Tween and then incubated for 45 min with gentle rocking at room temperature in 1× TBS-Tween+2% dried milk and 1:10000 dilution of goat anti-mouse AzureSpectra 700 antibody (Azure Biosystems). Finally, blots were washed 4 times in 1× TBS-Tween and imaged on an Azure c600 Imager (Azure Biosystems) using the IR700 imaging channel.
[0198] Fluorescence labelling. After purification by His-Trap affinity chromatography, purified products were dialyzed against 8 M urea, 10 mM HEPES, 100 μM TCEP, pH 7.4, at a final protein concentration of approximately 10 μM. Sulfo-Cyanine5 (Lumiprobe Life science solutions) was pre-dissolved in DMSO at a concentration of 100 mM and then added to the protein solution to a final concentration of 200 μM. The reaction mixture was incubated overnight at 4° C. in dark with periodic mixing. After overnight incubation, the reaction was mixed 1:1 with 2×Laemmli sample buffer, run on an SDS-PAGE, and imaged with an Azure c600 Imager (Azure Biosystems) using the Cy5 channel.
[0199] Densitometry analysis and calculation of M.sub.w, M.sub.n, and PDI. Coomassie stained SDSPAGE gels of polymerization products after ion exchange purification were imaged on an Azure c600 Imager (Azure Biosystems). All quantifications were performed in triplicate. All densitometry analysis was performed with the AzureSpot Analysis Software (Azure Biosystems). Images were background subtracted with a built-in automatic lane edge subtraction algorithm. Protein band intensities were integrated by the AzureSpot software, and apparent MWs were calculated based on MW standards run on the same gels. Integrated band intensities were normalized against the highest band intensity in a given MW distribution. Averages of three normalized integrated band intensities along with the standard deviation of the three normalized values were plotted against MW. Number-average MW (M.sub.n) was calculated as Mn=ΣM.sub.i.sup.N.sub.i/Σ, where ΣM.sub.i.sup.N.sub.i, is treated as the sum of each species' MW (M.sub.i) multiplied by its integrated band intensity (N.sub.i), and ΣN.sub.i is the sum of all band intensities. Weight-average MW (M.sub.w) was calculated as M.sub.w=Σw.sub.iM.sub.i, where w.sub.i is the weight fraction of each species calculated as the total weight of a species (M.sub.i.sup.N.sub.i) divided by the total weight of all species (ΣM.sub.i.sup.N.sub.i). Lastly, PDI was calculated as the ratio of M.sub.w to M.sub.n.
[0200] Fiber spinning and mechanical testing. Fiber spinning and mechanical testing were performed following a protocol modified from known methods. Specifically, lyophilized spidroin powders were dissolved in HFIP to 20% w/v. This protein dope was loaded to a 100 μL Hamilton gastight syringe (Hamilton Robotics). The syringe was fitted to a Harvard Apparatus Pump 11 Elite syringe pump (Harvard Apparatus), and the dope was extruded into a 95% v/v methanol bath at 5 μL/min. Extruded fibers were then transferred to a 75% v/v methanol bath and carefully extended at approximately 1 cm/s to the maximum draw ratio without fiber fracture. Extended fibers were removed from the bath and held under tension until visibly dry. Segments of post-drawn fibers (20 mm) were carefully laid exactly vertical across a 5 mm (vertical)×15 mm (horizontal) opening cut into a 20 mm×20 mm piece of cardstock and fixed with adhesive tape at both ends of the opening. Diameters of mounted fibers were then measured by light microscopy, averaging measurements at three points along the fiber axis (see Table 13 and Table 14).
[0201] Mechanical properties were measured by axial pull tests on an MTS Criterion Model 41 universal test frame fitted with a 1 .sup.N load cell (MTS Systems Corporation). Cardstock holders were mounted between two opposing spring-loaded grips, and the supporting edges were carefully cut. Pull tests were conducted at a relative humidity of 30% and temperature of 22° C., with a constant crosshead speed of 10 mm/min. Stress-strain curves were recorded by the MTS TW Elite test suite at a sampling rate of 50 Hz. Fiber breaks were recorded when a 90% drop from peak stress was detected. All mechanical properties were automatically calculated by the MTS TW Elite test suite. Ultimate tensile strength was calculated as the maximum measured load over the initial fiber cross-sectional area (A=πr.sup.2), as determined from measured initial diameters. Modulus was calculated as the slope of a linear least squares fit to the stress/strain data of the initial elastic region. Toughness was calculated as the area under the total stress/strain curve divided by the initial fiber volume (V=πr.sup.2 h) as calculated from measured initial fiber diameters and set initial gage length of 5 mm. For each protein, a total of 10 fibers were measured in this manner.
[0202] Light microscopy. Fiber diameters were measured using images acquired with a Zeiss Axio Observer ZI Inverted Microscope equipped with a phase contrast 20× objective lens and the Axiovision LE software (Zeiss).
[0203] Scanning Electron Microscopy. Following tensile tests, silk fibers were mounted onto a sample holder using conductive tape. The sample holder was sputter coated with a 10 nm gold layer using a Leica EM ACE600 high vacuum sputter coater (Leica Microsystems). Fibers were imaged using a Nova NanoSEM 230 Field Emission Scanning Electron Microscope (Field Electron and Ion Company, FEI) at an accelerating voltage of 7-10 kV.
[0204] Fourier Transform Infrared Spectroscopy. For secondary structure determination, FTIR spectra were acquired with a Thermo Nicolet 470 FT-IR spectrometer (ThermoFisher Scientific) fitted with a Smart Performer ATR accessory with Ge crystal. Spectra were acquired from 1350-1750 cm.sup.−1 at 4 cm.sup.−1 resolution. A total of 254 scans were accumulated for each sample. All recorded spectra were analyzed using Fityk 0.9.8. Baselines were subtracted from all spectra using the built-in Fityk convex hull algorithm. The amide I band (1600-1700 cm.sup.−1) was deconvolved into a set of eleven Lorentzian peaks centered at 1610, 1618.5, 1624.5, 1632.5, 1642, 1651, 1659, 1666.5, 1678, 1690.5, and 1700 cm.sup.−1, corresponding to amide I shifts characteristic of either β-sheet, random coil, α-helix, or β-turn. Specific assignments are listed in Table 15. Peak areas were integrated, and component percentages were calculated as the component peak area over the sum of all peak areas. Percentages were averaged from measurements of three fibers each for unseeded and seeded polymers.
[0205] Abbreviations
[0206] PBMs: protein-based materials, MW: molecular weight, HMW: high molecular weight, SI: split intein, N. clavipes: Nephila clavipes, E. coli: Escherichia coli, IPTG: Isopropyl β-D-1-thiogalactopyranoside, SCP: seeded chain-growth polymerization, NTD: N. clavipes .sup.N-terminal domain, ATc: anhydrotetracycline, SDS-PAGE: sodium dodecyl sulfate-polyacrylamide gel electrophoresis, HFIP: hexafluoroisopropanol, Mn: number average molecular weight, Mw: weight average molecular weight, PDI: poly dispersity index, SEM: scanning electron microscopy, FT-IR: Fourier transform infrared spectroscopy, M.sub.e: entanglement molecular weight, M.sub.e: critical MW for onset of entanglements.
[0207] Definitions and methods described herein are provided to better define the present disclosure and to guide those of ordinary skill in the art in the practice of the present disclosure. Unless otherwise noted, terms are to be understood according to conventional usage by those of ordinary skill in the relevant art.
[0208] In some embodiments, numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth, used to describe and claim certain embodiments of the present disclosure are to be understood as being modified in some instances by the term “about.” In some embodiments, the term “about” is used to indicate that a value includes the standard deviation of the mean for the device or method being employed to determine the value. In some embodiments, the numerical parameters set forth in the written description and attached claims are approximations that vary depending upon the desired properties sought to be obtained by a particular embodiment. In some embodiments, the numerical parameters are be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of some embodiments of the present disclosure are approximations, the numerical values set forth in the specific examples are reported as precisely as practicable. The numerical values presented in some embodiments of the present disclosure may contain certain errors necessarily resulting from the standard deviation found in their respective testing measurements. The recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein.
[0209] In some embodiments, the terms “a” and “an” and “the” and similar references used in the context of describing a particular embodiment (especially in the context of certain of the following claims) are construed to cover both the singular and the plural, unless specifically noted otherwise. In some embodiments, the term “or” as used herein, including the claims, is used to mean “and/or” unless explicitly indicated to refer to alternatives only or to refer to the alternatives that are mutually exclusive.
[0210] The terms “comprise,” “have” and “include” are open-ended linking verbs. Any forms or tenses of one or more of these verbs, such as “comprises,” “comprising,” “has,” “having,” “includes” and “including,” are also open-ended. For example, any method that “comprises,” “has” or “includes” one or more steps is not limited to possessing only those one or more steps and may also cover other unlisted steps. Similarly, any composition or device that “comprises,” “has” or “includes” one or more features is not limited to possessing only those one or more features and may cover other unlisted features.
[0211] All methods described herein are performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. “such as”) provided with respect to certain embodiments herein is intended merely to better illuminate the present disclosure and does not pose a limitation on the scope of the present disclosure otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the present disclosure.
[0212] Groupings of alternative elements or embodiments of the present disclosure disclosed herein are not to be construed as limitations. Each group member is referred to and claimed individually or in any combination with other members of the group or other elements found herein. One or more members of a group are included in, or deleted from, a group for reasons of convenience or patentability. When any such inclusion or deletion occurs, the specification is herein deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.
[0213] To facilitate the understanding of the embodiments described herein, a number of terms are defined below. The terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present disclosure. Terms such as “a,” “an,” and “the” are not intended to refer to only a singular entity, but rather include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the disclosure, but their usage does not delimit the disclosure, except as outlined in the claims.
[0214] All of the compositions and/or methods disclosed and claimed herein may be made and/or executed without undue experimentation in light of the present disclosure. While the compositions and methods of this disclosure have been described in terms of the embodiments included herein, it will be apparent to those of ordinary skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit, and scope of the disclosure. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope, and concept of the disclosure as defined by the appended claims.
[0215] This written description uses examples to disclose the disclosure, including the best mode, and also to enable any person skilled in the art to practice the disclosure, including making and using any devices or systems and performing any incorporated methods. The patentable scope of the disclosure is defined by the claims, and may include other examples that occur to those skilled in the art. Such other examples are intended to be within the scope of the claims if they have structural elements that do not differ from the literal language of the claims, or if they include equivalent structural elements with insubstantial differences from the literal language of the claims.