PLASMA EXCHANGE REMOVAL OF SPD-L1
20230310499 · 2023-10-05
Inventors
- Jacob J. Orme (Rochester, MN, US)
- Aaron S. Mansfield (Rochester, MN, US)
- Roxana S. Dronca (Rochester, MN, US)
- Haidong Dong (Rochester, MN, US)
- Jeffrey L. Winters (Rochester, MN, US)
Cpc classification
A61K39/3955
HUMAN NECESSITIES
G01N33/57484
PHYSICS
C07K2317/76
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/395
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Materials and methods for improving immunotherapy are provided herein. In some cases, the materials and methods can be used in the treatment of cancers.
Claims
1. A method comprising: (a) performing therapeutic plasma exchange (TPE) on a mammal identified as (i) having cancer and (ii) having a measured level of one or more markers in a biological sample that is equal to or higher than a threshold level, and subsequently (b) administering an immunotherapy to the mammal.
2. The method of claim 1, wherein said one or more markers comprises soluble PD-L1 (sPD-L1) or extracellular vesicle PD-L1 (evPD-L1).
3. The method of claim 2, wherein said one or more markers comprises sPD-L1, and wherein said threshold level is from 0.27 ng/mL to 1.75 ng/mL sPDL1.
4. The method of claim 2, wherein said one or more markers comprises sPD-L1, and wherein said threshold level is from 5 ng/mL to 10 ng/mL sPDL1.
5. (canceled)
6. The method of claim 1, wherein said one or more markers comprises extracellular vesicles (EVs).
7. The method of claim 1, wherein said measuring comprises performing an enzyme linked immunosorbent assay (ELISA) or performing nanoflow cytometry.
8. (canceled)
9. The method of claim 1, wherein said immunotherapy comprises an anti-PD-1 antibody or anti-PD-L1 antibody.
10. The method of claim 1, wherein said mammal is a human.
11. The method of claim 1, wherein said cancer is melanoma, renal cell carcinoma, mesothelioma, squamous cell cancer, a hematological cancer, neurological cancer, breast cancer, head and neck cancer, gastrointestinal cancer, liver cancer, pancreatic cancer, genitourinary cancer, bone cancer, bladder cancer, or vascular cancer.
12. A method for treating a mammal identified as having cancer, said method comprising: (a) measuring the level of one or more markers in a biological sample obtained from said mammal, (b) comparing said measured level of said one or more markers to a threshold level, (c) when the measured level is equal to or greater than said threshold level, performing TPE on the mammal, and subsequently (d) administering an immunotherapy to the mammal.
13. The method of claim 12, wherein said one or more markers comprises sPD-L1 or evPD-L1.
14. The method of claim 13, wherein said one or more markers comprises sPD-L1, and wherein said threshold level is from 0.27 ng/mL to 1.75 ng/mL sPDL1.
15. The method of claim 13, wherein said one or more markers comprises sPD-L1, and wherein said threshold level is from 5 ng/mL to 10 ng/mL sPDL1.
16. (canceled)
17. The method of claim 12, wherein said one or more markers comprises EVs.
18. The method of claim 12, wherein said measuring comprises performing an ELISA or performing nanoflow cytometry.
19. (canceled)
20. The method of claim 12, wherein said immunotherapy comprises an anti-PD-1 or anti-PD-L1 antibody.
21. The method of claim 12, wherein said mammal is a human.
22. The method of claim 12, wherein said cancer is melanoma, renal cell carcinoma, mesothelioma, squamous cell cancer, a hematological cancer, neurological cancer, breast cancer, head and neck cancer, gastrointestinal cancer, liver cancer, pancreatic cancer, genitourinary cancer, bone cancer, bladder cancer, or vascular cancer.
23. A method for treating a mammal identified as having a cancer that is resistant to immunotherapy, wherein the method comprises performing TPE on said mammal and administering an immunotherapy to said mammal.
24. The method of claim 23, wherein said mammal was identified as having a cancer resistant to immunotherapy by measuring the level of one or more immunosuppressive components in a biological sample obtained from said mammal, and determining that said level is equal to or higher than a given cutoff level.
25. The method of claim 23, wherein said one or more immunosuppressive components comprise one or more of sPD-L1, evPD-L1, and evADAM10.
26. The method of claim 23, wherein said mammal is a human.
Description
DESCRIPTION OF DRAWINGS
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION
[0027] This document provides materials and methods for treating mammals (e.g., human patients) that have cancer and are resistant to immunotherapy. For example, the methods provided herein can be used to treat cancer patients who are “PD-1 resistant” (also referred to as “anti-PD-1 antibody resistant” and “anti-PD-1 non-responder”) in that they do not respond, or have a reduced response, to treatments targeted to PD-1 (e.g., anti-PD-1 antibodies) due to, for example, interference from sPD-L1. The methods provided herein also can be used to treat cancer patients who are “PD-L1 resistant” (also referred to as “anti-PD-L1 antibody resistant” and “anti-PD-L1 non-responder”) in that they do not respond, or have a reduced response, to treatments targeted to PD-L1 (e.g., anti-PD-L1 antibodies) due to, for example, interference from sPD-L1.
[0028] As noted above, increased levels of extracellular PD-L1 (e.g., sPD-L1 and evPD-L1) can reduce the effectiveness of immunotherapy.
[0029] A representative full length amino acid sequence for human PD-L1 is set forth in SEQ ID NO:1:
TABLE-US-00001 MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVE KQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLG NAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVD PVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTS TLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILG AILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET (SEQ ID NO:1)
[0030] The methods provided herein can be used to reduce the level of extracellular PD-L1, thus boosting the effectiveness of immunotherapies. In general, the methods provided herein include the use of TPE to reduce circulating extracellular PD-L1 in mammals identified as having cancer. In some cases, the mammal(s) can be identified as having reduced anti-tumor immunity based on the presence of a substrate (e.g., a PD-L1-related marker such as sPD-L1 or evPD-L1) at a level that is above or below (e.g., equal to or above) a predetermined threshold. The methods provided herein also can include administering immunotherapy to one or more mammals identified as having cancer and as having reduced anti-tumor immunity based on the presence of a substrate (e.g., a PD-L1-related marker such as sPD-L1 or evPD-L1) at a level that is above or below (e.g., equal to or above) a predetermined threshold, where the mammal(s) is/are subjected to TPE before administration of the immunotherapy.
[0031] The methods described herein can be used for treatment of any appropriate mammal (e.g., a human, non-human primate, horse, cow, pig, sheep, goat, cat, rabbit, guinea pig, hamster, rat, gerbil, or mouse) identified as being in need thereof. For example, a mammal can be identified as having a cancer (e.g., a tumor, malignancy, or otherwise abnormally proliferating cells). In some cases, the methods described herein can be used to treat mammals having a cancer in which the level of a PD-L1-related marker (e.g., sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain) is elevated. Cancers that may have elevated levels of one or more PD-L1 markers and can therefore be treated using the methods described herein include, without limitation, melanoma (e.g., metastatic melanoma), renal cancer, lung cancer (e.g., non-small cell lung cancer; NSCLC), mesothelioma, squamous cell cancer, a hematological cancer (e.g., leukemia or lymphoma, such as Hodgkin’s lymphoma), neurological cancer, breast cancer, prostate cancer, head and neck cancer, gastrointestinal cancer, liver cancer, pancreatic cancer, genitourinary cancer, bone cancer, bladder cancer, and vascular cancer.
[0032] A cancer that is resistant to immunotherapy in a subject (e.g., a mammal) may not respond to checkpoint inhibitors (e.g., inhibitors of PD-1/PD-L1 interactions) in an effective manner. In the methods provided herein, the subject in need of treatment can be a mammal identified as having an anti-PD-1 resistant or anti-PD-L1 resistant malignancy; in some cases, the methods provided herein can include identifying a subject as having an anti-PD-1 resistant or anti-PD-L1 resistant cancer. In some cases, the methods provided herein can include identifying a subject as having an immune system that is in some way unable to respond to anti-PD-1 or anti-PD-L1 treatment. A subject in need of the methods provided herein can be identified based on, for example, detection of sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain in a biological fluid sample (e.g., blood, plasma, serum, or urine), measurement of an elevated level of sPD-L1 evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain in a biological fluid sample, or a combination of methods that include assessing the presence or level of sPD-L1. Having the ability to identify mammals as having a tumor and/or immune system that is resistant to treatment with inhibitors of PD-1/PD-L1 interactions can allow those mammals to be properly identified and treated in an effective and reliable manner. For example, the treatments provided herein in which TPE is combined with immunotherapy can be used to treat patients identified as having a tumor resistant to inhibitors of PD-1/PD-L1 interactions. Thus, the methods provided herein can be used to determine which patients are more likely to benefit from checkpoint inhibitor treatment alone, and which patients are more likely to require additional treatment to reduce sPD-L1 levels or availability, in addition to treatment with a checkpoint inhibitor.
[0033] An elevated level of a substrate (e.g., a PD-L1 related marker, such as sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain) is any level that is greater than a corresponding reference level (also referred to herein as a threshold or “cutoff” level) for the substrate. An elevated level of sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain can be, for example, 3 to 5% greater, 5 to 10% greater, 10 to 20% greater, 20 to 50% greater, 50 to 100% greater, or more than 100% greater than the threshold level of sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain. In some cases, an elevated level of sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain can be a level that is at least 2 percent (e.g., at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, or 500 percent) greater than the threshold level.
[0034] A threshold level for a substrate (e.g., a PD-L1-related marker such as sPD-L1, evPD-L1, or ADAM10/ADAM17-cleaved sPD-L1 ectodomain) in a mammal can be the level of the substrate that indicates a prognosis for the mammal (e.g., OS or time to recurrence). As described herein, a threshold value can be determined by measuring the level of a particular marker in samples from a population of mammals having different disease outcomes, and determining a level of the marker that can serve as a cutoff -where levels above the cutoff indicate poor prognosis and levels below the cutoff indicate a better prognosis, for example (or vice versa, depending on the marker). For sPD-L1, for example, the threshold can be from about 0.001 ng/mL to about 20 ng/mL (e.g., about 0.001 to about 0.01 ng/mL, about 0.01 to about 0.05 ng/mL, about 0.05 to about 0.1 ng/mL, about 0.1 to about 0.2 ng/mL, about 0.2 ng/mL to about 0.3 ng/mL, about 0.3 ng/mL to about 0.5 ng/mL, about 0.5 ng/mL to about 1 ng/mL, about 1 ng/mL to about 1.5 ng/mL, or about 1.5 ng/mL to about 2 ng/mL, about 2 ng/mL to about 5 ng/mL, about 5 ng/mL to about 10 ng/mL, about 8 ng/mL to about 12 ng/mL, or about 10 to about 20 ng/mL). In some cases, the threshold value for sPD-L1 can be from about 0.27 ng/mL to about 1.75 ng/mL, or about 0.277 ng/mL. In some cases, the threshold value for sPD-L1 can be from about 5 ng/mL to about 10 ng/mL, or about 7.5 ng/mL. In some cases, the threshold for evPD-L1 or evADAM10 can be from about 0.1% to 1% of circulating EVs (e.g., from about 0.1×10.sup.6 to about 0.4×10.sup.6 particles/uL, about 0.4×10.sup.6 to about 0.8×10.sup.6 particles/uL, about 0.5×10.sup.6 to about 1×10.sup.6 particles/uL, about 1×10.sup.6 to about 2×10.sup.6 particles/uL, or about 2×10.sup.6 to about 1.2x10.sup.7 particles/uL).
[0035] Any appropriate method can be used to detect and quantify substrates that are proteins or other macromolecules (e.g., PD-L1, sPD-L1, or ADAM10/ADAM17 cleaved sPD-L1 ectodomain). Suitable methods include, without limitation, enzyme-linked immunosorbent assay (ELISA), immunohistochemistry (IHC), and other antibody-based detection methods. In addition, any appropriate method can be used to detect substrates that include EVs (e.g., evPD-L1). “EVs” include extracellular vesicles, exosomes, and other structures for inter-cellular transport. Suitable methods for detecting and/or quantifying EVs include, without limitation, flow cytometry (e.g., nanoflow cytometry) and microscopic imaging techniques [e.g., electron magnetic imaging (EM)].
[0036] In some cases, the methods provided herein can include detecting and/or quantifying sPD-L1 in a sample of body fluid using, for example, immunological techniques. For example, an antibody that binds to an epitope specific for sPD-L1 can be used to detect sPD-L1 in body fluid. In some cases, an antibody directed against sPD-L1 can bind the polypeptide with an affinity of at least 10.sup.-4 M (e.g., at least 10.sup.-5, 10.sup.-6, 10.sup.-7, 10.sup.-8, 10.sup.-9, 10.sup.-10, 10.sup.-11, or 10.sup.-12 M).
[0037] Antibodies having specific binding affinity for sPD-L1 can be commercially obtained, or can be produced using, for example, methods described elsewhere (see, for example, Dong et al., Nature Med, 8:793-800, 2002). In some cases, a sPD-L1 polypeptide (e.g., a polypeptide comprising or consisting of the extracellular domain of PD-L1) can be recombinantly produced, or can be purified from a biological sample, and used to immunize a host animal such as, without limitation, a rabbit, chicken, mouse, guinea pig, or rat. Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund’s adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin and dinitrophenol. Monoclonal antibodies can be prepared using a sPD-L1 polypeptide and hybridoma technology.
[0038] In immunological assays, an antibody having specific binding affinity for sPD-L1 or a secondary antibody that binds to such an antibody can be labeled, either directly or indirectly. Suitable labels include, without limitation, radioisotopes (e.g., .sup.125I, .sup.131I, .sup.35S, .sup.3H, .sup.32P, .sup.33P, or .sup.14C), fluorophores (e.g., fluorescein, fluorescein-5-isothiocyanate (FITC), PerCP, rhodamine, or phycoerythrin), luminescent moieties (e.g., QDOT™ nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, CA), compounds that absorb light of a defined wavelength, or enzymes (e.g., alkaline phosphatase or horseradish peroxidase). In some cases, antibodies can be indirectly labeled by conjugation with biotin and then detected with avidin or streptavidin labeled with a molecule described above. Methods of detecting or quantifying a label depend on the nature of the label, and can include, for example, the use of detectors such as x-ray film, radioactivity counters, scintillation counters, spectrophotometers, colorimeters, fluorometers, luminometers, and densitometers. Combinations of these approaches (including “multi-layer” assays) can be used to enhance the sensitivity of an assay.
[0039] Immunological assays for detecting sPD-L1 can be performed in a variety of formats, including sandwich assays (e.g., ELISA assays, sandwich Western blotting assays, or sandwich immunomagnetic detection assays), competition assays (competitive RIA), or bridge immunoassays. See, for example, U.S. Pat. Nos. 5,296,347; 4,233,402; 4,098,876; and 4,034,074. Methods of detecting sPD-L1 generally can include contacting a body fluid with an antibody that binds to sPD-L1 and detecting or quantifying binding of sPD-L1 to the antibody. For example, an antibody having specific binding affinity for sPD-L1 can be immobilized on a solid substrate and then exposed to the biological sample. In some cases, binding of sPD-L1 to the antibody on the solid substrate can be detected by exploiting the phenomenon of surface plasmon resonance, which results in a change in the intensity of surface plasmon resonance upon binding that can be detected qualitatively or quantitatively by an appropriate instrument, e.g., a Biacore apparatus (Biacore International AB; Rapsgatan, Sweden). Alternatively, the antibody can be labeled and detected as described above. A standard curve using known quantities of sPD-L1 can be generated to aid in the quantitation of sPD-L1 levels.
[0040] In some embodiments, a “sandwich” assay in which a capture antibody or capture binding substrate is immobilized on a solid substrate can be used to detect the presence, absence, or amount of sPD-L1. The solid substrate can be contacted with the biological sample such that sPD-L1 in the sample can bind to the immobilized antibody. The presence of sPD-L1 bound to the antibody can be determined using a “reporter” antibody having specific binding affinity for sPD-L1 and the methods described above. It is understood that in these sandwich assays, the capture antibody or capture binding substrate (e.g., an immobilized PD-1 receptor fragment) should not bind to the same epitope (or range of epitopes in the case of a polyclonal antibody) as the reporter antibody. Thus, if a monoclonal antibody is used as a capture antibody, the reporter antibody can be another monoclonal antibody that binds to an epitope that is either completely physically separated from or only partially overlaps with the epitope to which the capture monoclonal antibody binds, or a polyclonal antibody that binds to epitopes other than or in addition to that to which the capture monoclonal antibody binds.
[0041] Suitable solid substrates to which an antibody (e.g., a capture antibody) or capture binding substrate can be bound include, without limitation, microtiter plates, tubes, membranes such as nylon or nitrocellulose membranes, and beads or particles (e.g., agarose, cellulose, glass, polystyrene, polyacrylamide, magnetic, or magnetizable beads or particles). Magnetic or magnetizable particles can be used when an automated immunoassay system is used.
[0042] Alternative techniques for detecting sPD-L1 include mass-spectrophotometric techniques such as electrospray ionization (ESI), liquid chromatography-mass spectrometry (LC-MS), and matrix-assisted laser desorption-ionization (MALDI). See, for example, Gevaert et al., Electrophoresis, 22(9):1645-51, 2001; and Chaurand et al., J Am Soc Mass Spectrom, 10(2):91-103, 1999). Mass spectrometers useful for such applications are available from Applied Biosystems (Foster City, CA); Bruker Daltronics (Billerica, MA) and Amersham Pharmacia (Sunnyvale, CA). Arrays for detecting polypeptides, two-dimensional gel analysis, and chromatographic separation techniques also can be used to detect sPD-L1.
[0043] When a subject is identified as having a level of a substrate (e.g., a PD-L1 related marker such as sPD-L1 or evPD-L1) that is at or above a threshold level, the subject can undergo one or more (e.g., one, two, three, four, five, one to three, two to four three to five, or more than five) TPE procedures. TPE (depicted in
[0044] After the TPE step(s) is complete, the subject can be treated with immunotherapy. The immunotherapy can be include one or more immune checkpoint inhibitors targeted to an immunomodulatory receptor (e.g., PD-1 or CTLA-4) or an immunomodulatory ligand (e.g., PD-L1, PD-L2, PD-L3, CD80, or CD86) that binds to an immunomodulatory receptor. Checkpoint inhibitors (e.g., inhibitors of PD-1/PD-L1 interaction) that can be used in the methods provided herein include, without limitation, anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-CTLA-4 antibodies, and any combination thereof (e.g., nivolumab and ipilimumab). Anti-PD-1, anti-PD-L1, and anti-CTLA-4 antibodies that can be used as described herein can be polyclonal antibodies, monoclonal antibodies, humanized antibodies, chimeric antibodies, single chain Fv antibody fragments, Fab fragments, or F(ab)2 fragments that are capable of binding to an epitopic determinant of PD-1 (e.g., human PD-1), PD-L1 (e.g., human PD-L1), or CTLA-4 (e.g., human CTLA-4). Examples of anti-PD1 antibodies that can be used as described herein include, without limitation, pembrolizumab (a humanized antibody with the trade name KEYTRUDA®, available from Merck), nivolumab (a targeted antibody with the trade name OPDIVO®, available from Bristol-Myers Squibb), and pidilizumab (a monoclonal antibody available from Medivation). Examples of anti-PD-L1 antibodies that can be used as described herein include, without limitation, avelumab (a monoclonal antibody with the trade name BAVENCIO®, available from Pfizer), atezolizumab (a humanized monoclonal antibody with the trade name TECENTRIQ®, available from Genentech) and durvalumab (a monoclonal antibody with the trade IMFINZI®, available from AstraZeneca). Examples of anti-CTLA-4 antibodies that can be used in the methods described herein include, without limitation, ipilimumab (a monoclonal antibody with the trade name YERVOY®, available from Bristol-Myers Squibb).
[0045] A immunotherapeutic composition containing, for example, one or more inhibitors of PD-⅟PD-L1 interaction (e.g., one or more anti-PD-1 antibodies, one or more anti-PD-L1 antibodies, or a combination thereof) can be administered to a subject in an amount, at a frequency, and for a duration effective to achieve a desired effect (e.g., to reduce tumor size, reduce cancer cell number, to reduce one or more symptoms of cancer, or to prevent or delay worsening of one or more such symptoms). The immunotherapy (e.g., one or more inhibitors of PD-⅟PD-L1 interaction) can be administered in an amount effective to reduce the size of a tumor, reduce the number of cancer cells, or reduce one or more symptoms of cancer in a patient by at least 3% (e.g., at least 5%, at least 10%, at least 20%, at least 50%, 3% to 5%, 5% to 10%, 10% to 15%, 15% to 20%, 20% to 25%, 25% to 50%, or more than 50%). In some cases, for example, effective amount of an immunotherapy treatment can be an amount that reduces the size of a tumor in a treated mammal by at least 10% as compared to the size of the tumor in the mammal prior to administration of the immunotherapy. The presence or extent of tumors, cancer cells, and cancer symptoms can be evaluated using any appropriate method.
[0046] In some embodiments, the amounts of one or more immunotherapies (e.g., one or more inhibitors of PD-1/PD-L1 interactions) administered to a mammal and/or the frequency of administration can be titrated in order to, for example, identify a dosage that is most effective to treat the mammal while having the least amount of adverse effects. For example, an effective amount of a composition containing one or more inhibitors of PD-1/PD-L1 interaction can be any amount that reduces tumor size or reduces cancer symptoms within a mammal, without having significant toxicity in the mammal. If a cancer in a mammal fails to respond to a particular amount, then the amount can be increased by, for example, two-fold, three-fold, five-fold, or ten-fold. After receiving this higher concentration, the mammal can be monitored for both responsiveness to the treatment and toxicity symptoms, and adjustments in the dosage can be made accordingly. The effective amount can remain constant or can be adjusted as a sliding scale or variable dose depending on the mammal’s response to treatment.
[0047] In some embodiments, the methods provided herein can include monitoring a treated subject to determine whether or not the therapy is effective. For example, a mammal having a tumor (e.g., a human cancer patient) can be monitored to determine whether the tumor has decreased in size after treatment, or whether the number of tumor cells detected in the patient is reduced following treatment.
[0048] In some cases, a method as described herein can include the steps shown in
[0049] It is to be noted that this document also provides methods for removing EVs to address other clinical indications including, but not limited to, aging, autoimmunity, heart disorders, infection, neurodegeneration, and obesity.
[0050] The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
EXAMPLES
Example 1 - Materials and Methods
[0051] Retrospective Melanoma Outcomes Study Design: In a retrospective analysis, baseline blood samples from 276 patients with melanoma prior to treatment in one of three clinical trials by the North Central Cancer Treatment Group (NCCTG): N057e (Kottschade et al., Cancer, 117(8):1704-1710, 2011), N0775 (ottschade et al., KCancer, 119(3):586-592, 2013), and N0879 (McWilliams et al., Cancer, 124(3):537-545, 2018) between 2006 and 2014 were tested for sPD-L1. 82% of patients were diagnosed with cutaneous melanoma, and none received immunotherapy treatments. Blood from 86 healthy volunteers undergoing blood donation at Mayo Clinic also was tested.
[0052] Prospective Therapeutic Plasma Exchange Study Design: Adult subjects undergoing TPE were identified for an investigator-initiated open-label single-center observational study. Samples of whole blood were collected in ACD vacutainers (BD) immediately prior to TPE and upon completion of the procedure. In each case, the first 8 mL of blood was discarded to avoid contamination, after which an 8 mL sample was obtained in sequence. Plasma was isolated by centrifugation. A post-procedure blood sample was obtained after completion of the procedure. In addition, matching samples from discarded plasma from the procedure waste bag were collected. Samples were obtained from up to four consecutive procedures for each patient. If a patient underwent fewer than four TPE procedures, samples were obtained from as many procedures as possible.
[0053] The patients included in the study were adults undergoing TPE for a variety of hematologic, neurologic, and renal diseases as indicated by published guidelines from the American Society for Apheresis (ASFA) or according to the medical judgement of the referring physicians (Padmanabhan et al., J Clin Apher, 34(3):171-354, 2019). Patients taking biotin supplements were excluded from the study due to biotin interference with the sPD-L1 ELISA assay. Procedures were performed using centrifugation-based cell separators, either the Fenwal Amicus (Fresenius KABI USA LLC, Lake Zurich IL, USA) or the Spectra Optia (Terumo BCT Inc, Lakewood CO, USA). For each patient, a single plasma volume was exchanged using either peripheral IVs (preferred) or central lines for vascular access. For this study, due to the possibility of sPD-L1 or PD-L1-positive EVs present in donor plasma, only TPE sessions using no donor plasma (i.e., no FFP) in the replacement fluid were included in calculations. Anticoagulation consisted of either 500 ml of acid citrate dextrose solution A (ACD-A) or 500 ml of ACD-A with 5000 units of unfractionated heparin. Anticoagulant to blood ratios were 1:13 when ACD-A was used and 1:26 when ACD-A/Heparin was used. Patients did not receive routine electrolyte replacement, but 10 ml of 10% calcium gluconate was administered by slow IV push for signs and symptoms of hypocalcemia related to the ACD-A anticoagulant in one patient.
[0054] ELISA: Enzyme-linked immunosorbent assay (ELISA) was performed as described elsewhere (Frigola et al., Clin Cancer Res 1(177):1915-1923, 2011). Both secreted splice variant and shed sPD-L1 are reliably detected by this ELISA. In brief, paired mouse IgG2 monoclonal antibody clones H1A and B11 against extracellular human PD-L1 were utilized in a capture-detection plate assay using biotinylation and HRP-streptavidin detection. This assay is specific for sPD-L1 and does not exhibit cross-reactivity to other B7-H homologues, nor to evPD-L1. Concentrations were determined by optical density (OD) measurements along a standard curve of recombinant human PD-L1. ELISAs were performed by team members blinded to the identity of the samples.
[0055] Flow cytometry: Flow cytometry for EVs was performed as described elsewhere (Gomes et al., Thromb Haemost 118(9):1612-1624, 2018). In brief, plasma samples were centrifuged twice at 2000 g to deplete platelets. Resultant platelet-free plasma (PFP) was analyzed using an A60-Micro Plus Nanoscale Flow Cytometer (Apogee FlowSystems Ltd., Hemel Hempstead, England) gating for mid-intensity light angle light scatter (LALS) and markers of interest. Anti-PD-L1 (atezolizumab; Genentech, South San Francisco, CA), ADAM10 (clone 163003; R&D Systems/Bio-Techne, Minneapolis, MN), and CD61 (clone VI-PL2; BioLegend, San Diego, CA) antibodies were conjugated to fluorophores (Alexa-647, PE phycoerythrin, and Alexa-488; Life Technologies/Thermo Fisher Scientific, Waltham, MA) and titrated prior to use. Nanoscale flow cytometer calibration was performed using a standard reference bead mix as described elsewhere (Gomes et al., supra). Flow cytometry was performed by team members blinded to the identity of the samples.
[0056] Statistical Analysis: All statistical analyses were performed using R Statistical Software (R Foundation). Retrospective progression-free survival (PFS) was analyzed using Kaplan-Meier and Cox proportional-hazards modeling. Optimal cutoff values for sPD-L1 levels were determined using the greyzoneSurv package for R. Wilcoxon signed-rank test was used to compare paired pre- and post-TPE patient sample sPD-L1 and EV levels as indicated. Baseline clinical characteristics for the study were compared by Kruskal-Wallis test for continuous variables and Pearson’s chi-squared test for discrete variables as indicated. Otherwise, groups were compared by unpaired two-sided Student’s t-test. Figures containing box plots show quartile values and individual data points. Mean values and 95% confidence intervals (CI) are indicated in corresponding supplemental figures and tables. P <0.05 was considered statistically significant. In the figures presented herein, p values are denoted <0.05 with *, <0.01 with **, and <0.001 with ***.
Example 2 - Soluble PD-L1 Levels Predict Overall Survival in Patients With Melanoma
[0057] Each form of extracellular PD-L1 acts in trans as a systemic immunosuppressant through PD-1 signaling (
TABLE-US-00002 Extracellular forms of PD-L1 and outcomes in multiple malignancies High sPD-L1 prognosis PD-L1 protein-to-mRNA prognosis.sup.1 First Line IO Non-First Line IO Adrenocortical ↑ Bladder ↑ Cisplatin-ineligible CPS10: P.sup.2A.sup.3 P.sup.2 N.sup.4 Breast Poor.sup.5 ↑ TNBC unresectable PD-L1>1%: A.sup.3 Biliary Poor .sup.6 Cervical ↗ P.sup.2 Colon MSI-high: P.sup.2 Gastric Mainly poor.sup.7-11 Poor in IO.sup.12 Poor with EVs.sup.13 ↓ P.sup.2 Glioma (low-grade) ↑ Head/Neck SCC ↗ P.sup.2 N.sup.4 Hepatocellular Poor DFS and OS.sup.14-18 or equivocal.sup.19 ↑ P.sup.2 N.sup.4 Lung Poor.sup.20-23 Poor response in IO.sup.12,24,25 Metastatic NSCLC no muts: P.sup.2A.sup.3 SCLC: A.sup.3 P.sup.2 N.sup.4 Lymphoma BCL poor OS.sup.26 poor response.sup.27 decrease on tx positive.sup.28 HL poor PFS.sup.29 PTCL poor OS/PFS/response.sup.30,31 NK/T poor OS/PFS.sup.32,33 ↗ HL: P.sup.2 N.sup.4 Melanoma Poor34 Poor in IO.sup.35 ↗ Unresectable/metastatic: P.sup.2N.sup.4 Adjuvant if LNs after resection: P.sup.2 Mesothelioma ↑ Myeloma Poor PFS.sup.36,37 Ovarian (epithelial) Poor OS and PFS in cisplatin-resp.sup.38 Pancreatic Decrease on tx positive.sup.39 Prostate ↗ Rectal Poor DFS.sup.40 Renal ↗ Advanced with axitinib: P.sup.2 N.sup.4 Sarcoma ↑
[0058] Cancers for which serum sPD-L1 and/or PD-L1 protein-to-mRNA ratios affect(s) prognosis in a previous study of Cancer Genome Atlas (TCGA) data (increased improves survival)1 and/or in which first-line or common second-line PD-(L)1 inhibitor therapy is FDA approved as a partial list. OS: overall survival. PFS: progression-free survival. IO: immunotherapy. A: atezolizumab. N: nivolumab. P: pembrolizumab.
REFERENCES
[0059] 1. Orme et al., supra. [0060] 2. Keytruda: Highlights of Prescribing Information, 2017 [0061] 3. Genentech. Atezolizumab: Highlights of Prescribing Information, 2018 [0062] 4. Nivolumab: Highlights of Prescribing Information, 2018 [0063] 5. Li et al., supra [0064] 6. Ha et al., supra [0065] 7. Zheng et al., Chin J Cancer Res, 26:104-111, 2014 [0066] 8. Ito et al., Ann Gastroenterol Surg, 2(4):313-318, 2018 [0067] 9. Bang et al., J Clin Oncol, 33:4001, 2015 [0068] 10. Shigemori et al., Ann Surg Oncol, 26:876-883, 2019 [0069] 11. Choi et al., Ann Surg, 270:309-316, 2019 [0070] 12. Ando et al., supra [0071] 13. Fan et al., supra [0072] 14. Finkelmeier et al., Z Gastroenterol, 53:A4_19, 2015 [0073] 15. El-Gebaly et al., Curr Cancer Drug Targets, 19(11):896-905, 2019 [0074] 16. Chang et al., Cancer Immunol Immunother, 68:353-363, 2019 [0075] 17. Han et al., J Cancer Res Clin Oncol, 145:303-312, 2019 [0076] 18. Kim et al., Radiother Oncol, 129:130-135, 2018 [0077] 19. Elmezayen et al., Surg Today, 50(6):569-576, 2019 [0078] 20. Okuma et al. 2017, supra [0079] 21. Zhang et al., supra [0080] 22. Costantini et al., supra [0081] 23. Zhao et al., supra [0082] 24. Costantini et al., supra [0083] 25. Okuma et al. 2018, supra [0084] 26. Rossille et al., Leukemia, 28, 2367-2375, 2014 [0085] 27. Rossille et al., supra [0086] 28. El-Ghammaz, et al., Clin Exp Med, 18:505-512, 2018 [0087] 29. Guo et al., Transl Oncol, 11:779-785, 2018 [0088] 30. Zhang et al., Hematol Oncol, 37:270-276, 2019 [0089] 31. Shen et al., Hematol, 24:392-398, 2019 [0090] 32. Bi et al., J Hematol Oncol, 9:109, 2016 [0091] 33. Wang et al., Oncotarget 7:33035-33045, 2016 [0092] 34. Dronca et al., supra [0093] 35. Zhou et al., supra [0094] 36. Wang et al., Oncotarget 6:41228-44136, 2015 [0095] 37. Huang et al., Oncotarget 7:62490-62502, 2016 [0096] 38. Buderath et al., Front Oncol, 9:1015, 2019 [0097] 39. Park et al., Sci Rep, 9:11131, 2019 [0098] 40. Tominaga et al., PLoS One, 14:e0212978, 2019
TABLE-US-00003 Baseline patient characteristics in the melanoma cohort High sPD-L1 (n=216) Low sPD-L1 (n=61) Statistic Age, years 60 (50, 69) 58 (50, 70) F=0.10, P = 0.756.sup.1 Sex: M 137/216 (63) 31/60 (52) X.sup.2 = 2.73, P=0.10.sup.2 Stage X.sup.2 = 3.95, P=0.139.sup.2 M1a 31/214 (14.5) 14/59 (23.7) M1b 54/214 (25.2) 17/59 (28.8) M1c 129/214 (60.3) 28/59 (47.5) sPD-L1, ng/uL 0.589 (0.370, 3.153) 0.216 (0.173, 0.249) F=272.68 P < 0.001.sup.1 LDH, U/L 209 (168, 395) 187 (163, 298) F=2.05 P = 0.154.sup.1 Patients with melanoma from three studies with retrospective data were compared by starting sPD-L1 level above or below the discovered survival cutoff (0.277 ng/mL). Characteristics collected at entry into the study included age in years, sex, stage, sPD-L1, and LDH (lactate dehydrogenase). .sup.1Kruskal-Wallis. .sup.2Pearson
TABLE-US-00004 Multivariate analysis in melanoma survival at diagnosis Hazard Ratio P value Age > 60 years 1.00 (0.76-1.32) 0.93 Sex: M 1.19 (0.90-1.58) 0.25 Stage M1a 1 M1b 1.42 (0.91-2.23) 0.11 M1c 1.94 (1.28-2.96) 0.002 .sup.∗∗ sPD-L1 > 0.277 ng/mL 1.47 (1.05-2.07) 0.025 .sup.∗ LDH > 180 U/L 1.53 (1.53, 2.11) 0.010 .sup.∗∗ Multivariate analysis in melanoma survival at diagnosis. Cox proportional Hazards multivariate analysis was performed.
Example 3 - Therapeutic Plasma Exchange Significantly Reduces Plasma sPD-L1 Levels
[0099] To determine whether TPE can remove extracellular PD-L1 in its various forms, patients undergoing planned TPE were prospectively enrolled. 28 patients met inclusion criteria, and 25 provided informed consent. Baseline patient characteristics are listed in TABLE 4. One patient was excluded for biotin-containing supplement use, as biotin interferes with the established sPD-L1 detection assay. The remaining 24 patients underwent plasma exchange and sample collection before and after the procedure as described in Example 1 and depicted in
TABLE-US-00005 Patient baseline characteristics Characteristic High sPDL1 (n=17) Low sPDL1 (n=7) Statistic Starting sPD-L1 1650 (962, 6663) 108 (0, 128) F.sub.1.22 = 36.19, P < 0.001.sup.1 Age (years) 61 (42, 69) 47 (38, 66) F.sub.1.22 = 0.35, P=0.558.sup.1 Gender: F 8 (47%) 2 (29%) X.sup.2 = 0.70, P=0.404.sup.2 Active Cancer: Yes 5 (29%) 2 (29%) X.sup.2 = 0, P=0.967.sup.2 Immunntherapy X.sup.2 = 2.88, P=0.237.sup.2 None 16 (94%) 6 (86%) Atezolizumab 1 (6%) 0 (0%) Pembrolizumab 0 (0%) 1 (14%) Plasma exchange indication X.sup.2 = 2.88, P=0.315.sup.2 CNS demyelination (myelitis, MS, NMO, myelopathy) 5 (29%) 5 (71%) Immune encephalitis 2 (12%) 0 (0%) Myasthenia gravis 1 (5.9%) 0 (0%) Paraneoplastic syndrome (encephalitis, neuropathy, pemphigus) 2 (12%) 2 (29%) Paraproteinemia (Waldenström, cryoglobulinemia, kappa gammopathy) 3 (18%) 0 (0%) Susac syndrome 2 (12%) 0 (0%) Transplant rejection (heart, kidney) 2 (12%) 0 (0%) Pre-TPE White Blood Cell Count 6.7 (6.1, 10.3) 8.8 (7.9, 12.3) F.sub.1,22 = 0.78, P = 0.385.sup.1 Pre-TPE Hemoglobin 12.5 (10.4, 13.5) 14.7 (13.5, 14.9) F.sub.1,22 = 8.60, P = 0.008.sup.1 Pre-TPE Creatinine 0.90 (0.79, 1.55) 0.710 (0.63, 0.89) F.sub.1,22 = 3.82, P = 0.063.sup.1 Patients undergoing TPE were compared by starting sPD-L1 level above or below a survival cutoff established in patients with melanoma (0.277 ng/mL). For categorical variables, n (%) is given. For continuous variables, mean (quartiles) is given. .sup.1Kruskal-Wallis. .sup.2Pearson. MS, multiple sclerosis; NMO, neuromyelitis optica.
[0100] Most patients undergoing TPE did not have an active cancer diagnosis. Baseline sPD-L1 levels in all patients were compared to matched normal controls and patients with melanoma (
TABLE-US-00006 sPD-L1 reduction and regeneration per exchange % Reduction per exchange (n=44) Mean (SD) 70.8 (21.3) Median [Min, Max] 74.4 [-5.10, 100] % Regeneration between exchanges (n=44) Mean (SD) 33.8 (84.1) Median [Min, Max] 45.5 [-429, 100] Regeneration per cycle (pg/ml) Mean (SD) 1250 (3300) Median [Min, Max] 466 [-3.8k, 15.4k] For each exchange not requiring FFP, percent sPD-L1 reduction and regeneration between each exchange was calculated. n=44.
[0101] A representative individual patient treatment course showing sPD-L1 reduction over four successive TPE sessions is shown in
[0102] FFP is sometimes given during TPE for patients with increased risk of bleeding. It was observed that some patients receiving FFP with low baseline sPD-L1 experienced rapid increases in sPD-L1 levels after TPE, presumably passively acquired from donor plasma since this was not observed in patients receiving albumin replacement alone. sPD-L1 was not detected in the discarded plasma from the procedure for these patients. A mild association between post-FFP infusion rises in sPD-L1 levels and the blood type of the recipient was observed, mainly in patients with O type blood. Individuals with Group O-blood are universal recipients of FFP products and universal donors of cellular products due to a lack of ABO group antigens and the presence of pre-formed anti-A and anti-B antibodies, respectively. Recipients of FFP usually receive a mixture of compatible plasma from multiple donors. To determine whether blood type in FFP donors is associated with FFP sPD-L1 content, sPD-L1 was measured by ELISA in plasma from multiple FFP donors (
Example 4 - TPE Efficiently Reduces Plasma EV Levels in vivo
[0103] To determine whether TPE can remove PD-L1-positive EVs (evPD-L1) from patient blood, total EV levels and evPD-L1 were measured in each sample by flow cytometry. The impact of TPE on platelet-derived CD61-positive EVs and ADAM10-positive low density EVs also was determined as CD61-positive EVs are one of the most abundant EV subpopulations in blood (CD61 is a platelet marker), and ADAM10-positive low density EVs have been implicated in exosome loading and pathogenesis (Berckmans et al., Thromb Haemost, 85(4):639-646, 2001; Crescitelli et al., J Extracell Vesicles, 9(1):1722433, 2020; and Kowal et al., Proc Natl Acad Sci USA, 113(8):E968-E977, 2016).
[0104] TPE significantly reduced total plasma particle concentration (
[0105] Individual patient courses showing total plasma, PD-L1-positive, ADAM10-positive, and CD61-positive EV levels before and after each TPE session are shown in
TABLE-US-00007 Reduction in EVs by subtype per exchange % Reduction in total EVs per exchange (n=55) Mean (SD) 33.5 (89.4) Median [Min, Max] 60.9 [-468, 99.1] % Reduction PD-L1-positive EVs per exchange (n=13) Mean (SD) 73.1 (14.6) Median [Min, Max] 72.3 [50.0, 98.5] % Reduction in ADAM10-positive EVs per exchange (n=55) Mean (SD) 5.91 (126) Median [Min, Max] 42.4 [-709, 99.5] Percent reduction in EVs for TPE sessions in which over one million pre-TPE EVs were present (above background noise levels) and no FFP was given.
Example 5 - TPE Significantly Reduces sPD-L1 Levels in Melanoma Patients Experiencing Progression After Immunotherapy
[0106] Patients with melanoma who had experienced disease progression despite immunotherapy with a PD-(L)1 inhibitor were screened for initial sPD-L1 levels in a prospective biomarker-selected trial. At screening, patients with sPD-L1 levels above a prespecified cutoff of 7.5 ng/mL were assessed for appropriate peripheral vascular access for the TPE procedure. Patients meeting the criteria underwent multiple days of TPE, and sPD-L1 levels were measured. Patients with high sPD-L1 levels at screening continued to show significant elevated sPD-L1 levels at the beginning of TPE after radiation. After TPE, all patients in the study experienced significant decreases in sPD-L1 levels (
OTHER EMBODIMENTS
[0107] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.