ANTI-TIM3 SINGLE-CHAIN ANTIBODY AND USE THEREOF IN PREPARING MEDICINE FOR TREATING TUMOR

20230295294 · 2023-09-21

Assignee

Inventors

Cpc classification

International classification

Abstract

The disclosure relates to an anti-TIM3 single-chain antibody. The amino acid sequence of the anti-TIM3 single-chain antibody is a sequence shown in SEQ ID NO. 1. T lymphocytes expressing the anti-TIM3 single-chain antibody can effectively kill tumor cells.

Claims

1. An anti-TIM3 single-chain antibody, wherein the amino acid sequence of the anti-TIM3 single-chain antibody is a sequence shown in SEQ ID NO. 1.

2. A nucleic acid, wherein the nucleic acid encodes the anti-TIM3 single-chain antibody according to claim 1.

3. A fusion protein, wherein the fusion protein contains an antigen binding domain, a transmembrane domain and an intracellular signaling domain that are sequentially linked; the amino acid sequence of the intracellular signaling domain comprises the amino acid sequence of the anti-TIM3 single-chain antibody according to claim 1.

4. A fusion nucleic acid, wherein the fusion nucleic acid encodes the fusion protein according to claim 3.

5. An expression vector, wherein the expression vector is inserted with an expression cassette, the expression cassette comprises a first nucleic acid fragment encoding an antigen binding molecule and a second nucleic acid fragment encoding an intracellular signaling molecule, the intracellular signaling molecule contains the anti-TIM3 single-chain antibody according to claim 1, and an IRES element or a 2A peptide encoding sequence is inserted between the first nucleic acid fragment and the second nucleic acid fragment.

6. A cell expressing a chimeric antigen receptor, wherein the cell expressing a chimeric antigen receptor is obtained by transfection of the expression vector according to claim by a host cell, and the chimeric antigen receptor contains an anti-TIM3 single-chain antibody, wherein the amino acid sequence of the anti-TIM3 single-chain antibody is a sequence shown in SEQ ID NO. 1.

7. The cell according to claim 6, wherein the host cell is a T cell.

8-9. (canceled)

10. A pharmaceutical composition, wherein an active ingredient of the pharmaceutical composition comprises the cell expressing an anti-TIM3 chimeric antigen receptor according to claim 6.

11. The nucleic acid according to claim 2, wherein the nucleic acid has a nucleotide sequence shown in SEQ ID NO. 2.

12. The fusion protein according to claim 3, wherein the antigen binding domain comprises an anti-CD44 single-chain antibody and/or an anti-CD133 single-chain antibody, and the intracellular signaling domain comprises the anti-TIM3 single-chain antibody.

13. The fusion protein according to claim 3, wherein the fusion protein has an amino acid sequence shown in SEQ ID NO. 3.

14. The fusion nucleic acid according to claim 4, wherein the fusion nucleic acid has a nucleotide sequence shown in SEQ ID NO. 4.

15. The expression vector according to claim 5, wherein the expression cassette is a fusion nucleic acid, wherein the fusion nucleic acid encodes a fusion protein, wherein the fusion protein contains an antigen binding domain, a transmembrane domain and an intracellular signaling domain that are sequentially linked; the amino acid sequence of the intracellular signaling domain comprises the amino acid sequence of an anti-TIM3 single-chain antibody, wherein the amino acid sequence of the anti-TIM3 single-chain antibody is a sequence shown in SEQ ID NO. 1.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0021] The accompanying drawings are intended to provide a further understanding of the disclosure, constitute a part of the description, and are used for interpreting the disclosure together with the following specific embodiments, rather than limiting the disclosure. In the figures:

[0022] FIG. 1 is a flow cytometer test result diagram of CAR-T 1 cells according to an embodiment of the disclosure;

[0023] FIG. 2 is a flow cytometer test result diagram of CAR-T 2 cells according to an embodiment of the disclosure; and

[0024] FIG. 3 is a flow cytometer test result diagram of CAR-T 3 cells according to an embodiment of the disclosure.

DETAILED DESCRIPTION

[0025] The specific embodiments of the disclosure will be described in detail below with reference to the accompanying drawings. It should be understood that the specific embodiments described herein are merely used for illustrating and interpreting the disclosure, rather than limiting the disclosure.

[0026] A first aspect of the disclosure provides an anti-TIM3 single-chain antibody, the amino acid sequence of the anti-TIM3 single-chain antibody includes a sequence shown in SEQ ID NO. 1.

[0027] Where the sequence shown in SEQ ID NO. 1 is as follows:

TABLE-US-00001 QVQLQQSGPGLVKPSHTLSLTCTVSGGSISSGGYYWSWTRQHPGMGLEW IGYISYSGSIYYTPSLKSRLTISVDTSKNQFSLKLSSVTAADTAVYYCA SLDSWGSNRDYWGQGTLVTVSSGGGGSEIVLTQSPATLSLSPGERATLS CRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDF TLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK.

[0028] T cell immunoglobulin mucin-3 (TIM3) is an important tumor immunoassay site, is widely expressed on tumor infiltrating T lymphocytes, and can inhibit the tumor immunocompetence of tumor infiltrating T lymphocytes. The anti-TIM3 single-chain antibody designed for TIM3 can effectively block TIM3 pathways in T lymphocytes, enhance the tumor immunocompetence of T lymphocytes, and enhance the ability of T lymphocytes to kill tumor cells.

[0029] The inventors of the disclosure found that T lymphocytes expressing the above-mentioned anti-TIM3 single-chain antibody can effectively kill tumor cells.

[0030] A second aspect of the disclosure provides a nucleic acid encoding the anti-TIM3 single-chain antibody according to the first aspect. Preferably, the nucleic acid has a nucleotide sequence shown in SEQ ID NO. 2.

[0031] Where the nucleotide sequence shown in SEQ ID NO. 2 is as follows:

TABLE-US-00002 caggtgcagctacagcagtcgggcccaggactggtgaagccttcacaca ccctgtccctcacctgcactgtctctggtggctccatcagcagtggtgg ttactactggagttggacccgtcagcacccagggatgggcctggagtgg attggatacatctcttacagtgggagtatctattacactccgtccctca agagtcgacttaccatatcagtggacacgtctaagaaccagttctccct gaagctgagctctgtgactgccgcggacacggccgtatattactgtgcg agtttggattcctggggatctaaccgtgactactggggccagggaaccc tggtcaccgtctcgagtggaggtggtggatccgaaattgtgttgacgca gtctccagccaccctgtctttgtctccaggggaaagagccaccctctcc tgcagggccagtcagagtgttagcagctacttagcctggtaccaacaga aacctggccaggctcccaggctcctcatctatgatgcatccaacagggc cactggcatcccagccaggttcagtggcagtgggtctgggacagacttc actctcaccatcagcagcctagagcctgaagattttgcagtttattact gtcagcagcgtagcaactggccgctcactttcggcggagggaccaaggt ggagattaag.

[0032] A third aspect of the disclosure provides a fusion protein containing an antigen binding domain, a transmembrane domain and an intracellular signaling domain that are sequentially linked. The amino acid sequence of the intracellular signaling domain includes the amino acid sequence of the anti-TIM3 single-chain antibody according to the first aspect. Preferably, the antigen binding domain includes an anti-CD44 single-chain antibody and/or an anti-CD133 single-chain antibody, and the intracellular signaling domain includes the anti-TIM3 single-chain antibody. More preferably, the fusion protein has an amino acid sequence shown in SEQ ID NO. 3.

[0033] Where the fusion protein shown in SEQ ID NO. 3 consists of an anti-CD44 single-chain antibody, an anti-CD133 single-chain antibody, a CD28, a CD3, a T2A, and an anti-TIM3 single-chain antibody.

[0034] Where the amino acid sequence shown in SEQ ID NO. 3 is as follows:

TABLE-US-00003 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVA VIWYDGSNKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR RSDYRGYYGMDVWGQGTTVTVSSGSTSGGGSGGGSGGGGSSEIVLTQSP ATLSLSPGERATLSCRASQSVINYLAWYQQKPGQAPRLLIYDASNRASG IPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEI KGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDFE MHWVRQAPGQGLEWMGDIDPGTGDTAYNLKFKGRVTMTTDTSTSTAYME LRSLRSDDTAVYYCALGAFVYWGQGTLVTVSSGSTSGGGSGGGSGGGGS SDVVMTQSPLSLPVTPGEPASISCRSSQSLANSYGNTYLSWYLQKPGQS PQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGT HQPYTFGQGTKLEIKTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGA VHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRSKRSRLLHSDYMN MTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYKQGQNQLYN ELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAY SEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPREGRGSLLT CGDVEENPGPMTNKCLLQIALLLCFSTTALSQVQLQQSGPGLVKPSHTL SLTCTVSGGSISSGGYYWSWTRQHPGMGLEWIGYISYSGSIYYTPSLKS RLTISVDTSKNQFSLKLSSVTAADTAVYYCASLDSWGSNRDYWGQGTLV TVSSGGGGSEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKP GQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQ QRSNWPLTFGGGTKVEIK.

[0035] A fourth aspect of the disclosure provides a fusion nucleic acid encoding the fusion protein according to the third aspect. Preferably, the fusion nucleic acid has a nucleotide sequence shown in SEQ ID NO. 4.

[0036] Where the nucleotide sequence shown in SEQ ID NO. 4 is used for encoding the amino acid sequence shown in SEQ ID NO. 3.

[0037] Where the nucleotide sequence shown in SEQ ID NO. 4 is as follows:

TABLE-US-00004 caggtgcagctggtggagtctgggggaggcgtggtccagcctgggaggt ccctgagactctcctgtgcagcgtctggattcaccttcagtagctatgg catgcactgggtccgccaggctccaggcaaggggctggagtgggtggca gttatatggtatgatggaagtaataaattctatgcagactccgtgaagg gccgattcaccatctccagagacaattccaagaacacgctgtatctgca aatgaacagcctgagagccgaggacacggctgtgtattactgtgcgagg agaagtgactacaggggctactacggtatggacgtctggggccaaggga ccacggtcaccgtctcctcaggcagtactagcggtggtggctccggggg cggttccggtgggggcggcagcagcgaaattgtgttgacacagtctcca gccaccctgtctttgtctccaggggaaagagccaccctctcctgcaggg ccagtcagagtgttatcaactacttagcctggtaccaacagaaacctgg ccaggctcccaggctcctcatctatgatgcatccaacagggcctctggc atcccagccaggttcagtggcagtgggtctgggacagacttcactctca ccatcagcagcctagagcctgaagattttgcagtttattactgtcagca gcgtcgcaactggccgctcactttcggcggagggaccaaggtggagatc aaaggaggtggtggatccggaggtggtggctccggaggtggtggatccc aggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctc agtgaaggtctcctgcaaggcttctggttacacctttaccgactttgaa atgcactgggtgcgacaggcccctggacaagggcttgagtggatgggag atattgatcctggaactggtgatactgcctacaatctgaagttcaaggg cagagtcaccatgaccacagacacatccacgagcacagcctacatggag ctgaggagcctgaggtctgacgacacggccgtgtattactgtgcgttgg gggcctttgtttactggggccagggaaccctggtcaccgtctcctcagg cagtactagcggtggtggctccgggggcggttccggtgggggcggcagc agcgatgttgtgatgactcagtctccactctccctgcccgtcacccctg gagagccggcctccatctcctgcaggtctagtcagagtcttgcaaacag ttatgggaacacctatttgtcttggtacctgcagaagccagggcagtct ccacagctcctgatctatgggatttccaacagattttctggggtccctg acaggttcagtggcagtggatcaggcacagattttacactgaaaatcag cagagtggaggctgaggacgttggggtttattactgcttacaaggtaca catcagccgtacacgtttggccaggggaccaagctggagatcaaaacca ctaccccagcaccgaggccacccaccccggctcctaccatcgcctccca gcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggcc gtgcatacccggggtcttgacttcgcctgcgatatctacatttgggccc ctctggctggtacttgcggggtcctgctgctttcactcgtgatcactct ttactgtaggagtaagaggagcaggctcctgcacagtgactacatgaac atgactccccgccgccccgggcccacccgcaagcattaccagccctatg ccccaccacgcgacttcgcagcctatcgctcccgcgtgaaattcagccg cagcgcagatgctccagcctacaagcaggggcagaaccagctctacaac gaactcaatcttggtcggagagaggagtacgacgtgctggacaagcgga gaggacgggacccagaaatgggcgggaagccgcgcagaaagaatcccca agagggcctgtacaacgagctccaaaaggataagatggcagaagcctat agcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacg gactgtaccagggactcagcaccgccaccaaggacacctatgacgctct tcacatgcaggccctgccgcctcgggagggaaggggttctctcctgacc tgcggcgatgtggaggagaaccccggacccatgaccaacaagtgtctcc tccaaattgctctcctgttgtgcttctccactacagctctttcccaggt gcagctacagcagtcgggcccaggactggtgaagccttcacacaccctg tccctcacctgcactgtctctggtggctccatcagcagtggtggttact actggagttggacccgtcagcacccagggatgggcctggagtggattgg atacatctcttacagtgggagtatctattacactccgtccctcaagagt cgacttaccatatcagtggacacgtctaagaaccagttctccctgaagc tgagctctgtgactgccgcggacacggccgtatattactgtgcgagttt ggattcctggggatctaaccgtgactactggggccagggaaccctggtc accgtctcgagtggaggtggtggatccgaaattgtgttgacgcagtctc cagccaccctgtctttgtctccaggggaaagagccaccctctcctgcag ggccagtcagagtgttagcagctacttagcctggtaccaacagaaacct ggccaggctcccaggctcctcatctatgatgcatccaacagggccactg gcatcccagccaggttcagtggcagtgggtctgggacagacttcactct caccatcagcagcctagagcctgaagattttgcagtttattactgtcag cagcgtagcaactggccgctcactttcggcggagggaccaaggtggaga ttaag.

[0038] A fifth aspect of the disclosure provides an expression vector, the expression vector is inserted with an expression cassette, the expression cassette includes a first nucleic acid fragment encoding an antigen binding molecule and a second nucleic acid fragment encoding an intracellular signaling molecule, the intracellular signaling molecule contains the anti-TIM3 single-chain antibody according to the first aspect, and an IRES element or a 2A peptide coding sequence is inserted between the first nucleic acid fragment and the second nucleic acid fragment; and preferably, the expression cassette is the fusion nucleic acid according to the fourth aspect.

[0039] A sixth aspect of the disclosure provides a cell expressing a chimeric antigen receptor, the cell expressing a chimeric antigen receptor is obtained by transfection of the expression vector according to the fifth aspect by a host cell, and the chimeric antigen receptor contains the anti-TIM3 single-chain antibody according to the first aspect. Optionally, the host cell is a T cell.

[0040] A seventh aspect of the disclosure provides use of the anti-TIM3 single-chain antibody according to the first aspect, the nucleic acid according to the second aspect, the fusion protein according to the third aspect, the fusion nucleic acid according to the fourth aspect, the expression vector according to the fifth aspect, and the cell expressing a chimeric antigen receptor according to the sixth aspect in preparing a medicine for treating a tumor. Optionally, the tumor is glioma.

[0041] An eighth aspect of the disclosure provides a pharmaceutical composition, an active ingredient of which includes the cell expressing an anti-TIM3 chimeric antigen receptor according to the sixth aspect.

[0042] The disclosure is further described by the following examples, but the disclosure is not limited thereby.

Example 1

[0043] This example was used to explain the construction of expression vectors.

[0044] (1) Nucleotide sequences shown in SEQ ID NO. 4 and SEQ ID NO. 5 were respectively synthesized by using a full sequence synthesis method. The nucleotide sequence shown in SEQ ID NO. 4 was used for encoding a fusion protein shown in SEQ ID NO. 3; and the nucleotide sequence shown in SEQ ID NO. 5 was used for encoding a fusion protein shown in SEQ ID NO. 6. The composition of the fusion proteins shown in SEQ ID NO. 3 and SEQ ID NO. 6 was as follows: [0045] G1: the fusion protein shown in SEQ ID NO. 3 consisted of an anti-CD44 single-chain antibody, an anti-CD133 single-chain antibody, a CD28, a CD3, a T2A, and an anti-TIM3 single-chain antibody; [0046] G2: the fusion protein shown in SEQ ID NO. 6 consisted of an anti-CD44 single-chain antibody, an anti-CD133 single-chain antibody, a CD28, and a CD3.

[0047] Where the nucleotide sequence shown in SEQ ID NO. 5 was as follows:

TABLE-US-00005 caggtgcagctggtggagtctgggggaggcgtggtccagcctgggaggt ccctgagactctcctgtgcagcgtctggattcaccttcagtagctatgg catgcactgggtccgccaggctccaggcaaggggctggagtgggtggca gttatatggtatgatggaagtaataaattctatgcagactccgtgaagg gccgattcaccatctccagagacaattccaagaacacgctgtatctgca aatgaacagcctgagagccgaggacacggctgtgtattactgtgcgagg agaagtgactacaggggctactacggtatggacgtctggggccaaggga ccacggtcaccgtctcctcaggcagtactagcggtggtggctccggggg cggttccggtgggggcggcagcagcgaaattgtgttgacacagtctcca gccaccctgtctttgtctccaggggaaagagccaccctctcctgcaggg ccagtcagagtgttatcaactacttagcctggtaccaacagaaacctgg ccaggctcccaggctcctcatctatgatgcatccaacagggcctctggc atcccagccaggttcagtggcagtgggtctgggacagacttcactctca ccatcagcagcctagagcctgaagattttgcagtttattactgtcagca gcgtcgcaactggccgctcactttcggcggagggaccaaggtggagatc aaaggaggtggtggatccggaggtggtggctccggaggtggtggatccc aggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctc agtgaaggtctcctgcaaggcttctggttacacctttaccgactttgaa atgcactgggtgcgacaggcccctggacaagggcttgagtggatgggag atattgatcctggaactggtgatactgcctacaatctgaagttcaaggg cagagtcaccatgaccacagacacatccacgagcacagcctacatggag ctgaggagcctgaggtctgacgacacggccgtgtattactgtgcgttgg gggcctttgtttactggggccagggaaccctggtcaccgtctcctcagg cagtactagcggtggtggctccgggggcggttccggtgggggcggcagc agcgatgttgtgatgactcagtctccactctccctgcccgtcacccctg gagagccggcctccatctcctgcaggtctagtcagagtcttgcaaacag ttatgggaacacctatttgtcttggtacctgcagaagccagggcagtct ccacagctcctgatctatgggatttccaacagattttctggggtccctg acaggttcagtggcagtggatcaggcacagattttacactgaaaatcag cagagtggaggctgaggacgttggggtttattactgcttacaaggtaca catcagccgtacacgtttggccaggggaccaagctggagatcaaaacca ctaccccagcaccgaggccacccaccccggctcctaccatcgcctccca gcctctgtccctgcgtccggaggcatgtagacccgcagctggtggggcc gtgcatacccggggtcttgacttcgcctgcgatatctacatttgggccc ctctggctggtacttgcggggtcctgctgctttcactcgtgatcactct ttactgtaggagtaagaggagcaggctcctgcacagtgactacatgaac atgactccccgccgccccgggcccacccgcaagcattaccagccctatg ccccaccacgcgacttcgcagcctatcgctcccgcgtgaaattcagccg cagcgcagatgctccagcctacaagcaggggcagaaccagctctacaac gaactcaatcttggtcggagagaggagtacgacgtgctggacaagcgga gaggacgggacccagaaatggggggaagccgcgcagaaagaatccccaa gagggcctgtacaacgagctccaaaaggataagatggcagaagcctata gcgagattggtatgaaaggggaacgcagaagaggcaaaggccacgacgg actgtaccagggactcagcaccgccaccaaggacacctatgacgctctt cacatgcaggccctgccgcctcgg.

[0048] The amino acid sequence of the fusion protein shown in SEQ ID NO. 6 was as follows:

TABLE-US-00006 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVA VIWYDGSNKFYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR RSDYRGYYGMDVWGQGTTVTVSSGSTSGGGSGGGSGGGGSSEIVLTQSP ATLSLSPGERATLSCRASQSVINYLAWYQQKPGQAPRLLIYDASNRASG IPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRRNWPLTFGGGTKVEI KGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDFE MHWVRQAPGQGLEWMGDIDPGTGDTAYNLKFKGRVTMTTDTSTSTAYME LRSLRSDDTAVYYCALGAFVYWGQGTLVTVSSGSTSGGGSGGGSGGGGS SDVVMTQSPLSLPVTPGEPASISCRSSQSLANSYGNTYLSWYLQKPGQS PQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGT HQPYTFGQGTKLEIKTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGA VHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRSKRSRLLHSDYMN MTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYKQGQNQLYN ELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAY SEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR.

[0049] (2) The two kinds of nucleotide sequences synthesized in step (1) were respectively inserted into pLVX-IRES-ANGFR (purchased from Clontech Company, article number 631982) as a vector to obtain two kinds of lentivirus expression vectors of this example.

Example 2

[0050] This example was used to explain the preparation and test of T cells expressing a chimeric antigen receptor.

[0051] (1) The two kinds of lentivirus expression vectors constructed in Example 1 and an empty pLVX-IRES-ANGFR vector were packaged with lentiviruses respectively, and then T cells were cultured in vitro, transfected and proliferated according to the following methods.

[0052] (2) T cells in blood were separated according to the following method: 1 mL of sterile PBS and 1 mL of blood were mixed evenly, then slowly added to an upper layer of a lymphocyte separation medium Ficoll, and centrifuged at 4° C. and 400 g for 30 min, with acceleration and deceleration set to 0 respectively. After centrifugation, the upper plasma was removed, the middle white membrane cells were pipetted, PBS was added for re-suspension washing, and centrifugation was carried out for 10 min at 100 g, with normal acceleration and deceleration.

[0053] After centrifugation, the upper washing solution was removed, 1 mL of 1640+10% FBS+1% double antibody+1× Glutamine medium was added to re-suspend cells, and then the cells were stimulated to proliferate by means of anti-human CD3/CD28 magnetic beads (purchased from Thermo Fisher company), where the concentration of re-suspended cells was 1×10.sup.6 cells/mL and the amount of magnetic beads added was 100 μL. Then 100 IU/mL rhIL-2 (Peprotech) was added to stimulate culture for 2 days to obtain T cells.

[0054] (3) Transfection of lentiviruses was carried out according to the following method: the lentiviruses packaged in step (1) were respectively added to three parts of T cells separated above, and then polybrene with a final concentration of 6 μg/mL was added, followed by uniform mixing and centrifugation at 32° C. and 800 g for 100 min. After centrifugation, the culture was continued in an incubator for 24 h. After the culture, the culture solution was centrifuged at 1500 rpm for 15 min, and the centrifuged cells were inoculated at a density of 1×10.sup.6/mL into a culture plate and stimulated for culture with rhIL2-100 IU/mL. After that, the medium was changed every 2-3 days until 2-4 weeks, and transfected T lymphocytes CAR-T 1, CAR-T 2 and CAR-T 3 were obtained. CAR-T 1 was transfected with the nucleotide sequence shown in SEQ ID NO. 4 and could express the fusion protein shown in SEQ ID NO. 3; CAR-T 2 was transfected with the nucleotide sequence shown in SEQ ID NO. 5 and could express the fusion protein shown in SEQ ID NO. 6; and CAR-T 3 was transfected with the empty vector.

[0055] After culture, the cells were re-suspended with PBS, and the ratio of the above three kinds of CAR-T cells and the expression of CAR protein on the surface were tested with a flow cytometer. The test method was as follows: the T cells to be tested after transfection were centrifuged and collected respectively, the supernatant was discarded after the T cells to be tested were washed with PBS once, and a corresponding test amount of monoclonal antibody was added according to antibody instructions, followed by PBS washing, re-suspension, filtration with a membrane, and sandwich test with a flow cytometer, where the antibody used for the test was a mixture of His-tag labeled CD44 and PE labeled anti-His-tag antibody. The results were shown in FIGS. 1-3.

[0056] FIG. 1 is a flow cytometer test result diagram of CAR-T 1 cells according to an embodiment of the disclosure;

[0057] FIG. 2 is a flow cytometry test result diagram of CAR-T 2 cells provided by an embodiment of the disclosure; and

[0058] FIG. 3 is a flow cytometry test result diagram of CAR-T 3 cells according to the embodiment of the disclosure.

[0059] As can be seen from FIG. 1 and FIG. 2, other cells different from normal T lymphocytes were detected out from the CAR-T 1 cells and the CAR-T 2 cells. As can be seen from FIG. 3, other cells different from normal T lymphocytes were not detected out from the CAR-T 3 cells. This showed that the CAR-T cells transfected with fusion genes in this example had successfully expressed the target fusion protein.

Example 3

[0060] This example was used to verify the ability of the CAR-T cells constructed in Example 2 to kill tumor cells.

[0061] Three kinds of CAR-T cells obtained by transfection and culture in Example 2 were respectively mixed with CD44 and CD133 positive glioma stem cells GSC20 according to different effect-target ratios (the number of T cells: the number of glioma stem cells). The mixed cells were cultured in 96-well plates, where each well contained 4×10.sup.4 glioma stem cells, and the reaction system was 200 μL per well. The culture conditions included: 37° C., 5% CO.sub.2, and culture in a saturated humidity incubator for 4 h.

[0062] Determination of lactate dehydrogenase activity: after centrifugation, 100 μL of supernatant was pipetted from each well and placed in 96-well enzyme-labeled plates, 100 μL of LDH substrate was added to each well, and the reaction was carried out at room temperature for 30 min without light. After the reaction, 50 μL of termination solution was added to each well to terminate the enzymatic reaction. The optical density (OD) was measured with a Microplate Reader 490 nm. The average optical density (OD) of each group was calculated, and the lysis rate of glioma stem cells by each kind of T cells was calculated according to the following formula. The results were shown in Table 1.


Lysis rate %=(OD of the experimental group−OD spontaneously released by glioma stem cells−OD naturally released by effector cells)/(maximum OD released by glioma stem cells OD spontaneously released by glioma stem cells)

TABLE-US-00007 TABLE 1 Lysis rate of glioma stem cells by CAR-T cells under different effect-target ratios (%) CAR-T cells 5:1 3:1 2:1 1:1 CAR-T 1 88.57% 69.12% 44.71% 31.75% CAR-T 2 80.87% 48.51% 40.93% 30.32% CAR-T 3 6.87% 2.63% 1.23% 2.41%

[0063] As can be seen from Table 1, the anti-TIM3 single-chain antibody provided by the disclosure can effectively improve the tumor immunocompetence of T lymphocytes and enhance the ability of T lymphocytes to kill tumor cells.

Comparative Example

[0064] Conventional second generation CAR-T cells (EGFR vIII-CD28-CD3) targeting a classical tumor target EGFR vIII were used to replace the T cells in Example 3, and then killing rates of glioma stem cells GSC20 by CAR-T under different effect-target ratios were tested according to the method of Example 3. The test result is shown in Table 2.

TABLE-US-00008 TABLE 2 Lysis rate of glioma stem cells by conventional second generation CAR-T cells under different effect-target ratios (%) Effect-target ratio 5:1 3:1 2:1 1:1 Conventional 17.57% 14.62% 13.97% 11.88% CAR-T

[0065] As can be seen from Table 2, the ability of the conventional second generation CAR-T cells targeting a classical tumor stem cell target EGFR vIII to kill glioma stem cells was weaker than that of the T cells expressing the anti-TIM3 single-chain antibody provided by the disclosure.

[0066] The preferred embodiments of the disclosure are described in detail above with reference to the accompanying drawings. However, the disclosure is not limited to the specific details in the above embodiments. Various simple variations may be made to the technical solutions of the disclosure within the scope of the technical idea of the disclosure, and these simple variations fall within the scope of the disclosure.

[0067] It should be further noted that the specific technical features described in the above specific embodiments may be combined in any suitable manner without contradiction. In order to avoid unnecessary repetition, the disclosure will not describe various possible combinations.

[0068] Moreover, the various different embodiments of the disclosure may be combined randomly without deviating from the idea of the disclosure, and the combinations should also be regarded as the disclosure of the disclosure.