Coronavirus T Cell Epitopes and Uses Thereof

Abstract

The present invention includes compositions and methods for detecting the presence of: a coronavirus or an immune response to a coronavirus infection including T cells responsive to one or more coronavirus peptides or proteins comprising, consisting of, or consisting essentially of: one or more amino acid sequences selected from SEQ ID NO: 1 to 1126, subsequences, portions, homologues, variants or derivatives; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 1126; a pool of peptides or proteins selected from the amino acid sequences set forth in SEQ ID NO: 1 to 1126; or a polynucleotide that encodes one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, subsequences, portions, homologues, variants or derivatives. The invention further provides vaccines, diagnostics, therapies, and kits, comprising such proteins or peptides.

Claims

1-157. (canceled)

158. A composition comprising monomers or multimers of: one or more peptides or proteins comprising, consisting of, or consisting essentially of: one or more SARS-CoV-2 amino acid sequences selected from SEQ ID NO: 1 to 1126, concatemers, subsequences, portions, homologues, variants or derivatives thereof; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 1126.

159. The composition of claim 158, wherein the one or more peptides or proteins or the fusion protein comprises, 22, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1125, or more amino acid sequences selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof.

160. The composition of claim 158, wherein the one or more protein or peptide comprises at least one of: a SARS-CoV-2 T cell epitope, a SARS-CoV-2 CD8+ or CD4+ T cell epitope, the SARS-CoV-2 T cell epitope is not conserved in another coronavirus, the SARS-CoV-2 T cell epitope is conserved in another coronavirus, or the one or more peptides or proteins exclude the amino acid sequences selected from SEQ ID NOS: 245-280 and 804-873.

161. The composition of claim 158, wherein one or more peptides or proteins has a length from about 9-15, 15-20, 20-25, 25-30, 30-40, 40-50, 50-75 or 75-100 amino acids.

162. The composition of claim 158, wherein the one or more peptides or proteins elicits, stimulates, induces, promotes, increases or enhances a T cell response to SARS-CoV-2, or wherein the one or more peptides or proteins that elicits, stimulates, induces, promotes, increases or enhances the T cell response to SARS-CoV-2 is a SARS-CoV-2 spike, nucleoprotein, membrane, replicase polyprotein 1ab, protein 3a, envelope small membrane protein, non-structural protein 3b, protein 7a, protein 9b, non-structural protein 6, or non-structural protein 8a protein or peptide, or a variant, homologue, derivative or subsequence thereof.

163. The composition of claim 158, further comprising formulating the one or more peptides or proteins into an immunogenic formulation with an adjuvant, wherein the adjuvant is selected from the group consisting of adjuvant is selected from the group consisting of alum, aluminum hydroxide, aluminum phosphate, calcium phosphate hydroxide, cytosine-guanosine oligonucleotide (CpG-ODN) sequence, granulocyte macrophage colony stimulating factor (GM-CSF), monophosphoryl lipid A (MPL), poly(I:C), MF59, Quil A, N-acetyl muramyl-L-alanyl-D-isoglutamine (MDP), FIA, montanide, poly (DL-lactide-coglycolide), squalene, virosome, AS03, ASO4, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, STING, CD40L, pathogen-associated molecular patterns (PAMPs), damage-associated molecular pattern molecules (DAMPs), Freund’s complete adjuvant, Freund’s incomplete adjuvant, transforming growth factor (TGF)-beta antibody or antagonists, A2aR antagonists, lipopolysaccharides (LPS), Fas ligand, Trail, lymphotactin, Mannan (M-FP), APG-2, Hsp70 and Hsp90, pattern recognition receptor ligands, TLR3 ligands, TLR4 ligands, TLR5 ligands, TLR⅞ ligands, and TLR9 ligands.

164. The composition of claim 158, wherein the composition further comprises a modulator of an immune response, an innate immune response, or the modulator is Interleukin-6 (IL-6), Interferon-gamma (IFN-g), Transforming growth factor beta (TGF-B), Interleukin-10 (IL-10), or an agonist or antagonist thereof.

165. A method for detecting the presence of: (i) SARS-CoV-2 or (ii) an immune response relevant to SARS-CoV-2 infections, vaccines or therapies, including T cells responsive to one or more SARS-CoV-2 peptides, comprising: providing one or more proteins or peptides for detection of an amount or a relative amount of, and/or the activity of, and/or the state of antigen-specific T-cells; contacting a biological sample suspected of having SARS-CoV-2-specific T-cells to one or more proteins or peptides for detection; and detecting an amount or a relative amount of, and/or the activity of, and/or the state of antigen-specific T-cells in the biological sample, wherein the one or more proteins or peptides for detection comprise one or more amino acid sequences set forth in SEQ ID NO: 1 to 873, or comprise a pool of 22, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1125, or more amino acid sequences set forth in SEQ ID NO: 1 to 1126.

166. A kit for the detection of SARS-CoV-2 or an immune response to SARS-CoV-2 in a subject comprising: one or more T cells that specifically detect the presence of: one or more amino acid sequences selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 1126; or a pool of 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1125 more peptides selected from the amino acid sequences set forth in SEQ ID NO: 1 to 1126.

167. The kit of claim 166, wherein the one or more amino acid sequences are selected from at least one of: a coronavirus T cell epitope set forth in SEQ ID NO:874 to 1126; wherein the one or more amino acid sequences comprises: one or more amino acid sequences selected from SEQ ID NO: 1 to 873, or a subsequence, portion, homologue, variant or derivative thereof; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 873; a pool of 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, or 873 more peptides selected from the amino acid sequences set forth in SEQ ID NO: 1 to 873; or the fusion protein has a length from about 9-15, 15-20, 20-25, 25-30, 30-40, 40-50, 50-75 or 75-100 amino acids a coronavirus CD8+ or CD4+ T cell epitope; the T cell epitope is not conserved in another coronavirus; or the T cell epitope is conserved in another coronavirus.

168. The kit of claim 166, wherein the kit includes instruction for a diagnostic method, a process, a composition, a product, a service or component part thereof for the detection of: (i) coronavirus or (ii) an immune response relevant to coronavirus infections, vaccines or therapies, including T cells responsive to coronavirus.

169. The kit of claim 166, wherein the kit includes reagents for detecting an amount or a relative amount of, and/or the activity of, and/or the state of antigen-specific T-cells in the biological sample comprises measuring one or more of a cytokine or lymphokine secretion assay, T cell proliferation, immunoprecipitation, immunoassay, ELISA, radioimmunoassay, immunofluorescence assay, Western Blot, FACS analysis, a competitive immunoassay, a noncompetitive immunoassay, a homogeneous immunoassay a heterogeneous immunoassay, a bioassay, a reporter assay, a luciferase assay, a microarray, a surface plasmon resonance detector, a florescence resonance energy transfer, immunocytochemistry, or a cell mediated assay, or a cytokine proliferation assay.

170. The kit of claim 166, wherein the kit includes reagents for determining a Human Leukocyte Antigen (HLA) profile of a subject, and selecting peptides that are presented by the HLA profile of the subject for detecting an immune response to coronavirus.

171. A method of stimulating, inducing, promoting, increasing, or enhancing an immune response against SARS-CoV-2 in a subject, comprising: administering to a subject an amount of a protein or peptide or a polynucleotide that expresses the protein or peptide comprising an amino acid sequence of the SARS-CoV-2 spike, nucleoprotein, membrane, replicase polyprotein 1ab, protein 3a, envelope small membrane protein, non-structural protein 3b, protein 7a, protein 9b, non-structural protein 6, or non-structural protein 8a protein or peptide, or a variant, homologue, derivative or subsequence thereof, wherein the protein or peptide comprises at least two peptides selected from the amino acid sequences set forth in SEQ ID NO:1 to 1126 or a subsequence, portion, homologue, variant or derivative thereof, in an amount sufficient to prevent, stimulate, induce, promote, increase, immunize against, or enhance an immune response against SARS-CoV-2 in the subject.

172. The method of claim 171, wherein the immune response provides the subject with protection against SARS-CoV-2 infection or pathology, or one or more physiological conditions, disorders, illnesses, diseases or symptoms caused by or associated with SARS-CoV-2 infection or pathology, reduces SARS-CoV-2 viral titer, increases or stimulates SARS-CoV-2 viral clearance, reduces or inhibits SARS-CoV-2 viral proliferation, reduces or inhibits increases in SARS-CoV-2 viral titer or SARS-CoV-2 viral proliferation, reduces the amount of a SARS-CoV-2 viral protein or the amount of a SARS-CoV-2 viral nucleic acid, or reduces or inhibits synthesis of a SARS-CoV-2 viral protein or a SARS-CoV-2 viral nucleic acid the SARS-CoV-2 infection is an acute infection, or the subject is a mammal or a human, or the immune response is to two or more circulating forms of SARS-CoV-2 or two or more coronaviruses.

173. The method of claim 171, wherein the one or more amino acid sequences are selected from at least one of: the one or more peptides selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 1126; or a pool of 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1125 more peptides selected from the amino acid sequences set forth in SEQ ID NO: 1 to 1126. the anti-SARS-CoV-2 T cell response is a CD8+, a CD4+ T cell response, or both; or the T cell epitope is conserved across two or more clinical isolates of SARS-CoV-2.

174. The method of claim 171, wherein the composition further comprising formulating the one or more peptides or proteins into an immunogenic formulation with an adjuvant, wherein the adjuvant is selected from the group consisting of adjuvant is selected from the group consisting of alum, aluminum hydroxide, aluminum phosphate, calcium phosphate hydroxide, cytosine-guanosine oligonucleotide (CpG-ODN) sequence, granulocyte macrophage colony stimulating factor (GM-CSF), monophosphoryl lipid A (MPL), poly(I:C), MF59, Quil A, N-acetyl muramyl-L-alanyl-D-isoglutamine (MDP), FIA, montanide, poly (DL-lactide-coglycolide), squalene, virosome, AS03, ASO4, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, STING, CD40L, pathogen-associated molecular patterns (PAMPs), damage-associated molecular pattern molecules (DAMPs), Freund’s complete adjuvant, Freund’s incomplete adjuvant, transforming growth factor (TGF)-beta antibody or antagonists, A2aR antagonists, lipopolysaccharides (LPS), Fas ligand, Trail, lymphotactin, Mannan (M-FP), APG-2, Hsp70 and Hsp90, pattern recognition receptor ligands, TLR3 ligands, TLR4 ligands, TLR5 ligands, TLR⅞ ligands, and TLR9 ligands, or a modulator of an immune response, an innate immune response, or the modulator is Interleukin-6 (IL-6), Interferon-gamma (IFN-y), Transforming growth factor beta (TGF-β), Interleukin-10 (IL-10), or an agonist or antagonist thereof.

175. A polynucleotide that expresses one or more peptides or proteins, comprising, an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 1126; or a pool of 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1125 or more peptides comprising, consisting of, or consisting essentially of amino acid sequences selected from SEQ ID NO: 1 to 1126.

176. A vector that comprises the polynucleotide of claim 175.

177. The vector of claim 176, wherein the vector is a viral vector.

178. A host cell that comprises the vector of claim 176.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0029] For a more complete understanding of the features and advantages of the present invention, reference is now made to the detailed description of the invention along with the accompanying figures and in which:

[0030] FIGS. 1A to 1E show SARS-CoV-2-specific T cell reactivity per protein. Immunodominance at the ORF/antigen level and breath of T cell responses are shown for CD4.sup.+ (FIG. 1A) and CD8.sup.+ (FIG. 1C) T cells. Data are shown as geometric mean ± geometric SD. The numbers of donors recognizing one or more antigens with a response >10%, normalized per donor to account for the differences in magnitude based on days PSO, are shown for CD4.sup.+ (FIG. 1B) and CD8.sup.+ (FIG. 1D) T cells. Empty circles represent CD4.sup.+ and CD8.sup.+ T cell reactivity per protein, respectively. Filled circles highlight the immunodominant antigens recognized by CD4.sup.+ and CD8.sup.+ T cells, respectively. FIG. 1E shows a flow chart of a scheme of experimental strategy selected for HLA class I and class II epitope identification, and representative graphs depicting the flow cytometry gating strategy for defining antigen-specific CD4.sup.+ and CD8.sup.+ T cells by OX40.sup.+CD137.sup.+ and CD69.sup.+CD137.sup.+ expression, respectively.

[0031] FIGS. 2A to 2L show SARS-CoV-2-specific CD4.sup.+ T cell reactivities and their correlations with antibody production and CD8.sup.+ T cell reactivity. RBD IgG serology is shown for all the donors of this cohort (FIG. 2A). Serology data of panel A are correlated with CD4.sup.+ T cell reactivities specific against all combined proteins (FIG. 2B), structural proteins S, M, and N (FIG. 2C), non-structural proteins nsp3, nsp4, nsp12, and nsp13 (FIG. 2D), and ORF8 and ORF3a (FIG. 2E). The total CD8.sup.+ T cell reactivity is correlated with the total CD4.sup.+ T cell reactivity (FIG. 2F) and the CD4.sup.+ T cell reactivity against structural proteins S, M, and N (FIG. 2G), non-structural proteins nsp3, nsp4, nsp12, and nsp13 (FIG. 2H), and ORF8 and ORF3a (FIG. 2I). Empty and filled circles represent correlation between CD4.sup.+ T cell reactivity and serology or CD8.sup.+ T cell reactivity, respectively. All analyses were performed using Spearman correlation and the p-values shown were not corrected for multiple hypothesis testing. FIGS. 2J to 2L shows the correlations of SARS-CoV-2-specific CD4+ and CD8+ T cell reactivities per protein. CD4+ and CD8+ T cell reactivities are correlated for each of the 9 SARS-CoV-2 antigens that were immunodominant for CD4+ T cells: S, M, and N (FIG. 2J); nsp3, nsp4, nsp12, and nsp13 (FIG. 2K); and ORF8 and ORF3a (FIG. 2L). All analyses were performed using Spearman correlation and the p-values shown were not corrected for multiple hypothesis testing.

[0032] FIG. 3A shows SARS-CoV-2 CD4+ T cell epitopes as a function of the number of responding donors recognized and strength of responses (FIG. 3A). These data highlight that 49 immunodominant epitopes account for 45% of the total response. Heat maps of HLA predicted binding patterns in the 27 most frequent HLA class II alleles worldwide (Greenbaum et al., 2011). Predicted binding patterns for the top 49 most immunodominant SARS-CoV-2 CD4+ T cell epitopes are compared with a set of matched non-epitopes. Predicted IC50 were calculated using NetMHCIIpan embedded in Tepitool (Dhanda et al., 2019; Karosiene et al., 2013; Paul et al., 2016) and converted to Log10 scale. Lower values indicate stronger predicted binding affinity, and are highlighted at the red end of the spectrum. Predicted values with an IC50 <1000 nM (Log10 scale <3) are considered positive binders (Paul et al., 2019; Southwood et al., 1998). FIGS. 3B to 3F show SARS-CoV-2 immunodominant epitope HLA class II binding capacity and promiscuity. A comparison of the HLA class II binding capacity of 49 immunodominant epitopes as determined by binding predictions or as measured experimentally (FIG. 3B), suggesting feasibility for using binding predictions to assess HLA-restriction. Predicted HLA class II binding promiscuity is shown for the same 49 epitopes (white circles), and also 49 non-epitopes (black circles), considering the 27 HLA class II alleles most frequent worldwide (FIGS. 3C-3D), or the 58 HLA class II alleles specific to the study cohort (FIGS. 3E-3F). The number of HLA class II alleles predicted to bind epitopes (white circles) and non-epitopes (black circles) are based on a prediction cutoff value of IC50<1000nM. Statistical comparisons were performed using Mann-Whitney.

[0033] FIGS. 4A to 4Q show the number of donors tested with their HLA-matched class I peptides for each of the 8 dominant proteins for CD8.sup.+ is shown in panel (FIG. 4A). The distribution of allele-specific CD8.sup.+ responses for the 18 class I alleles that were tested in 3 or more donors is shown as function of protein composition (FIG. 4B) or the HLA class I alleles tested (FIG. 4C). Bars to the right represent the total magnitude of AIM.sup.+ CD8.sup.+ T cells divided by the number of positive donors. Bars to the left represent the frequency of positive tests. The total number of epitopes identified for each class I allele is shown in panel (FIG. 4D). FIGS. 4E to 4J show HLA phenotype frequency in the COVID-19 cohort analyzed compared with the worldwide phenotype frequencies available in the IEDB-AR population coverage tool (Bui et al., 2006; Dhanda et al., 2019). HLA class I frequency for A and B loci for the top 28 HLA class I with frequency >5% in the worldwide population are shown in panels FIG. 4E and FIG. 4F, respectively. (FIG. 4G) Coverage of class I predicted peptides based on the HLA typing of the population. HLA class II frequency for DRB1, DP and DQ loci for the top HLA class II with frequency >5% in the worldwide population or the studied cohort are shown in panels FIGS. 4H, 4I, and 4J respectively. FIGS. 4K-4Q show analyses of CD4+ and CD8+ T cell epitopes identified compared to non-epitopes within the same proteins. Comparison of sequenced identity between CD4+ T cell epitopes and non-epitopes as a function of sequence identity with the CCC in S, M, and N combined (FIG. 4K), ORF8 and ORF3a (FIG. 4L), and non-structural proteins (FIG. 4M). For CD8+ epitopes and non-epitopes, the sequence identities with CCC are shown for S, M, and N (FIG. 4N), ORF3a (FIG. 4O), and non-structural proteins (FIG. 4P). Statistical analyses were performed using the Kolmogorov-Smirnov test, and data are shown as violin plots. (FIG. 4Q) Overlap of previously identified epitopes in unexposed (Mateus et al., 2020 Science) with the proteins analyzed in this study and the current epitopes identified in COVID-19 donors. The Venn diagram was calculated with the Venn Diagram Plotter (PNNL, OMICS.PNL.gov).

[0034] FIGS. 5A to 5L show the immunodominant regions for CD4.sup.+ T cell reactivity for S (FIG. 5A), N (FIG. 5B) and M (FIG. 5C) proteins as a function of the frequency of positive response (red) and total magnitude (black) in the topmost panel. The dotted red line indicates the cutoff of 20% frequency of positivity used to define the immunodominant regions boxed in red. The x-axis labels in this topmost panel indicate the middle position of the peptide. Binding promiscuity was calculated based on NetMHCIIpan predicted IC.sub.50 for the alleles present in the cohort of donors tested and is shown in grey on the upper middle panel. The lower middle panel shows the % homology of SARS-CoV-2 to the four most frequent CCC (229E, NL63, HKU1, and OC43) and the max value. The linear structure of each protein is drawn below the graph of homology (Cai et al., 2020; Zeng et al., 2020; UniProtKB - P59596 (VME1_SARS)). The magnitude of CD8.sup.+ responses to class I predicted epitopes is shown in the bottom panel, where black dots represent epitopes and grey dots represent non-epitopes, each centered on the middle position of the peptide. FIGS. 5D to 5L show correlations of predicted binding promiscuity to the alleles present in the donor cohort tested with the frequency of positive response for S (FIG. 5D), N (FIG. 5H), and M (FIG. 5J) epitopes. Frequency of positive response is also correlated with the maximum % homology of the SARS-CoV-2 sequence to CCC and plotted for S (FIG. 5E), M (FIG. 5F), and N (FIG. 5K). In the final column of panels, the correlation of frequency of positivity and the cleavage probability percentile rank (calculated using the IEDB MHCII-NP tool) are shown for S (FIG. 5F), N (FIG. 5I), and M (FIG. 5L). Statistics were performed using the Spearman correlation and the line on each graph is a simple linear regression.

[0035] FIGS. 6A to 6L show T cell responses to SARS-CoV-2 megapools as measured in AIM (empty circles) and FluoroSpot (filled in circles) assays. Twenty-five unexposed and 31 convalescent COVID-19 donors were tested in the AIM assays (FIG. 6A and FIG. 6C), and all donors were also tested in the FluoroSpot assays (FIG. 6B and FIG. 6D). CD4.sup.+ T cell responses to CD4-R+S (previously described), CD4-E (280 class II epitopes identified in this study), and EC Class II (Nelde et al 2020) megapools were measured via AIM (FIG. 6A) and FluoroSpot (FIG. 6B). CD8.sup.+ T cell responses to CD8-A+B (previously described), CD8-E (454 class I epitopes identified in this study), and EC Class I (Nelde et al 2020) megapools were measured via AIM (C) and FluoroSpot (FIG. 6D). Bars represent geometric mean ± geometric SD, and p-values were calculated by Mann-Whitney. Panels FIG. 6E- FIG. 6H show ROC analysis for CD4.sup.+ and CD8.sup.+ T cell response data in FluoroSpot (FIG. 6F- FIG. 6H) and AIM (FIG. 6E -FIG. 6G) assays. In each panel, curves are shown for the 3 peptide pools tested. For a given pool, T cell responses were used to classify individuals into predicted exposed’ or ‘predicted unexposed’, at varying thresholds starting with the highest observed response to the lowest. The inventors then compared these data with the actual SARS-CoV-2 exposure status of the individuals and calculated the rate of true positive (predicted exposed / total exposed) and the rate of false positives (predicted exposed / total non-exposed). Additionally, the inventors further tested 17 of these COVID-19 convalescent donors in FluoroSpot with a titration of 200, 50, 25, and 12.5×10.sup.3 cells per well with the indicated CD4-MPs (FIG. 6I- FIG. 6J) and CD8-MPs (FIG. 6K- FIG. 6L).

DETAILED DESCRIPTION OF THE INVENTION

[0036] While the making and using of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as “a”, “an” and “the” are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims. Unless specifically stated or obvious from context, as used herein, the term “or” is understood to be inclusive.

[0037] The term “gene” means the segment of DNA involved in producing a protein; it includes regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons). The leader, the trailer as well as the introns include regulatory elements that are necessary during the transcription and the translation of a gene. Further, a “protein gene product” is a protein expressed from a particular gene.

[0038] The word “expression” or “expressed” as used herein in reference to a gene means the transcriptional and/or translational product of that gene. The level of expression of a DNA molecule in a cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of protein encoded by that DNA produced by the cell. The level of expression of non-coding nucleic acid molecules (e.g., sgRNA) may be detected by standard PCR or Northern blot methods well known in the art. See, Sambrook et al., 1989 Molecular Cloning: A Laboratory Manual, 18.1-18.88.

[0039] The term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an α carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. The terms “non-naturally occurring amino acid” and “unnatural amino acid” refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.

[0040] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.

[0041] The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues, wherein the polymer may, in embodiments, be conjugated to a moiety that does not consist of amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. A “fusion protein” refers to a chimeric protein encoding two or more separate protein sequences that are recombinantly expressed as a single moiety.

[0042] Proteins and peptides include isolated and purified forms. Proteins and peptides also include those immobilized on a substrate, as well as amino acid sequences, subsequences, portions, homologues, variants, and derivatives immobilized on a substrate.

[0043] Proteins and peptides can be included in compositions, for example, a pharmaceutical composition. In particular embodiments, a pharmaceutical composition is suitable for specific or non-specific immunotherapy, or is a vaccine composition.

[0044] Isolated nucleic acid (including isolated nucleic acid) encoding the proteins and peptides are also provided. Cells expressing a protein or peptide are further provided. Such cells include eukaryotic and prokaryotic cells, such as mammalian, insect, fungal and bacterial cells.

[0045] Methods and uses and medicaments of proteins and peptides of the invention are included. Such methods, uses and medicaments include modulating immune activity of a cell against a pathogen, for example, a bacteria or virus.

[0046] The term “peptide mimetic” or “peptidomimetic” refers to protein-like chain designed to mimic a peptide or protein. Peptide mimetics may be generated by modifying an existing peptide or by designing a compound that mimic peptides, including peptoids and β-peptides.

[0047] “Conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, “conservatively modified variants” refers to those nucleic acids that encode identical or essentially identical amino acid sequences. Because of the degeneracy of the genetic code, a number of nucleic acid sequences will encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.

[0048] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the disclosure. The following eight groups each contain amino acids that are conservative substitutions for one another: (1) Alanine (A), Glycine (G); (2) Aspartic acid (D), Glutamic acid (E); (3) Asparagine (N), Glutamine (Q); (4) Arginine (R), Lysine (K); (5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); (6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); (7) Serine (S), Threonine (T); and (8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).

[0049] A “percentage of sequence identity” is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.

[0050] The terms “identical” or percent “identity,” in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site ncbi.nlm.nih.gov/BLAST/ or the like). Such sequences are then said to be “substantially identical.” This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.

[0051] An amino acid or nucleotide base “position” is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5′-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion. Where there is an insertion in an aligned reference sequence, that insertion will not correspond to a numbered amino acid position in the reference sequence. In the case of truncations or fusions there can be stretches of amino acids in either the reference or aligned sequence that do not correspond to any amino acid in the corresponding sequence.

[0052] The terms “numbered with reference to” or “corresponding to,” when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.

[0053] The term “multimer” refers to a complex comprising multiple monomers (e.g., a protein complex) associated by noncovalent bonds. The monomers be substantially identical monomers, or the monomers may be different. In embodiments, the multimer is a dimer, a trimer, a tetramer, or a pentamer.

[0054] As used herein, the term “Major Histocompatibility Complex” (MHC) is a generic designation meant to encompass the histocompatibility antigen systems described in different species including the human leucocyte antigens (HLA). Typically, MHC Class I or Class II multimers are well known in the art and include but are not limited to dimers, tetramers, pentamers, hexamers, heptamers and octamers.

[0055] As used herein, the term “MHC/peptide multimer” refers to a stable multimeric complex composed of MHC protein(s) subunits loaded with a peptide of the present invention. For example, an MHC/peptide multimer (also called herein MHC/peptide complex) include, but are not limited to, an MHC/peptide dimer, trimer, tetramer, pentamer or higher valency multimer. In humans there are three major different genetic loci that encode MHC class I molecules (the MHC molecules of the human are also designated human leukocyte antigens (HLA)): HLA-A, HLA-B, HLA-C, e.g., HLA-A*01, HLA-A*02, and HLA-A*11 are examples of different MHC class I alleles that can be expressed from these loci. Non-classical human MHC class I molecules such as HLA-E (homolog of mice Qa-1b) and MICA/B molecules are also encompassed by the present invention. In some embodiments, the MHC/peptide multimer is an HLA/peptide multimer selected from the group consisting of HLA-A/peptide multimer, HLA-B/peptide multimer, HLA-C/peptide multimer, HLA-E/peptide multimer, MICA/peptide multimer and MICB/peptide multimer.

[0056] In humans there are three major different genetic loci that encode MHC class II molecules: HLA-DR, HLA-DP, and HLA-DQ, each formed of two polypeptides, alpha and beta chains (A and B genes). For example, HLA-DQA1*01, HLA-DRB1 *01, and HLA-DRB1*03 are different MHC class II alleles that can be expressed from these loci. It should be further noted that non-classical human MHC class II molecules such as HLA-DM and HL-DOA (homolog in mice is H2-DM and H2-O) are also encompassed by the present invention. In some embodiments, the MHC/peptide multimer is an HLA/peptide multimer selected from the group consisting of HLA-DP/peptide multimer, HLA-DQ/peptide multimer, HLA-DR/peptide multimer, HLA-DM/peptide multimer and HLA-DO/peptide multimer.

[0057] An MHC/peptide multimer may be a multimer where the heavy chain of the MHC is biotinylated, which allows combination as a tetramer with streptavidin. MHC-peptide tetramers have increased avidity for the appropriate T cell receptor (TCR) on T lymphocytes. The multimers can also be attached to paramagnetic particles or magnetic beads to facilitate removal of non-specifically bound reporter and cell sorting. Multimer staining does not kill the labelled cells, thus, cell integrity is maintained for further analysis. In some embodiments, the MHC/peptide multimer of the present invention is particularly suitable for isolating and/or identifying a population of CD8+ T cells having specificity for the peptide of the present invention (in a flow cytometry assay).

[0058] The peptides or MHC class I or class II multimer as described herein is particularly suitable for detecting T cells specific for one or more peptides of the present invention. The peptide(s) and/or the MHC/multimer complex of the present invention is particularly suitable for diagnosing coronavirus infection in a subject. For example, the method comprises obtaining a blood or PBMC sample obtained from the subject with an amount of a least peptide of the present invention and detecting at least one T cell displaying a specificity for the peptide. Another diagnostic method of the present invention involves the use of a peptide of the present invention that is loaded on multimers as described above, so that the isolated CD8+ or CD4+ T cells from the subject are brought into contact with the multimers, at which the binding, activation and/or expansion of the T cells is measured. For example, following the binding to antigen presenting cells, e.g., those having the MHC class I or class II multimer, the number of CD8+ and/or CD4+ cells binding specifically to the HLA-peptide multimer may be quantified by measuring the secretion of lymphokines/cytokines, division of the T cells, or standard flow cytometry methods, such as, for example, using fluorescence activated cell sorting (FACS). The multimers can also be attached to paramagnetic ferrous or magnetic beads to facilitate removal of non-specifically bound reporter and cell sorting.

[0059] The MHC class I or class II peptide multimers as described herein can also be used as therapeutic agents. The peptide and/or the MHC class I or class II peptide multimers of the present invention are suitable for treating or preventing a coronavirus infection in a subject. The MHC Class I or Class II multimers can be administered in soluble form or loaded on nanoparticles.

[0060] The term “antibody” refers to a polypeptide encoded by an immunoglobulin gene or functional fragments thereof that specifically binds and recognizes an antigen. The recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively.

[0061] The phrase “specifically (or selectively) binds” to an antibody or “specifically (or selectively) immunoreactive with,” when referring to a protein or peptide, refers to a binding reaction that is determinative of the presence of the protein or peptide, often in a heterogeneous population of proteins and other biologics. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein at least two times the background and more typically more than 10 to 100 times background. Specific binding to an antibody under such conditions requires an antibody that is selected for its specificity for a particular protein. For example, polyclonal antibodies can be selected to obtain only a subset of antibodies that are specifically immunoreactive with the selected antigen and not with other proteins. This selection may be achieved by subtracting out antibodies that cross-react with other molecules. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Using Antibodies, A Laboratory Manual (1998) for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity).

[0062] Antibodies are large, complex molecules (molecular weight of ~150,000 or about 1320 amino acids) with intricate internal structure. A natural antibody molecule contains two identical pairs of polypeptide chains, each pair having one light chain and one heavy chain. Each light chain and heavy chain in turn consists of two regions: a variable (“V”) region involved in binding the target antigen, and a constant (“C”) region that interacts with other components of the immune system. The light and heavy chain variable regions come together in 3-dimensional space to form a variable region that binds the antigen (for example, a receptor on the surface of a cell). Within each light or heavy chain variable region, there are three short segments (averaging 10 amino acids in length) called the complementarity determining regions (“CDRs”). The six CDRs in an antibody variable domain (three from the light chain and three from the heavy chain) fold up together in 3-dimensional space to form the actual antibody binding site which docks onto the target antigen. The position and length of the CDRs have been precisely defined by Kabat, E. et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1983, 1987. The part of a variable region not contained in the CDRs is called the framework (“FR”), which forms the environment for the CDRs.

[0063] The term “antibody” is used according to its commonly known meaning in the art. Antibodies exist, e.g., as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases. Thus, for example, pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)′.sub.2, a dimer of Fab which itself is a light chain joined to V.sub.H-C.sub.H1 by a disulfide bond. The F(ab)′.sub.2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)′.sub.2 dimer into a Fab′ monomer. The Fab′ monomer is essentially Fab with part of the hinge region (see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries (see, e.g., McCafferty et al., Nature 348:552-554 (1990)).

[0064] An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kD) and one “heavy” chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains respectively. The Fc (i.e., fragment crystallizable region) is the “base” or “tail” of an immunoglobulin and is typically composed of two heavy chains that contribute two or three constant domains depending on the class of the antibody. By binding to specific proteins, the Fc region ensures that each antibody generates an appropriate immune response for a given antigen. The Fc region also binds to various cell receptors, such as Fc receptors, and other immune molecules, such as complement proteins.

[0065] As used herein, the term “antigen” and the term “epitope” refers to a molecule or substance capable of stimulating an immune response. In one example, epitopes include but are not limited to a polypeptide and a nucleic acid encoding a polypeptide, wherein expression of the nucleic acid into a polypeptide is capable of stimulating an immune response when the polypeptide is processed and presented on a Major Histocompatibility Complex (MHC) molecule. Generally, epitopes include peptides presented on the surface of cells non-covalently bound to the binding groove of Class I or Class II MHC, such that they can interact with T cell receptors and the respective T cell accessory molecules. However, antigens and epitopes also apply when discussing the antigen binding portion of an antibody, wherein the antibody binds to a specific structure of the antigen.

[0066] Proteolytic Processing of Antigens. Epitopes that are displayed by MHC on antigen presenting cells are cleavage peptides or products of larger peptide or protein antigen precursors. For MHC I epitopes, protein antigens are often digested by proteasomes resident in the cell. Intracellular proteasomal digestion produces peptide fragments of about 3 to 23 amino acids in length that are then loaded onto the MHC protein. Additional proteolytic activities within the cell, or in the extracellular milieu, can trim and process these fragments further. Processing of MHC Class II epitopes generally occurs via intracellular proteases from the lysosomal/endosomal compartment. The present invention includes, in one embodiment, pre-processed peptides that are attached to the anti-CD40 antibody (or fragment thereof) that directs the peptides against which an enhanced immune response is sought directly to antigen presenting cells.

[0067] The present invention includes methods for specifically identifying the epitopes within antigens most likely to lead to the immune response sought for the specific sources of antigen presenting cells and responder T cells.

[0068] As used herein, the term “T cell epitope” refers to a specific amino acid that when present in the context of a Major or Minor Histocompatibility Complex provides a reactive site for a T cell receptor. The T-cell epitopes or peptides that stimulate the cellular arm of a subject’s immune system are short peptides of about 8-25 amino acids. T-cell epitopes are recognized by T cells from animals that are immune to the antigen of interest. These T-cell epitopes or peptides can be used in assays such as the stimulation of cytokine release or secretion or evaluated by constructing major histocompatibility (MHC) proteins containing or “presenting” the peptide. Such immunogenically active fragments are often identified based on their ability to stimulate lymphocyte proliferation in response to stimulation by various fragments from the antigen of interest.

[0069] As used herein, the term “immunological response” refers to an antigen or composition is the development in a subject of a humoral and/or a cellular immune response to an antigen present in the composition of interest. For purposes of the present disclosure, a “humoral immune response” refers to an immune response mediated by antibody molecules, while a “cellular immune response” is one mediated by T-lymphocytes and/or other white blood cells. One important aspect of cellular immunity involves an antigen-specific response by cytolytic T-cells (“CTL”s). CTLs have specificity for peptide antigens that are presented in association with proteins encoded by the major histocompatibility complex (MHC) and expressed on the surfaces of cells. CTLs help induce and promote the destruction of intracellular microbes, or the lysis of cells infected with such microbes. Another aspect of cellular immunity involves an antigen-specific response by helper T-cells. Helper T-cells act to help stimulate the function, and focus the activity of, nonspecific effector cells against cells displaying peptide antigens in association with MHC molecules on their surface. A “cellular immune response” also refers to the production of cytokines, chemokines and other such molecules produced by activated T-cells and/or other white blood cells, including those derived from CD4+ and CD8+ T-cells. Hence, an immunological response may include one or more of the following effects: the production of antibodies by B-cells; and/or the activation of effector and/or suppressor T-cells and/or gamma-delta T-cells directed specifically to an antigen or antigens present in the composition or vaccine of interest. These responses may serve to neutralize infectivity, and/or mediate antibody-complement, or antibody dependent cell cytotoxicity (ADCC) to provide protection to an immunized host. Such responses can be determined using standard immunoassays and neutralization assays, well known in the art.

[0070] As used herein, the term an “immunogenic composition” and “vaccine” refer to a composition that comprises an antigenic molecule where administration of the composition to a subject or patient results in the development in the subject of a humoral and/or a cellular immune response to the antigenic molecule of interest. “Vaccine” refers to a composition that can provide active acquired immunity to and/or therapeutic effect (e.g., treatment) of a particular disease or a pathogen. A vaccine typically contains one or more agents that can induce an immune response in a subject against a pathogen or disease, i.e., a target pathogen or disease. The immunogenic agent stimulates the body’s immune system to recognize the agent as a threat or indication of the presence of the target pathogen or disease, thereby inducing immunological memory so that the immune system can more easily recognize and destroy any of the pathogen on subsequent exposure. Vaccines can be prophylactic (e.g., preventing or ameliorating the effects of a future infection by any natural or pathogen) or therapeutic (e.g., reducing symptoms or aberrant conditions associated with infection). The administration of vaccines is referred to vaccination. In some examples, a vaccine composition can provide nucleic acid, e.g., mRNA that encodes antigenic molecules (e.g., peptides) to a subject. The nucleic acid that is delivered via the vaccine composition in the subject can be expressed into antigenic molecules and allow the subject to acquire immunity against the antigenic molecules. In the context of the vaccination against infectious disease, the vaccine composition can provide mRNA encoding antigenic molecules that are associated with a certain pathogen, e.g., one or more peptides that are known to be expressed in the pathogen (e.g., pathogenic bacterium or virus).

[0071] The present invention provides nucleic acid molecules, specifically polynucleotides, primary constructs and/or mRNA that encode one or more polynucleotides that express one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof for use in immune modulation. The term “nucleic acid” refers to any compound and/or substance that comprise a polymer of nucleotides, referred to herein as polynucleotides. Exemplary nucleic acids or polynucleotides of the invention include, but are not limited to, ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs), including diastereomers of LNAs, functionalized LNAs, or hybrids thereof.

[0072] One method of immune modulation of the present invention includes direct or indirect gene transfer, i.e., local application of a preparation containing the one or more polynucleotides (DNA, RNA, mRNA, etc.) that expresses the one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof. A variety of well-known vectors can be used to deliver to cells the one or more polynucleotides or the peptides or proteins expressed by the polynucleotides, including but not limited to adenoviral vectors and adeno-associated vectors. In addition, naked DNA, liposome delivery methods, or other novel vectors developed to deliver the polynucleotides to cells can also be beneficial. Any of a variety of promoters can be used to drive peptide or protein expression, including but not limited to endogenous promoters, constitutive promoters (e.g., cytomegalovirus, adenovirus, or SV40), inducible promoters (e.g., a cytokine promoter such as the interleukin-1, tumor necrosis factor-alpha, or interleukin-6 promoter), and tissue specific promoters to express the immunogenic peptides or proteins of the present invention.

[0073] The immunization may include adenovirus, adeno-associated virus, herpes virus, vaccinia virus, retroviruses, or other viral vectors with the appropriate tropism for cells likely to present the antigenic peptide(s) or protein(s) may be used as a gene transfer delivery system for a therapeutic peptide(s) or protein(s), comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof, gene expression construct. Viral vectors which do not require that the target cell be actively dividing, such as adenoviral and adeno-associated vectors, are particularly useful when the cells are accumulating, but not proliferative. Numerous vectors useful for this purpose are generally known (Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244:1275-1281, 1989; Eglitis and Anderson, BioTechniques 6:608-614, 1988; Tolstoshev and Anderson, Current Opinion in Biotechnology 1:55-61, 1990; Sharp, The Lancet 337:1277-1278, 1991; Cornetta et al., Nucleic Acid Research and Molecular Biology 36:311-322, 1987; Anderson, Science 226:401-409, 1984; Moen, Blood Cells 17:407-416, 1991; and Miller and Rosman, Bio Techniques 7:980-990, 1989; Le Gal La Salle et al., Science 259:988-990, 1993; and Johnson, Chest 107:77S-83S, 1995). Retroviral vectors are particularly well developed and have been used in clinical settings (Rosenberg et al., N. Engl. J. Med 323:370, 1990; Anderson et al., U.S. Pat. No. 5,399,346).

[0074] The immunization may also include inserting the one or more polynucleotides (DNA, RNA, mRNA, etc.) that express the one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof into the viral vector, along with another gene which encodes the ligand for a receptor on a specific target cell, for example, such that the vector is now target specific. Viral vectors can be made target specific by attaching, for example, a sugar, a glycolipid, or a protein. Targeting can also be accomplished by using an antibody to target the viral vector. Those of skill in the art will know of, or can readily ascertain without undue experimentation, specific polynucleotide sequences which can be inserted into the viral genome or attached to a viral envelope to allow target specific delivery of the viral vector containing the gene.

[0075] Since recombinant viruses are defective, they require assistance in order to produce infectious vector particles. This assistance can be provided, for example, by using helper cell lines that contain plasmids encoding all of the structural genes of the virus under the control of regulatory sequences within the viral genome. These plasmids are missing a nucleotide sequence which enables the packaging mechanism to recognize a polynucleotide transcript for encapsidation. These cell lines produce empty virions, since no genome is packaged. If a viral vector is introduced into such cells in which the packaging signal is intact, but the structural genes are replaced by other genes of interest, the vector can be packaged and vector virion produced.

[0076] Viral or non-viral approaches may also be employed for the introduction of one or more therapeutic polynucleotides that express the one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof, into polynucleotide-encoding polynucleotide into antigen presenting cells. The polynucleotides may be DNA, RNA, mRNA that directly encode the one or more peptides or proteins of the present invention, or may be introduced as part of an expression vector. Another example of an immunization includes colloidal dispersion systems that include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes and the one or more polynucleotides that express the one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof. One non-limiting example of a colloidal system for use with the present invention is a liposome. Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. It has been shown that large unilamellar vesicles (LUV), which range in size from 0.2-4.0 micrometers that can encapsulate a substantial percentage of an aqueous buffer containing large macromolecules. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (Fraley, et al., Trends Biochem. Sci., 6:77, 1981). In addition to mammalian cells, liposomes have been used for delivery of polynucleotides in plant, yeast and bacterial cells. In order for a liposome to be an efficient gene transfer vehicle, the following characteristics should be present: (Zakut and Givol, supra) encapsulation of the genes of interest at high efficiency while not compromising their biological activity; (Fearnhead, et al., supra) preferential and substantial binding to a target cell in comparison to non-target cells; (Korsmeyer, S. J., supra) delivery of the aqueous contents of the vesicle to the target cell cytoplasm at high efficiency; and (Kinoshita, et al., supra) accurate and effective expression of genetic information (Mannino, et al., Bio Techniques, 6:682, 1988).

[0077] The composition for immunizing the subject or patient may, in certain embodiments comprise a combination of phospholipid, particularly high-phase-transition-temperature phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used. The physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations. The targeting of liposomes can be classified based on anatomical and mechanistic factors. Anatomical classification is based on the level of selectivity, for example, organ-specific, cell-specific, and organelle-specific. Mechanistic targeting can be distinguished based upon whether it is passive or active. Passive targeting utilizes the natural tendency of liposomes to distribute to cells of the reticuloendothelial system (RES) in organs which contain sinusoidal capillaries. Active targeting, on the other hand, involves alteration of the liposome by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein, or by changing the composition or size of the liposome in order to achieve targeting to organs and cell types other than the naturally occurring sites of localization, specifically, cells that can become infected with a coronavirus or interact with the proteins, peptides, and/or gene products of a coronavirus, e.g., immune cells.

[0078] For any of the above approaches, the immune modulating polynucleotide construct, composition, or formulation is preferably applied to a site that will enhance the immune response. For example, the immunization may be intramuscular, intraperitoneal, enteral, parenteral, intranasal, intrapulmonary, or subcutaneous. In the gene delivery constructs of the instant invention, polynucleotide expression is directed from any suitable promoter (e.g., the human cytomegalovirus, simian virus 40, actin or adenovirus constitutive promoters; or the cytokine or metalloprotease promoters for activated synoviocyte specific expression).

[0079] In one example of the immune modifying peptide(s) or protein(s) include polynucleotides, constructs and/or mRNAs that express the one or more polynucleotides that express the one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof, that are designed to improve one or more of the stability and/or clearance in tissues, uptake and/or kinetics, cellular access by the peptide(s) or protein(s), translational, mRNA half-life, translation efficiency, immune evasion, protein production capacity, accessibility to circulation, peptide(s) or protein(s) half-life and/or presentation in the context of MHC on antigen presenting cells.

[0080] The present invention contemplates immunization for use in both active and passive immunization embodiments. Immunogenic compositions, proposed to be suitable for use as a vaccine, may be prepared most readily directly from immunogenic peptides, proteins, monomers, multimers and/or peptide-MHC complexes prepared in a manner disclosed herein. The antigenic material is generally processed to remove undesired contaminants, such as, small molecular weight molecules, incomplete proteins, or when manufactured in plant cells, plant components such as cell walls, plant proteins, and the like. Often, these immunizations are lyophilized for ease of transport and/or to increase shelf-life and can then be more readily dissolved in a desired vehicle, such as saline.

[0081] The preparation of immunizations (also referred to as vaccines) that contain the immunogenic proteins of the present invention as active ingredients is generally well understood in the art, as exemplified by U.S. Letters Pats. 4,608,251; 4,601,903; 4,599,231; 4,599,230; 4,596,792; and 4,578,770, all incorporated herein by reference. Typically, such immunizations are prepared as injectables. The immunizations can be a liquid solution or suspension but may also be provided in a solid form suitable for solution in, or suspension in, liquid prior to injection may also be prepared. The preparation may also be emulsified. The active immunogenic ingredient is often mixed with excipients that are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, buffers, or the like and combinations thereof. In addition, if desired, the immunization may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, or adjuvants which enhance the effectiveness of the vaccines. The immunization is/are administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective and immunogenic. The quantity to be administered depends on the subject to be treated, including, e.g., the capacity of the individual’s immune system to synthesize antibodies, and the degree of protection desired. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner. However, suitable dosage ranges are of the order of several hundred micrograms active ingredient per vaccination. Suitable regimes for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations.

[0082] The manner of application of the immunization may be varied widely. Any of the conventional methods for administration of a vaccine are applicable. These are believed to also include oral application on a solid physiologically acceptable base or in a physiologically acceptable dispersion, parenterally, by injection or the like. The dosage of the vaccine will depend on the route of administration and will vary according to the size of the host.

[0083] Various methods of achieving adjuvant effect for the vaccine includes use of agents such as aluminum hydroxide or phosphate (alum), commonly used as 0.05 to 0.1 percent solution in phosphate buffered saline, admixture with synthetic polymers of sugars (Carbopol) used as 0.25 percent solution, aggregation of the protein in the vaccine by heat treatment with temperatures ranging between 70° to 101° C. for 30 second to 2-minute periods respectively. Aggregation by reactivating with pepsin treated (Fab) antibodies to albumin, mixture with bacterial cells such as C. parvum or endotoxins or lipopolysaccharide components of gram-negative bacteria, emulsion in physiologically acceptable oil vehicles such as mannide mono-oleate (Aracel A) or emulsion with 20 percent solution of a perfluorocarbon (Fluosol-DA) used as a block substitute may also be employed.

[0084] In many instances, it will be desirable to have multiple administrations of the vaccine, usually not exceeding six to ten immunizations, more usually not exceeding four immunizations and preferably one or more, usually at least about three immunizations. The immunizations will normally be at from two to twelve-week intervals, more usually from three to five-week intervals. Periodic boosters at intervals of 1-5 years, usually three years, will be desirable to maintain protective levels of the antibodies. The course of the immunization may be followed by assays for antibodies for the supernatant antigens. The assays may be performed by labeling with conventional labels, such as radionuclides, enzymes, fluorescent agents, and the like. These techniques are well known and may be found in a wide variety of patents, such as Hudson and Cranage, Vaccine Protocols, 2003 Humana Press, relevant portions incorporated herein by reference.

[0085] Techniques and compositions for making useful dosage forms using the present invention are described in one or more of the following references: Anderson, Philip O.; Knoben, James E.; Troutman, William G, eds., Handbook of Clinical Drug Data, Tenth Edition, McGraw-Hill, 2002; Pratt and Taylor, eds., Principles of Drug Action, Third Edition, Churchill Livingston, New York, 1990; Katzung, ed., Basic and Clinical Pharmacology, Ninth Edition, McGraw Hill, 2007; Goodman and Gilman, eds., The Pharmacological Basis of Therapeutics, Tenth Edition, McGraw Hill, 2001; Remington’s Pharmaceutical Sciences, 20th Ed., Lippincott Williams & Wilkins., 2000, and updates thereto; Martindale, The Extra Pharmacopoeia, Thirty-Second Edition (The Pharmaceutical Press, London, 1999); all of which are incorporated by reference, and the like, relevant portions incorporated herein by reference.

[0086] Many suitable expression systems are commercially available, including, for example, the following: baculovirus expression (Reilly, P. R., et al., BACULOVIRUS EXPRESSION VECTORS: A LABORATORY MANUAL (1992); Beames, et al., Biotechniques 11:378 (1991); Pharmingen; Clontech, Palo Alto, Calif.)), vaccinia expression systems (Earl, P. L., et al., “Expression of proteins in mammalian cells using vaccinia” In Current Protocols in Molecular Biology (F. M. Ausubel, et al. Eds.), Greene Publishing Associates & Wiley Interscience, New York (1991); Moss, B., et al., U.S. Pat. No. 5,135,855, issued Aug. 4, 1992), expression in bacteria (Ausubel, F. M., et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley and Sons, Inc., Media Pa.; Clontech), expression in yeast (Rosenberg, S. and Tekamp-Olson, P., U.S. Pat. No. RE35,749, issued, Mar. 17, 1998, herein incorporated by reference; Shuster, J. R., U.S. Pat. No. 5,629,203, issued May 13, 1997, herein incorporated by reference; Gellissen, G., et al., Antonie Van Leeuwenhoek, 62(1-2):79-93 (1992); Romanos, M. A., et al., Yeast 8(6):423-488 (1992); Goeddel, D. V., Methods in Enzymology 185 (1990); Guthrie, C., and G. R. Fink, Methods in Enzymology 194 (1991)), expression in mammalian cells (Clontech; Gibco-BRL, Ground Island, N.Y.; e.g., Chinese hamster ovary (CHO) cell lines (Haynes, J., et al., Nuc. Acid. Res. 11:687-706 (1983); 1983, Lau, Y. F., et al., Mol. Cell. Biol. 4:1469-1475 (1984); Kaufman, R. J., “Selection and coamplification of heterologous genes in mammalian cells,” in Methods in Enzymology, vol. 185, pp 537-566. Academic Press, Inc., San Diego Calif. (1991)), and expression in plant cells (plant cloning vectors, Clontech Laboratories, Inc., Palo-Alto, Calif., and Pharmacia LKB Biotechnology, Inc., Pistcataway, N.J.; Hood, E., et al., J. Bacteriol. 168:1291-1301 (1986); Nagel, R., et al., FEMS Microbiol. Lett. 67:325 (1990); An, et al., “Binary Vectors”, and others in Plant Molecular Biology Manual A3:1-19 (1988); Miki, B. L. A., et al., pp. 249-265, and others in Plant DNA Infectious Agents (Hohn, T., et al., eds.) Springer-Verlag, Wien, Austria, (1987); Plant Molecular Biology: Essential Techniques, P. G. Jones and J. M. Sutton, New York, J. Wiley, 1997; Miglani, Gurbachan Dictionary of Plant Genetics and Molecular Biology, New York, Food Products Press, 1998; Henry, R. J., Practical Applications of Plant Molecular Biology, New York, Chapman & Hall, 1997), relevant portion incorporated herein by reference.

[0087] As used herein, the term “effective amount” or “effective dose” refers to that amount of the peptide or protein T cell epitopes of the invention sufficient to induce immunity, to prevent and/or ameliorate an infection or to reduce at least one symptom of an infection and/or to enhance the efficacy of another dose of peptide or protein T cell epitopes. An effective dose may refer to the amount of peptide or protein T cell epitopes sufficient to delay or minimize the onset of an infection. An effective dose may also refer to the amount of peptide or protein T cell epitopes that provides a therapeutic benefit in the treatment or management of an infection. Further, an effective dose is the amount with respect to peptide or protein T cell epitopes of the invention alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment or management of an infection. An effective dose may also be the amount sufficient to enhance a subject’s (e.g., a human’s) own immune response against a subsequent exposure to an infectious agent. Levels of immunity can be monitored, e.g., by measuring amounts of neutralizing secretory and/or serum antibodies, e.g., by plaque neutralization, complement fixation, enzyme-linked immunosorbent, or microneutralization assay. In the case of a vaccine, an “effective dose” is one that prevents disease and/or reduces the severity of symptoms. A “reduction” of a symptom or symptoms (and grammatical equivalents of this phrase) means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s). A “prophylactically effective amount” of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms, in this case, an infectious disease, and more particularly, a coronavirus infection. The full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products. For example, for the given parameter, an effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Efficacy can also be expressed as “-fold” increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.

[0088] The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins), relevant portions incorporated herein by reference.

[0089] As used herein, the term “immune stimulator” refers to a compound that enhances an immune response via the body’s own chemical messengers (cytokines). These molecules comprise various cytokines, lymphokines and chemokines with immunostimulatory, immunopotentiating, and pro-inflammatory activities, such as interferons, interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-12, IL-13); growth factors (e.g., granulocyte-macrophage (GM)-colony stimulating factor (CSF)); and other immunostimulatory molecules, such as macrophage inflammatory factor, Flt3 ligand, B7.1; B7.2, etc. The immune stimulator molecules can be administered in the same formulation as peptide or protein T cell epitopes s of the invention, or can be administered separately. Either the protein or an expression vector encoding the protein can be administered to produce an immunostimulatory effect.

[0090] As used herein, in certain embodiments, the term “protective immune response” or “protective response” refers to an immune response mediated by antibodies against an infectious agent, which is exhibited by a vertebrate (e.g., a human), which prevents or ameliorates an infection or reduces at least one symptom thereof. Peptide and protein T cell epitopes of the invention can stimulate the production of antibodies that, for example, neutralize infectious agents, blocks infectious agents from entering cells, blocks replication of said infectious agents, and/or protect host cells from infection and destruction. In other embodiments, the term can also refer to an immune response that is mediated by T-lymphocytes and/or other white blood cells against an infectious agent, exhibited by a vertebrate (e.g., a human), that prevents or ameliorates flavivirus infection or reduces at least one symptom thereof. Peptide and protein T cell epitopes of the invention can stimulate the T cell responses that, for example, neutralize infectious agents, kill virus infected cells, blocks infectious agents from entering cells, blocks replication of said infectious agents, and/or protect host cells from infection and destruction.

[0091] The terms “biological sample” or “sample” refer to materials obtained from or derived from a subject or patient. A biological sample includes sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histological purposes. Such samples include bodily fluids such as blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), sputum, tissue, cultured cells (e.g., primary cultures, explants, and transformed cells) stool, urine, synovial fluid, joint tissue, synovial tissue, synoviocytes, fibroblast-like synoviocytes, macrophage-like synoviocytes, immune cells, hematopoietic cells, fibroblasts, macrophages, T cells, etc. A biological sample is typically obtained from a eukaryotic organism, such as a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or a bird; reptile; or fish.

[0092] The terms “virus” or “virus particle” are used according to its plain ordinary meaning within Virology and refers to a virion including the viral genome (e.g., DNA, RNA, single strand, double strand), viral capsid and associated proteins, and in the case of enveloped viruses (e.g., herpesvirus), an envelope including lipids and optionally components of host cell membranes, and/or viral proteins.

[0093] In embodiments, the virus is a coronavirus. Non-limiting examples of coronaviruses (CoV) from which T cell epitopes can be identified include, e.g., SARS-CoV (SARS-CoV-1), MERS-CoV, and SARS-CoV-2, but also betacoronaviruses, e.g., HCoV-OC43, HCoVHKU1, HCoV-229E and alphacoronaviuses such as HCoV-NL63, and/or other coronaviruses endemic in humans. The viral genome of coronaviruses encodes at least the following structure proteins, the spike (S), envelope (E), membrane (M), and nucleocapsid (N) proteins. The S glycoprotein is responsible for binding the host receptor via the receptor-binding domain (RBD) in its S1 subunit, as well as the subsequent membrane fusion and viral entry driven by its S2 subunit. Gene sequencing of SARS-CoV-2 showed that this novel coronavirus, a betacoronavirus, is related to the MERS-CoV and the SARS-CoV. SARS-CoV, MERS-CoV, and SARS-CoV-2 belong to the betacoronavirus genus and are highly pathogenic zoonotic viruses. Thus, the present invention can be used not only to determine antigenic peptides from the three highly pathogenic betacoronaviruses, but also low-pathogenicity betacoronaviruses, such as, HCoV-OC43, HCoVHKU1, HCoV-NL63 and HCoV-229E, are also endemic in humans. In certain specific embodiments, the coronavirus is SARS-CoV-2, including novel mutants of SARS-CoV-2 that include mutants from five clades (19A, 19B, 20A, 20B, and 20C) according to Nextstrain, in GISAID nomenclature which divides them into seven clades (L, O, V, S, G, GH, and GR), and/or PANGOLIN nomenclature which divides them into six major lineages (A, B, B.1, B.1.1, B.1.177, B.1.1.7). Notable mutations of SARS-CoV-2 include, e.g., D614G, P681H, N501Y, 69-70del, P681H, Y453F, 69-70deltaHV, N501Y, K417N, E484K, N501Y, and E484K.

[0094] As used herein, a “cell” refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA. A cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring. Cells may include prokaryotic and eukaryotic cells. Prokaryotic cells include but are not limited to bacteria. Eukaryotic cells include but are not limited to yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., spodoptera) and human cells. Cells may be useful when they are naturally nonadherent or have been treated not to adhere to surfaces, for example by trypsinization.

[0095] As used herein, the term “contacting” is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species to become sufficiently proximal to react, interact or physically touch. It should be appreciated, however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture. The term “contacting” may include allowing two species to react, interact, or physically touch, wherein the two species may be, for example, an amino acid sequence, protein, or peptide as provided herein and an immune cell, such as a T cell.

[0096] As used herein, a “control” sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample. For example, a test sample can be taken from a test condition, e.g., in the presence of a test compound, and compared to samples from known conditions, e.g., in the absence of the test compound (negative control), or in the presence of a known compound (positive control). A control can also represent an average value gathered from a number of tests or results. One of skill in the art will recognize that controls can be designed for assessment of any number of parameters. For example, a control can be devised to compare therapeutic benefit based on pharmacological data (e.g., half-life) or therapeutic measures (e.g., comparison of side effects). One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are widely variant in controls, variation in test samples will not be considered as significant.

[0097] The term “modulator” refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule relative to the absence of the modulator.

[0098] The term “modulate” is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties. “Modulation” refers to the process of changing or varying one or more properties. For example, as applied to the effects of a modulator on a target protein, to modulate means to change by increasing or decreasing a property or function of the target molecule or the amount of the target molecule.

[0099] The terms “associated” or “associated with” in the context of a substance or substance activity or function associated with a disease (e.g. a protein associated disease, a cancer (e.g., cancer, inflammatory disease, autoimmune disease, or infectious disease)) means that the disease (e.g. cancer, inflammatory disease, autoimmune disease, or infectious disease) is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function. As used herein, what is described as being associated with a disease, if a causative agent, could be a target for treatment of the disease.

[0100] The term “aberrant” as used herein refers to different from normal. When used to describe enzymatic activity or protein function, aberrant refers to activity or function that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non-disease-associated amount (e.g., by administering a compound or using a method as described herein), results in reduction of the disease or one or more disease symptoms.

[0101] The terms “subject” or “subject in need thereof” refers to a living organism who is at risk of or prone to having a disease or condition, or who is suffering from a disease or condition that can be treated by administration of a composition or pharmaceutical composition as provided herein. Non-limiting examples include humans and other primates, but also includes non-human primates such as chimpanzees and other apes and monkey species; farm animals such as cattle, sheep, pigs, goats and horses; domestic mammals such as dogs and cats; laboratory animals including rodents such as mice, rats and guinea pigs; birds, including domestic, wild and game birds such as chickens, turkeys and other gallinaceous birds, ducks, geese, and the like. The term does not denote a particular age. Thus, both adult and newborn individuals are intended to be covered. The system described above is intended for use in any of the above vertebrate species, since the immune systems of all of these vertebrates operate similarly.

[0102] The terms “disease” or “condition” refer to a state of being or health status of a patient or subject capable of being treated with a compound, pharmaceutical composition, or method provided herein.

[0103] In embodiments, a patient or subject is human. In embodiments, the disease is coronavirus infection.

[0104] In certain alternative embodiments, the disease is SARS-CoV-2 infection. In still other embodiments, the disease is COVID-19.

[0105] As used herein, “treatment” or “treating,” or “palliating” or “ameliorating” are used interchangeably herein. These terms refer to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated or the disorder resulting from viral infection. Also, a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with viral infection or the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient may still be afflicted with the underlying disorder or may still be infected. For prophylactic benefit, the compositions may be administered to a patient at risk of viral infection, of developing a particular disease, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made. Treatment includes preventing the infection or disease, that is, causing the clinical symptoms of the disease not to develop by administration of a protective composition prior to infection or the induction of the disease; suppressing the disease, that is, causing the clinical symptoms of the disease or infection not to develop by administration of a protective composition after the inductive event or infection but prior to the clinical appearance or reappearance of the disease; inhibiting the disease, that is, arresting the development of clinical symptoms by administration of a protective composition after their initial appearance; preventing re-occurring of the disease and/or relieving the disease, that is, causing the regression of clinical symptoms by administration of a protective composition after their initial appearance. “Treatment” can also refer to any of (i) the prevention of infection or reinfection, as in a traditional vaccine, (ii) the reduction or elimination of symptoms, and (iii) the substantial or complete elimination of the pathogen in question. Treatment may be affected prophylactically (prior to infection) or therapeutically (following infection).

[0106] In addition, in certain embodiments, “treatment,” “treat,” or “treating” refers to a method of reducing the effects of one or more symptoms of infection with a coronavirus. Thus, in the disclosed method, treatment can refer to a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the severity of an established infection, disease, condition, or symptom of the infection, disease or condition.

[0107] For example, a method for treating a disease is considered to be a treatment if there is a 10% reduction in one or more symptoms of the disease in a subject as compared to a control. Thus, the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any percent reduction in between 10% and 100% as compared to native or control levels. It is understood that treatment does not necessarily refer to a cure or complete ablation of the disease, condition, or symptoms of the disease or condition and/or complete prevention of infection. Further, as used herein, references to decreasing, reducing, or inhibiting include a change of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater as compared to a control level and such terms can include but do not necessarily include complete elimination.

[0108] As used herein the terms “diagnose” or “diagnosing” refers to recognition of an infection, disease or condition by signs and symptoms. Diagnosing can refer to determination of whether a subject has an infection or disease. Diagnosis may refer to determination of the type of disease or condition a subject has or the type of virus the subject is infected with.

[0109] Diagnostic agents provided herein include any such agent, which are well-known in the relevant art. Among imaging agents are fluorescent and luminescent substances, including, but not limited to, a variety of organic or inorganic small molecules commonly referred to as “dyes,” “labels,” or “indicators.” Examples include fluorescein, rhodamine, acridine dyes, Alexa dyes, and cyanine dyes. Enzymes that may be used as imaging agents in accordance with the embodiments of the disclosure include, but are not limited to, horseradish peroxidase, alkaline phosphatase, acid phosphatase, glucose oxidase, β-galactosidase, β-glucoronidase or P-lactarnase. Such enzymes may be used in combination with a chromogen, a fluorogenic compound or a luminogenic compound to generate a detectable signal.

[0110] The peptide(s) or protein(s) of the present invention can also be used in binding assays including, but are not limited to, immunoassays such as competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), “sandwich” immunoassays, Meso Scale Discovery (MSD, Gaithersburg, Md.), immunoprecipitation assays, ELISPOT, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art (see, e.g., Ausubel et al., eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York, relevant portions incorporated herein by reference).

[0111] Radioactive substances that may be used as imaging agents in accordance with the embodiments of the disclosure include, but are not limited to, .sup.18F, .sup.32P, .sup.33P, .sup.45Ti, .sup.47Sc, .sup.52Fe, .sup.59Fe, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.67Ga, .sup.77As, .sup.86Y, .sup.90Y. .sup.89Sr, .sup.89Zr, .sup.94Tc, .sup.94Tc, .sup.99mTc, .sup.99Mo, .sup.105Pd, .sup.105Rh, .sup.111Ag, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.142Pr, .sup.143Pr, .sup.149Pm, .sup.153Sm, .sup.154-1581Gd, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.169Er, .sup.175Lu, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.189Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.211Pb, .sup.212Bi, .sup.212Pb, .sup.213Bi, .sup.223Ra and .sup.225Ac. Paramagnetic ions that may be used as additional imaging agents in accordance with the embodiments of the disclosure include, but are not limited to, ions of transition and lanthanide metals (e.g., metals having atomic numbers of 21-29, 42, 43, 44, or 57-71).

[0112] These metals include ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb and Lu.

[0113] When the imaging agent is a radioactive metal or paramagnetic ion, the agent may be reacted with another long-tailed reagent having a long tail with one or more chelating groups attached to the long tail for binding to these ions. The long tail may be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chain having pendant groups to which the metals or ions may be added for binding. Examples of chelating groups that may be used according to the disclosure include, but are not limited to, ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTPA), DOTA, NOTA, NETA, TETA, porphyrins, polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups.

[0114] The terms “dose” and “dosage” are used interchangeably herein. A dose refers to the amount of active ingredient given to an individual at each administration. The dose will vary depending on a number of factors, including the range of normal doses for a given therapy, frequency of administration; size and tolerance of the individual; severity of the condition; risk of side effects; and the route of administration. One of skill will recognize that the dose can be modified depending on the above factors or based on therapeutic progress. The term “dosage form” refers to the particular format of the pharmaceutical or pharmaceutical composition, and depends on the route of administration. For example, a dosage form can be in a liquid form for nebulization, e.g., for inhalants, in a tablet or liquid, e.g., for oral delivery, or a saline solution, e.g., for injection.

[0115] As used herein, the term “administering” means oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject. Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc. By “co-administer” it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies, for example cancer therapies such as chemotherapy, hormonal therapy, radiotherapy, or immunotherapy. The compounds of the invention can be administered alone or can be co-administered to the patient. Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). Thus, the preparations can also be combined, when desired, with other active substances (e.g., to reduce metabolic degradation). The compositions of the present invention can be delivered by transdermally, by a topical route, formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.

[0116] Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the antibodies provided herein suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions. Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, microcrystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers. Lozenge forms can comprise the active ingredient in a flavor, e.g., sucrose, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art. Pharmaceutical compositions can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized sepharose (TM), agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes). Additionally, these carriers can function as immunostimulating agents (i.e., adjuvants).

[0117] The term “adjuvant” refers to a compound that when administered in conjunction with the compositions provided herein including embodiments thereof, augments the composition’s immune response. Generally, adjuvants are non-toxic, have high-purity, are degradable, and are stable. Adjuvants can augment an immune response by several mechanisms including lymphocyte recruitment, stimulation of B and/or T cells, and stimulation of macrophages. The adjuvant increases the titer of induced antibodies and/or the binding affinity of induced antibodies relative to the situation if the immunogen were used alone. A variety of adjuvants can be used in combination with the agents provided herein including embodiments thereof, to elicit an immune response. Preferred adjuvants augment the intrinsic response to an immunogen without causing conformational changes in the immunogen that affect the qualitative form of the response. Preferred adjuvants include aluminum hydroxide and aluminum phosphate, 3 De-O-acylated monophosphoryl lipid A (MPL™) (see GB 2220211 (RIBI ImmunoChem Research Inc., Hamilton, Montana, now part of Corixa). Stimulon™ QS-21 is a triterpene glycoside or saponin isolated from the bark of the Quillaja Saponaria Molina tree found in South America (see Kensil et al., in Vaccine Design: The Subunit and Adjuvant Approach (eds. Powell & Newman, Plenum Press, NY, 1995); U.S. Pat. No. 5,057,540), (Aquila BioPharmaceuticals, Framingham, MA). Other adjuvants are oil in water emulsions (such as squalene or peanut oil), optionally in combination with immune stimulants, such as monophosphoryl lipid A (see Stoute et al., N. Engl. J. Med. 336, 86-91 (1997)), pluronic polymers, and killed mycobacteria. Another adjuvant is CpG (WO 98/40100). Adjuvants can be administered as a component of a therapeutic composition with an active agent or can be administered separately, before, concurrently with, or after administration of the therapeutic agent.

[0118] Other adjuvants contemplated for the invention are saponin adjuvants, such as Stimulon™ (QS-21, Aquila, Framingham, MA) or particles generated therefrom such as ISCOMs (immunostimulating complexes) and ISCOMATRIX. Other adjuvants include RC-529, GM-CSF and Complete Freund’s Adjuvant (CFA) and Incomplete Freund’s Adjuvant (IFA). Other adjuvants include cytokines, such as interleukins (e.g., IL-1 α and β peptides, IL-2, IL-4, IL-6, IL-12, IL-13, and IL-15), macrophage colony stimulating factor (M-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), tumor necrosis factor (TNF), chemokines, such as MIP1α and β and RANTES. Another class of adjuvants is glycolipid analogues including N-glycosylamides, N-glycosylureas and N-glycosylcarbamates, each of which is substituted in the sugar residue by an amino acid, as immuno-modulators or adjuvants (see U.S. Pat. No. 4,855,283). Heat shock proteins, e.g., HSP70 and HSP90, may also be used as adjuvants. Suitable formulations for rectal administration include, for example, suppositories, which consist of the packaged nucleic acid with a suppository base. Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons. In addition, it is also possible to use gelatin rectal capsules which consist of a combination of the compound of choice with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.

[0119] Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intratumoral, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. In the practice of this invention, compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically or intrathecally. Parenteral administration, oral administration, and intravenous administration are the preferred methods of administration. The formulations of compounds can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.

[0120] Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced by nucleic acids for ex vivo therapy can also be administered intravenously or parenterally as described above.

[0121] The pharmaceutical preparation is preferably in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component. The unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules. Also, the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form. The composition can, if desired, also contain other compatible therapeutic agents.

[0122] The combined administration contemplates co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.

[0123] Effective doses of the compositions provided herein vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. However, a person of ordinary skill in the art would immediately recognize appropriate and/or equivalent doses looking at dosages of approved compositions for treating and preventing cancer for guidance.

[0124] As used herein, the term “pharmaceutically acceptable” is used synonymously with “physiologically acceptable” and “pharmacologically acceptable”. A pharmaceutical composition will generally comprise agents for buffering and preservation in storage, and can include buffers and carriers for appropriate delivery, depending on the route of administration. As used herein, the terms “pharmaceutically acceptable” or “pharmacologically acceptable” refer to a material which is not biologically or otherwise undesirable, i.e., the material may be administered to an individual in a formulation or composition without causing any unacceptable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.

[0125] “Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient. Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer’s, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer’s solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like. Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances, and the like., that do not deleteriously react with the compounds of the invention. One of skill in the art will recognize that other pharmaceutical excipients are useful in the present invention.

[0126] The term “pharmaceutically acceptable salt” refers to salts derived from a variety of organic and inorganic counter ions well known in the art and include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like; and when the molecule contains a basic functionality, salts of organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.

[0127] The term “preparation” is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it. Similarly, cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.

[0128] The pharmaceutical preparation is optionally in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component. The unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules. Also, the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form. The unit dosage form can be of a frozen dispersion.

[0129] The compositions of the present invention may additionally include components to provide sustained release and/or comfort. Such components include high molecular weight, anionic mucomimetic polymers, gelling polysaccharides and finely-divided drug carrier substrates. These components are discussed in greater detail in U.S. Pat. Nos. 4,911,920; 5,403,841; 5,212,162; and 4,861,760. The entire contents of these patents are incorporated herein by reference in their entirety for all purposes. The compositions of the present invention can also be delivered as microspheres for slow release in the body. For example, microspheres can be administered via intradermal injection of drug-containing microspheres, which slowly release subcutaneously (see Rao, J. Biomater Sci. Polym. Ed. 7:623-645, 1995; as biodegradable and injectable gel formulations (see, e.g., Gao Pharm. Res. 12:857-863, 1995); or, as microspheres for oral administration (see, e.g., Eyles, J. Pharm. Pharmacol. 49:669-674, 1997). In embodiments, the formulations of the compositions of the present invention can be delivered by the use of liposomes which fuse with the cellular membrane or are endocytosed, i.e., by employing receptor ligands attached to the liposome, that bind to surface membrane protein receptors of the cell resulting in endocytosis. By using liposomes, particularly where the liposome surface carries receptor ligands specific for target cells, or are otherwise preferentially directed to a specific organ, one can focus the delivery of the compositions of the present invention into the target cells in vivo. (See, e.g., Al-Muhammed, J. Microencapsul. 13:293-306, 1996; Chonn, Curr. Opin. Biotechnol. 6:698-708, 1995; Ostro, Am. J. Hosp. Pharm. 46:1576-1587, 1989). The compositions of the present invention can also be delivered as nanoparticles.

[0130] The present invention describes methods utilizing and compositions comprising or expressing T cell epitopes, T cell epitope-containing peptides, and T cell epitope-containing proteins associated with binding to a subset of the naturally occurring MHC Class II and/or MHC Class I molecules within the human population. Compositions comprising or expressing one or more of the disclosed peptides (e.g., the amino acid sequences set forth in any one of Tables 4-9) or polynucleotides encoding the same, covering different HLA Class II and/or MHC Class I alleles, capable of generating a treatment acting broadly on a population level are disclosed herein. As the antigen repertoire of MHC Class I and MHC Class II alleles varies from one individual to another and from one ethnic population to another, it is challenging to provide vaccines or peptide or epitopes-based immunotherapies that can be offered to subjects of any geographic region in the world or provide sufficient protection against infection across a wide segment of the populations unless numerous epitopes or peptides are included (e.g., in a vaccine). Taking into consideration the need for a single vaccine formulation that can provide protection across populations, if it desirable to provide a treatment containing or expressing proteins, peptides or epitopes that will provide protection against infection amongst the majority of the worldwide population. Also, taking into consideration the enormous costs and risks in the clinical development of new treatments and the increasing demands from regulatory bodies to meet high standards for toxicity testing, dose justification, safety and efficacy trials, it is desirable to provide treatments containing or expressing as few peptides as possible, but at the same time to be able to treat the majority of subjects in a worldwide population with a single immunotherapy. Such a product should comprise as a first requirement an expression or inclusion of combination of epitopes or peptides that are able to bind the worldwide MHC Class I and/or MHC Class II allele repertoire, and the resulting peptide-MHC complexes should as a second requirement be recognized by the T cells of the subject so as to induce the desired immunological reactions.

[0131] It is an object of claims of the present invention to provide improved epitope or peptide combinations for modulating an immune response, for treating a subject for an infection or aberrant immune response, and for use in diagnostic methods and kits comprising such peptide combinations. It is another object of the invention to provide epitope or peptide combinations exhibiting very good HLA Class I and Class II coverage in a worldwide population and being immunologically potent in a worldwide population. It is another object of the invention to provide epitope or peptide combinations having good cross reactivity to other viral strains, including co-circulating strains (for example, mutants) of coronaviruses, including SARS-CoV-2, common cold coronaviruses, as well as SARS-CoV, MERS, etc. It is another object of the invention to provide epitope or peptide combinations of a relatively small number of epitopes or peptides yet obtaining at least 70%, and more preferably around 90-100% donor coverage in a donor cohort representative of a worldwide population. In certain embodiments, this is achieved by selecting one or more immunodominant and/or immunoprevalent proteins (e.g., a SARS-CoV-2 protein) or subsequences, portions, homologues, variants or derivatives thereof for use in the methods and compositions of the present disclosure, wherein said immunodominant and/or immunoprevalent proteins or subsequences, portions, homologues, variants or derivatives thereof comprise two or more epitopes that are immunodominant and/or immunoprevalant. In some embodiments, the two or more epitopes comprise two to ten epitopes and/or polynucleotides encoding the same. Another object of the invention is to provide epitope combinations which are so immunologically potent that even at very low doses of epitopes, the percentage of responding donors can be retained at a very high level in a donor cohort representative of a worldwide population. Another object of the invention is to provide epitope combinations which have minor risk of inducing IgE-mediated adverse events. An additional object of the invention is to provide proteins, peptides, or nucleic acids containing or expressing epitopes or combinations of such proteins, peptides or nucleic acids which have a sufficient solubility profile for being formulated in a pharmaceutical product, preferably which have acceptable estimated in vivo stability. One further objective of the invention is to select epitopes for use in the compositions and methods described herein, based on one or both of their immunodominance or immunoprevalence. A still further object of the invention is to select such epitopes and epitopes combinations not only in accordance with those embodiments previously described, but also those epitopes and epitope combinations capable of eliciting a B cell response and T cell response (e.g., selecting one or more peptides for use in the methods and compositions described herein capable of generating a T cell and antibody response in a subject).

[0132] Provided herein are methods and compositions for diagnosing, treating, and immunizing against a coronavirus, including methods and compositions of detecting an immune response or immune cells relevant to a coronavirus infection. These methods and compositions include vaccines, diagnostics, therapies, reagents and kits, for modulating, eliciting, or detecting T cells responsive to one or more coronavirus peptides or proteins. The proteins and peptides described herein comprise, consist of, or consist essentially of: one or more amino acid sequences selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof; a fusion protein comprising one or more amino acid sequences selected from SEQ ID NO: 1 to 1126; a pool of 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 75, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1150 or more peptides selected from the amino acid sequences set forth in SEQ ID NO: 1 to 1126, or a polynucleotide that encodes one or more peptides or proteins, comprising, consisting of, or consisting essentially of an amino acid sequence selected from SEQ ID NO: 1 to 1126, or a subsequence, portion, homologue, variant or derivative thereof. In certain preferred embodiments, the coronavirus is one or more of SARS-CoV-2 or a variant thereof, or SARS, MERS, or a common cold coronavirus strain (e.g., 229E, NL63, HKU1, OC43). Further description and embodiments of such methods and compositions are provided in the definitions provided herein, and a person skilled in the art will recognize that the methods and compositions can be embodied in numerous variations, changes, and substitutions or as may occur to or be understood by one skilled in the art without departing from the invention.

[0133] The present inventors recognized that defining a comprehensive set of epitope specificities is important for several reasons. First, it allows the determination of whether within different SARS-CoV-2 antigens certain regions are immunodominant. This will be important for vaccine design, so as to ensure that vaccine constructs include not only regions targeted by neutralizing antibodies, such as the receptor binding domain (RBD) in the spike (S) region, but also include regions capable of delivering sufficient T cell help and are suitable targets of CD4+ T cell activity. Second, a comprehensive set of epitopes helps define the breadth of responses, in terms of the average number of different CD4+ and CD8+ T cell SARS-CoV-2 epitopes generally recognized by each individual. This is key because some reports have described a T cell repertoire focused on few viral epitopes (Ferretti et al., 2020), which would be concerning for potential viral escape from immune recognition via accumulated mutations that can occur during replication or through viral reassortment. Third, a comprehensive survey of epitopes restricted by a set of different HLAs representative of the diversity present in the general population is important to ensure that results obtained are generally applicable across different ethnicities and racial groups, and also to lay the foundations to examine the potential associations of certain HLAs with COVID-19 severity. Finally, the definition of the epitopes recognized in SARS-CoV-2 infection is relevant in the context of the debate on the potential influence of SARS-CoV-2 cross-reactivity with endemic “Common Cold” Coronaviruses (CCC) (Braun et al., 2020; Le Bert et al., 2020). Several studies have defined the repertoire of SARS-CoV-2 epitopes recognized in unexposed individuals (Braun et al., 2020; Mateus et al., 2020; Nelde et al., 2020), but the correspondence between that repertoire and the epitope repertoire elicited by SARS-CoV-2 infection has not been previously evaluated.

[0134] The present inventors provide a comprehensive map of epitopes recognized by CD4+ and CD8+ T cell responses across the entire SARS-CoV-2 viral proteome. Importantly, these epitopes have been characterized in the context of a broad set of HLA alleles using a direct ex vivo, cytokine-independent, approach.

[0135] Characteristics of the study participants. To broadly define the pattern of immunodominance and epitope recognition associated with SARS-CoV-2 infection, the inventors studied PBMC samples from 99 adult convalescent COVID-19 donors. Their age ranged from 19 to 91 years (median 41), with a gender ratio of about 2M:3F (Male 41%; Female 59%). Ethnic breakdown was reflective of the demographics of the local enrolled population. Samples were obtained 3 to 184 days post-symptom onset (median 67 days). Peak COVID-19 disease severity was representative of the distribution observed in the general population to date (mild 91%, moderate 2%, severe and critical 7%) (Table 1).

[0136] SARS-CoV-2 infection was determined by PCR-based testing during the acute phase of infection, if available (79% of the cases), and/or verified by plasma SARS-CoV-2 S protein RBD IgG ELISA (Stadlbauer et al., 2020) using plasma from convalescent phase blood draws. All donors were seropositive at the time of blood donation, with the exception of two mildly symptomatic donors with positive PCR results from the acute phase of illness, but seronegative results at time of blood donation (at 55- and 148-days post-symptom onset (PSO), respectively).

[0137] All donors were HLA typed at both class I and class II loci (data not shown). The HLA class I and II alleles frequently observed in the enrolled cohort were largely reflective of what is found in the worldwide population, as reported by the Allele Frequency Net Database (Gonzalez-Galarza et al., 2020), and as retrieved from the Immune Epitope Database’s (IEDB; www.iedb.org) population coverage tool (Bui et al., 2006; Dhanda et al., 2019) (FIGS. 4E-4J). Of the 20 different HLA class I alleles with phenotypic frequencies >5% in this cohort, 15 (75%) are also present in the most common and representative class I alleles in the worldwide population (Paul et al., 2013) (FIGS. 4G-4H). Likewise, of the 34 different HLA class II alleles with phenotypic frequencies >5% in this cohort, 26 (76%) are also present in the worldwide population with frequencies >5%. These alleles correspond to 16 of the 27 (59%) alleles included in a reference panel of the most common and representative class II alleles in the general population (Greenbaum et al., 2011)(FIGS. 4H-4J). In conclusion, this cohort is largely representative of the HLA allelic variants commonly expressed worldwide.

[0138] Pattern of antigen immunodominance in CD4+ and CD8+ T cell responses to SARS-CoV-2 antigens. To study adaptive immune responses in COVID-19 convalescent donors, the inventors previously utilized T cell receptor (TCR) dependent Activation Induced Marker (AIM) assays to quantify SARS-CoV-2-specific CD4+ and CD8+ T cells utilizing the combination of markers OX40+CD137+ and CD69+CD137+ for CD4+ and CD8+ T cells, respectively (Grifoni et al., 2020; Mateus et al., 2020; Weiskopf et al., 2020). To define the global pattern of immunodominance in the study cohort, the inventors tested PBMC from each donor with sets of overlapping peptides spanning the various SARS-CoV-2 proteins, as previously described (Grifoni et al., 2020b) (data not shown). These data also defined the specific viral antigens recognized by each donor, and therefore highlight the specific antigens/donor pairs suitable for further epitope identification studies, as shown in FIGS. 1A and C.

[0139] For each SARS-CoV-2 protein antigen (Table 2) the inventors recorded the % of donors in which a positive response was detected and the total response counts (positive cells/million detected in the AIM assay). This information was used to tabulate the percentage of the total response ascribed to each protein, and calculate the cumulative coverage provided by the most immunodominant proteins.

[0140] For CD4+ T cell responses, 9 viral proteins (non-structural protein (nsp) 3, nsp4, nsp12, nsp13, S, ORF3a, Membrane (M), ORF8, and Nucleocapsid (N)) accounted for 83% of the total response. In the context of CD8+ T cell responses, 8 viral proteins (nsp3, nsp4, nsp6, nsp12, S, ORF3a, M, and N) accounted for 81% of the total response. These results confirmed the pattern previously observed with a more limited (n=20) number of COVID-19 patients (Grifoni et al., 2020b) and highlight a broad pattern of immunodominance, where 8-9 antigens are required to cover 80% of the response.

[0141] The inventors further evaluated the number of antigens recognized in each of the individual donors analyzed. To this end, the inventors focused on antigens associated with a sizeable response, arbitrarily defined herein as those antigens individually accounting for at least 10% of the total response. It was found that per donor an average of 3.2 and 2.7 proteins were recognized by 10% or more of the total CD4+ and CD8+ SARS-CoV-2-specific T cells, respectively (FIGS. 1B and 1D). FIG. 1E shows a flow chart of a scheme of experimental strategy selected for HLA class I and class II epitope identification, and representative graphs depicting the flow cytometry gating strategy for defining antigen-specific CD4.sup.+ and CD8.sup.+ T cells by OX40.sup.+CD137.sup.+ and CD69.sup.+CD137.sup.+ expression, respectively.

[0142] Functional consequences of SARS-CoV-2-specific CD4+ T cell responses directed against different antigens. Next, the inventors investigated whether the recognition of different SARS-CoV-2 antigens by CD4+ T cells correlated with functional antibody and/or CD8+ T cell responses. Consistent with the wide range of blood collection time points (day PSO) and peak disease severity in the COVID-19 donor cohort, a wide range of RBD IgG responses (FIG. 2A) were observed. Combined CD4+ T cell responses did not significantly correlate with the antibody response to RBD (R = 0.1285, p = 0.2051; FIG. 2B). Breaking the correlation down for individual antigens showed that two correlations had p-values <0.05 namely Spike (R = 0.2223, p = 0.0270) and M protein (R = 0.2117, p = 0.0354), but these would not be significant when performing a multiple hypothesis comparison taking all other antigens into account (FIGS. 2C-E). In contrast, the correlation between CD4+ and CD8+ T cell responses was highly significant in aggregate (R = 0.6756, p = 1.70×10-14; FIG. 2F) and was significant for each of the individual antigen comparisons FIGS. 2G-I). The same was observed when the correlations of the matched protein-specific CD4+ and CD8+ T cell responses were considered (FIGS. 2J-2L).

[0143] These data show that the CD4+ T cell response against all dominant antigens is relevant in terms of providing helper function for CD8+ T cell-specific responses. These results may reflect that T cell responses correlate with gene expression. S, N, and M may be immunodominant because of the very high gene expression for each (Xie et al., 2020). In this context, it is perhaps surprising that a strong CD4+ and CD8+ T cell response was elicited by nsp3, which is not known to be expressed at high levels (Xie et al., 2020).

[0144] SARS-CoV-2 peptides and epitope screening strategy. The analysis of the SARS-CoV-2 proteome summarized above identified the major viral antigens accounting for 80% or more of the total CD4+ and CD8+ T cell response. These antigens were then introduced into the epitope screening pipeline (FIG. 1E). FIG. 1E shows a flow chart of a scheme of experimental strategy selected for HLA class I and class II epitope identification, and representative graphs depicting the flow cytometry gating strategy for defining antigen-specific CD4.sup.+ and CD8.sup.+ T cells by OX40.sup.+CD137.sup.+ and CD69.sup.+CD137.sup.+ expression, respectively. Since class II epitope prediction is not as robust as class I prediction (Peters et al., 2020), and because of the high degree of overlap in binding capacity of different HLA class II alleles, to determine CD4+ T cell reactivity in more detail a comprehensive and unbiased approach based on the use of complete sets of overlapping peptides spanning each antigen, and composition of antigen-specific peptide pools was used. Positivity was defined as net AIM+ counts (background subtracted by the average of triplicate negative controls) >100 and a Stimulation Index (SI) >2, as previously described (da Silva Antunes et al., 2020). Positive peptide pools were deconvoluted to identify the specific 15-mer peptide(s) recognized. For large proteins, such as S, an intermediate “mesopool” step was used to optimize use of reagents.

[0145] In parallel, panels of predicted HLA class I binders for the 28 most common allelic variants were synthesized (data not shown), as described in the methods section. The top two hundred predicted peptides were synthesized for each allele, leading to 5,600 predicted HLA binders in total. To identify CD8+ T cell epitopes, the inventors tested individual peptides derived from the specific antigen(s) recognized by CD8+ T cells of individual donors and that were predicted to bind the HLA class I alleles expressed by the respective donor. (FIG. 1C). To quantify the population coverage provided by the HLA class I alleles selected for study, the inventors tabulated the fraction of the donor cohort studied where allele matches were identified for 0, 1, 2, 3 or 4 of the respective HLA A and B alleles expressed by the donor. It was found that 98% of the participants in this cohort were covered by at least one allele, 91% by 2 or more, and 74% were covered by 3 or more of the alleles in this panel (FIG. 4G). As shown in Table 2, focusing on the 8 most dominant SARS-CoV-2 antigens for the purpose of epitope identification allowed mapping of 80% or more of the response, while screening only 35-40% of the total peptides.

[0146] To broadly identify T cell epitopes recognized in a cytokine-independent manner, the inventors used the AIM assay mentioned above (Grifoni et al., 2020; Reiss et al., 2017). Examples of gating strategies, pool deconvolution and epitope identification for both CD4+ and CD8+ T cell responses are shown in FIG. 1F. AIM+ cell counts were calculated per million CD4+ or CD8+ T cells, respectively. FIG. 1E shows representative graphs depicting the flow cytometry gating strategy for defining antigen-specific CD4.sup.+ and CD8.sup.+ T cells by OX40.sup.+CD137.sup.+ and CD69.sup.+CD137.sup.+ expression, respectively.

[0147] Summary of CD4+ T cell epitope identification results. To identify specific CD4+ T cell epitopes, the inventors deconvoluted peptide pools corresponding to antigens previously identified as positive for CD4+ T cell activity in each specific donor. In instances where not all positive pools could be deconvoluted due to limited cell availability, peptide pools were selected for screening to ensure that each of the 9 major antigens was tested in at least 10 donors. Overall, the inventors were able to test each peptide for these antigens in a median of 13 donors (range 10 to 17). Each donor was previously determined to be positive for CD4+ T cell responses to that specific antigen.

[0148] Taken together, a total of 280 SARS-CoV-2 CD4+ T cell epitopes were identified, including 3 nsp16 (this protein was not included in the top proteins studied) epitopes identified in parallel experiments in 2 donors (data not shown). It was found that each donor responded to an average of 3.2 viral antigens (FIG. 1D), and 5.9 CD4+ T cell epitopes were recognized per antigen for the top 80% most immunodominant antigens (data not shown). For each epitope/responding donor combination, potential HLA restrictions were also inferred based on the predicted HLA binding capacity of the epitope for the HLA alleles present in the respective responding donor (data not shown), as previously described (Mateus et al., 2020; Voic et al., 2020).

[0149] HLA binding capacity of dominant epitopes. A total of 109 of the 280 epitopes were recognized by 2 or more donors, accounting for 71% of the total response. The 49 most dominant epitopes, recognized in 3 or more donors, accounted for 45% of the total response (FIG. 3A).

[0150] Since dominant epitopes are associated with promiscuous HLA class II binding (Lindestam Arlehamn et al., 2013; Oseroff et al., 2010), defined as the capacity to bind multiple HLA allelic variants, the inventors investigated the role of HLA binding in determining immunodominant SARS-CoV-2 epitopes. Specifically, the inventors measured the in vitro binding capacity of the 49 most dominant epitopes (positive in 3 or more donors, as mentioned above) for a panel of 15 of the most common DR alleles using individual peptides and purified HLA class II molecules (Sidney et al., 2013). It was noted that, in general, a good correlation was observed between predicted and measured binding (R = 0.6604, p = 2.97×10-93; FIG. 3D). Based on these results, the inventors further characterized those 49 most dominant epitopes using predicted binding for additional HLA class II alleles, including a panel of the 12 most common HLA-DQ and DP allelic variants, and all HLA class II variants (DR, DQ, and DP) expressed in the cohort.

[0151] Overall, the 49 most dominant epitopes showed significantly higher binding promiscuity (number of alleles bound at the 1,000 nM or better threshold) (Paul et al., 2019; Southwood et al., 1998) for the panel of common HLA class II than a control group of 49 non-epitopes derived from the same proteins (Average number of HLA predicted to be bind ± SD epitopes = 10.8 ± 6.5; non-epitopes = 5.7 ± 6; p = 0.0001 by Mann-Whitney; FIGS. 3A-3F). The same conclusion was reached when the full set of HLA alleles present in the cohort were considered using the same criteria (Average ± SD epitopes = 24.3 ± 15.2; non-epitopes = 13.2 ± 14.1; p = 0.0003 by Mann-Whitney; FIG. 3). FIGS. 3B to 3F show SARS-CoV-2 immunodominant epitope HLA class II binding capacity and promiscuity. A comparison of the HLA class II binding capacity of 49 immunodominant epitopes as determined by binding predictions or as measured experimentally (FIG. 3B), suggesting feasibility for using binding predictions to assess HLA-restriction. Predicted HLA class II binding promiscuity is shown for the same 49 epitopes (white circles), and also 49 non-epitopes (black circles), considering the 27 HLA class II alleles most frequent worldwide (FIGS. 3C-3D), or the 58 HLA class II alleles specific to the study cohort (FIGS. 3E-3F). The number of HLA class II alleles predicted to bind epitopes (white circles) and non-epitopes (black circles) are based on a prediction cutoff value of IC50<1000nM. Statistical comparisons were performed using Mann-Whitney.

[0152] Heat maps of the 49 epitopes and non-epitopes considering the panel of common HLA DR, DP, and DQ are shown in FIGS. 3B-C. These results confirm that broad HLA binding capacity is a key feature of dominant epitopes. It further indicates that, because of their broad binding capacity, these epitopes are likely to be recognized in different geographical settings and different ethnicities.

[0153] Similarity of SARS-CoV-2 CD4+ T cell epitopes to CCC sequences. Several studies have reported significant preexisting immune memory to SARS-CoV-2 peptides in unexposed donors (Braun et al., 2020; Grifoni et al., 2020; Le Bert et al., 2020; Mateus et al., 2020). This reactivity was shown to be associated, at least in some instances, with memory T cells specific for human common cold coronaviruses (CCC) cross-reactively recognizing SARS-CoV-2 sequences (Braun et al., 2020; Mateus et al., 2020). In particular, it was shown that the SARS-CoV-2 epitopes recognized in unexposed donors had significantly higher homology to CCC than SARS-CoV-2 sequences not recognized in unexposed donors. Here, using the exact same methodology (Mateus et al., 2020), the inventors performed the converse analysis, namely an analysis of the homology between the CD4+ T cell epitopes experimentally identified in COVID-19 donors (FIGS. 5D-L) and sequences of peptides derived from the four widely circulating human CCC (NL63, OC43, HKU1, 229E). No significant differences were observed based on percent sequence identity between epitopes recognized from the COVID-19 cohorts and non-epitope controls in structural proteins S, M, and N (FIGS. 5D-F), and accessory proteins encoded by ORF3a and ORF8 (FIGS. 5G-I) or non-structural proteins (FIGS. 5J-L).

[0154] It was found that the pattern of antigen recognition in exposed and unexposed donors was significantly different. Here, having defined the actual epitopes recognized in COVID-19, the inventors compared them to the epitopes previously identified in unexposed donors. The present study re-identified 50% of the epitopes in a prior COVID-19 cohort, but in addition identified 227 novel CD4+ T cell epitopes specific for SARS-CoV-2 infection (Table 4). Thus, more than 80% (227/280) of the epitopes identified herein are novel and were not previously seen in the unexposed cohort. These results are consistent with the notion that while a cross-reactive repertoire is present in unexposed donors, SARS-CoV-2 infection elicits a vast repertoire of novel T cell specificities.

[0155] Summary of CD8+ T cell epitope identification results. Following the approach described above, a total of 523 SARS-CoV-2 CD8+ T cell epitopes were identified (Table 5). These epitopes are associated with 26 different HLA restrictions, based on predicted HLA binding capacity matched to the HLA alleles of the responding donor. For eight HLAs, only 1-2 donors expressing the matching HLA could be tested. Predicted binders for the remaining 18 HLAs were tested in a median of 5 donors (range 3 to 9). The 8 most immunodominant proteins were screened in an average of 19 donors (range 4 to 35) (FIG. 4A). Of the 523 CD8+ T cell epitopes identified, 61 were recognized in 2 or 3 different donor-allele combinations, meaning that there were 454 unique peptides recognized. Of these, 101 (22%) were recognized by 2 or more donors, accounting for 49% of the total response. It was found that each donor recognized an average of 2.7 antigens (FIG. 1F) and responded to an average of 1.6 CD8+ T cell epitopes per antigen per HLA allele (data not shown). Considering 4 HLA A and B alleles in each donor, the inventors estimated at least 17 epitopes per donor for class I (2.7 × 1.6 × 4 = 17.3).

[0156] FIGS. 4 shows the frequency of positive epitopes (identified epitopes/peptides screened), and the average magnitude of epitope responses (total magnitude of response normalized by the number of positive donors), as a function of protein (FIG. 4B) or HLA class I allele (FIG. 4C) analyzed. Each HLA was associated with an average of 25 epitopes (range 7 to 40, median 24) (FIG. 4D). Interestingly, as also previously detected in other systems (Goulder et al., 1997; Weiskopf et al., 2013), there was a wide variation as a function of HLA allele. Some alleles, such as A*03:01 and A*32:01, were associated with responses that were both infrequent and weak; in other cases (e.g., A*01:01), responses were infrequent, but when observed were of high magnitude. Finally, and conversely, other alleles were associated with relatively frequent but low magnitude responses (e.g., A*68:01). This effect was previously linked to differences in the size of peptide repertoires associated with different HLA motifs (Paul et al., 2013).

[0157] In terms of antigen specificity of CD8+ T cell responses, relatively similar epitope-specific response frequencies were observed for the various antigens, with the exception of nsp12, which was associated with responses of low frequency and magnitude (FIG. 4B). These results should be interpreted with the caveat in mind that the donors screened were pre-selected on the basis of association with positive responses to that particular antigen; thus, this data does not directly address protein immunodominance, which is instead addressed in Table 2. These data instead point to the relative frequency and magnitude of responses at the level of individual epitopes associated with a given antigen, which were found to be overall similar.

[0158] To address the potential relationship between CD8+ T cell epitope recognition and CCC homology, as performed above in the case of CD4+ T cell epitopes, the inventors analyzed the homology of the CD8+ T cell epitopes to CCC (NL63, OC43, HKU1, 229E), as compared to the homolog to the same CCC viruses detected in the case of peptides that tested negative in all donors tested, regardless of the HLA-restriction (FIGS. 5D-L). Similar to what was observed in the context of CD4+ T cell responses, the CD8+ T cell epitopes recognized in convalescent COVID-19 donors were not associated with higher sequence identity to CCC as compared to non-epitopes, when structural, accessory or non-structural proteins were considered.

[0159] Distribution of CD4+ and CD8+ T cell epitopes within dominant SARS-CoV-2 antigens. Next, the inventors analyzed the distribution of CD4+ and CD8+ T cell epitopes within the dominant SARS-CoV-2 S, N, and M antigens (FIGS. 5). For each antigen, the inventors show the frequency (red line) and magnitude (black line) of CD4+ T cell responses along the antigen sequence, considering regions with response frequency above 20% as immunodominant. Based on the results presented above, the inventors also plotted HLA class II binding promiscuity (defined as the number of HLA allelic variants expressed in the donor cohort predicted to be bound by a given peptide), and the degree of homology of each 15-mer peptide for aligned CCC antigen sequences. The bottom panel represents the distribution of CD8+ T cell epitopes (black) and non-epitopes (red) along the antigen sequence.

[0160] Responses to S peptides with a frequency of 20% or higher were focused on discrete regions of the protein involving the N-terminal domain (NTD), the C-terminal (CT) 686-816 region, and the neighboring fusion protein (FP) region; only a few responses were focused on the RBD. These immunodominant regions are boxed in red in FIG. 5A. Based on these results, it was found that HLA-binding capacity is associated with T cell immunodominant regions, and indeed had a significant positive correlation with the frequency of responses (R = 0.2231, p = 0.0003 by Spearman correlation, FIG. 5D). No significant correlation (R = -0.03144, p = 0.6187 by Spearman correlation, FIG. 5E) was found with sequence homology to CCC (calculated as maximum sequence homology to the four main CCC species). As indicated in the 3D rendering of the S crystal structure (PDB ID: 6XR8), these immunodominant regions were mostly located in the surface-exposed portions of the S monomer, and were not particularly influenced by the glycosylation pattern (shown in FIG. 5A as stars in the linear structure description, and based on experimental identification by Cai and co-authors (Cai et al., 2020)). The glycosylation patterns are also shown in the 3D-rendering of the corresponding crystal structure, based on curation done by the authors of the same manuscript, and shown as grey dots (FIG. 6A). The correlation between CD4+ T cell immunodominance and location of proteolytic cleavage sites, utilizing the MHCII-NP algorithm (Paul et al., 2018) was further explored. The results did not reveal any significant correlation between the predicted cleavage sites and immunodominant regions (Spearman correlation has R = -0.08426 and p = 0.1816, FIG. 5F). This is consistent with previous results that indicated that predicted cleavage sites do not significantly improve epitope predictions (Paul et al., 2018). Finally, CD8+ T cell reactivity did not reveal any particular immunodominant region in S, with epitopes and non-epitopes roughly equally distributed along the sequence (FIG. 5A).

[0161] In the same way, the inventors compared responses observed within the N and M proteins as a function of structural protein composition, HLA promiscuity and CCC homology (FIGS. 5B-C and FIGS. 6B-C). For the N protein (FIG. 5B), the majority of the response was focused on the NTD and CTD regions, with lower contributions from the linker region (all outlined in red boxes); segments in the middle and towards the ends of the protein were devoid of any reactivity. The correlation between immunodominance and HLA binding promiscuity was even stronger than observed for S (R = 0.4725, p = 7.41×10-6; FIG. 5G). Similar to what was observed for the S protein, no significant correlation between the frequency of positive responses was observed with CCC similarity (R = 0.1660, p = 0.1362; FIG. 5H) or predicted cleavage sites (R = -0.009245, p = 0.9343; FIG. 5I). The immunodominance of N-specific CD8+ T cell responses mirrors the one observed for the CD4+ T cell counterpart, highlighting that in general the N-terminal and C-terminal domains are the major immunodominant regions of N recognized by both T cell types.

[0162] CD4+ T cell immunogenic regions were distributed across the entire span of the M protein (FIG. 5C), including the transmembrane region (FIG. 6C). No significant correlation was observed when investigating HLA binding promiscuity (R = 0.2374, p = 0.1253; FIG. 5J), CCC similarity (R = 0.07648, p = 0.6259; FIG. 5K), or predicted cleavage sites (R = 0.08421, p = 0.5913; FIG. 5L). The lack of correlation between M epitopes and HLA binding is consistent with the interpretation that M is a prominent antigen because it is highly expressed, not because it contains high quality epitopes. No particular immunodominance patterns were observed for the M protein with respect to CD8+ epitopes. Finally, the location of immunodominant T cell regions relative to the main sites identified for antibody reactivity (Shrock et al., 2020) was investigated, the CD4+ T cell immunodominant regions identified in S and N showed minimal overlap with immunodominant linear regions targeted by antibody responses (Shrock et al., 2020) (FIGS. 6A TO 6L). The CD4+ T cell epitope recognition patterns of ORF3a, ORF8, nsp3, nsp4, nsp12, and nsp13 are as follows. The ORF8 protein was similar to M in that epitopes throughout both of these small proteins were recognized. ORF3a had clear regions of response clustered in the middle and at the C-terminus. Nsp3, which was the 4th most immunodominant antigen, was associated with a rather striking immunodominant region centered around residue 1643. Other non-structural proteins were less immunodominant overall, but had discreet regions targeted by CD4+ T cell responses (i.e., residue 5253 for nsp12).

[0163] Reactivity of megapools based on the experimentally identified epitopes. The experiments described above identified a total of 280 CD4+ and 454 CD8+ T cell epitopes. These epitopes were arranged into two epitope megapools (MPs), CD4-E and CD8-E, respectively (where the E denotes “experimentally defined”). These MPs were tested in a new cohort of 31 COVID-19 convalescent donors (none of these donors were utilized in the epitope identification experiments) and 25 unexposed controls (Table 3). MP reactivity was assessed for all donors using AIM and IFNγ FluoroSpot assays.

[0164] To put the results in context, the inventors also tested peptides contained in the CD4-R and CD4-S, and CD8-A and CD8-B MPs previously utilized to measure SARS-CoV-2 CD4+ and CD8+ T cell responses, respectively (Grifoni et al., 2020; Mateus et al., 2020; Rydyznski Moderbacher et al., 2020; Weiskopf et al., 2020). These MPs are based on either overlapping peptides spanning the entire S sequence (CD4-S) or predicted peptides (all other proteins). While these pools contain a larger total number of peptides (474 for CD4-R + CD4-S, and 628 for the CD8-A + CD8-B) than the corresponding experimentally defined sets, it could be expected that the experimentally defined peptide sets would be able to recapitulate the reactivity observed with the previously utilized MPs. As a further context, the inventors also tested the T cell Epitope Compositions (EC) class I and EC class II pools of experimentally defined CD8+ and CD4+ epitopes described by Nelde et al. (Nelde et al., 2020), encompassing 29 and 20 epitopes each, which prior to this study represented the most comprehensive set of experimentally defined epitopes.

[0165] As might be expected, the results showed that the AIM assay was more sensitive than the FluoroSpot assay . On the other hand, as a tradeoff for the lower signal, the FluoroSpot assay showed higher specificity in the responses detected, with fewer unexposed individuals showing any reactivity compared to the AIM assay. For CD4+ T cell responses as detected in the AIM assay (FIG. 6A), the CD4-E MP recapitulated the reactivity observed with the MPs of larger numbers of predicted peptides (CD4-R+S), and showed significantly higher reactivity (p = 4.30×10-6 by Mann-Whitney) as compared to the EC class IIpool. A similar picture was observed when the FluoroSpot assay was utilized (FIG. 6B), with a significantly higher reactivity of the CD4-E MP compared to the CD4-R+S (p = 0.0208 by Mann-Whitney), and to the EC class II pool (p = 1.39×10-7 by Mann-Whitney). In both AIM and FluoroSpot assays, the CD4-E MP showed the highest capacity to discriminate between COVID-19 convalescent and unexposed donors (p = 3.19×10-10 and p = 1.56×10-9, respectively by Mann-Whitney).

[0166] A similar picture was noted in the case of CD8+ T cell reactivity (FIGS. 6C-D), where the CD8-E MP recapitulated the reactivity observed with the MPs of larger numbers of predicted peptides (CD8-A+B), with a strong trend (p = 0.0551 by Mann-Whitney) towards more reactivity than the EC class II pool. In the case of the FluoroSpot assay, the inventors noted equivalent reactivity for the CD8-E and CD8-A+B MPs, and significantly higher reactivity (p = 0.0219 by Mann-Whitney) than the EC class II pool (FIG. 6D). In both assays, the CD8-E MP showed highest capacity to discriminate between COVID-19 convalescent and unexposed subjects (p = 1.47×10-8 and p = 1.48×10-8, respectively by Mann-Whitney). To test how well the different T cell responses measured separate individuals that have been exposed to SARS-Cov-2 versus those that do not, the inventors performed ROC analyses (FIGS. 6E-H) which allow us to directly compare the classification success based on true- and false-positive rates. The CD4-E and CD8-E response data were associated with the best performance.

[0167] Considering that a potential practical limitation in the characterization of SARS-CoV-2 responses is the number of cells available for study, in selected COVID-19 donors the inventors titrated the number of PBMC/well to determine if a response could be measured with lower cell numbers. As expected, as the cell input was decreased, the magnitude of responses decreased correspondingly. While marginal responses were seen with 25,000 cells/well and below, a sizeable response was still detectable with 50,000 cell/well, with 8 out of 17 donors responding for the CD4-E MP (as compared to 16 out of 17 in the case of 200,000 cell level). Similarly, in the case of the CD8-E MP, with 8 out of 17 donors responding (as compared to 11 out of 17 in the case of 200,000 cell level). The frequency and magnitude of responses of CD4-E were higher compared to the EC class II (p = 3.59×10-5 and p = 0.0044 by Mann-Whitney) (FIGS. 6I-J). The CD8-E MP was also associated with a higher magnitude of response than the EC class I pool (FIGS. 6K-L). In conclusion, these results underline the biological relevance of the more comprehensive CD4-E and CD8-E MPs.

[0168] The present invention includes a comprehensive analysis of the patterns of epitope recognition associated with SARS-CoV-2 infection in humans. The analysis was performed using a cohort of approximately 100 different convalescent donors spanning a range of peak COVID-19 disease severity representative of the observed distribution in the San Diego area. SARS-CoV-2 was probed using 1,925 different overlapping peptides spanning the entire viral proteome, ensuring an unbiased coverage of the different HLA class II alleles expressed in the donor cohort. For HLA class I the inventors used an alternative approach, selecting 5,600 predicted binders for 28 prominent HLA class I alleles, representing 61% of the HLA A and B allelic variants in the worldwide population, and affording an overall 98.8% HLA class I coverage at the phenotypic level.

[0169] The biological relevance of the epitope characterization studies summarized here is underlined by the use of the ex vivo AIM assay that does not require in vitro stimulation, which potentially skews the results by eliciting responses from naïve cells. The AIM assay is also more agnostic for different types of CD4+ T cells, as it measures all activated cells, regardless of T cell subset or any particular pattern of cytokine secretion.

[0170] To date, the repertoire of CD4+ and CD8+ T cell epitopes recognized in SARS-CoV-2 infection with a comparable level of granularity or breadth has not been determined. While several previous reports have described SARS-CoV-2 epitopes, and accordingly represent very useful advances, these studies either utilized in vitro expansion (Nelde et al., 2020), were limited in the number of proteins analyzed (Le Bert et al., 2020), characterized responses in fewer than 10 HLA types (Ferretti et al., 2020; Nelde et al., 2020; Peng et al., 2020), or focused on TCR repertoire after in vitro expansion of small numbers of cells (Snyder et al., 2020). Comparing these results with those obtained in those previous studies, it should be note that of the 20 HLA class II peptides identified by Nelde and co-authors (Nelde et al., 2020), 14 were contained within proteins the inventors mapped here in detail, and independently re-identified 12 (86%) of them (identical or largely overlapping sequences). Of 137 class I peptides reported thus far (Ferretti et al., 2020; Nelde et al., 2020; Peng et al., 2020), 98 were contained within the viral proteins the inventors mapped in detail, and independently re-identified 68 (69%) of them (identical or largely overlapping sequences).

[0171] Importantly, because SARS-CoV-2 antigen-specific T cell responses were evaluated in a systematic and unbiased fashion, quantitative estimates of the size of the repertoire of T cell epitope specificities recognized in each donor can be derived. Determining the breadth of responses is of relevance, since previous studies (Ferretti et al., 2020; Snyder et al., 2020) have suggested narrow SARS-CoV-2-specific T cell repertoires in COVID-19 patients; notably, a limited repertoire could favor viral mutation, a particular concern with this RNA virus. Based on these results, it could be estimated that each donor would be able to recognize about 19 CD4+ T cell epitopes, on average. Likewise, for CD8+ T cells, it could be estimated at least 17 epitopes per donor to be recognized. Overall, T cell responses in SARS-CoV-2 are estimated to recognize even more epitopes per donor than seen in the context of other RNA viruses, such as dengue (Grifoni et al., 2017; Weiskopf et al., 2015), where 11.6 and 7 CD4+ and CD8+ T cell epitopes, respectively, were recognized on average. This analysis should allay concerns over the potential for SARS-CoV-2 to escape T cell recognition by mutation of a few key viral epitopes.

[0172] The inventors defined the patterns of immunodominance across the various antigens encoded in the SARS-CoV-2 genome recognized in COVID-19 donors. Clear patterns of immunodominance were found, with a limited number of antigens accounting for about 80% of the total response. In general, the same antigens are dominant for both CD4+ and CD8+ responses, with some differences in relative ranking, such as in the case of nsp3, which is relatively more dominant for CD8+ than CD4+ T cell responses. Immunodominance at the protein level correlated with protein abundance/ gene, as previously noted for CD4+ T cell responses (Xie et al., 2020), although accessory proteins and nsps also account for a significant fraction of the response despite their predicted lower abundance in infected cells.

[0173] Because of their role in instructing both antibody and CD8+ T cell responses, the inventors correlated CD4+ T cell activity on a per donor and per antigen level with antibody and CD8+ T cell adaptive responses. This enabled establishing which antigens have functional relevance in terms of eliciting CD4+ T cell responses correlated with antibody and CD8+ T cell responses. At the level of antibody responses, S and M were correlated with RBD antibody titers, highlighting their capacity to support antibody responses, presumably by a deterministic linkage (viral antigen bridge) and cognate interactions (Sette et al., 2008). Surprisingly, N-specific CD4+ T cell responses did not correlate with S RBD antibody titers, suggesting unexpected complexity of the N-specific CD4+ T cell response. By contrast with these selective effects, CD4+ T cell activity against any of the antigens correlated with the total CD8+ T cell activity, suggesting that the role of CD4+ T cell responses driven by the different proteins is determinant in its helper function for either RBD-specific antibody production or CD8+ T cell responses. This was particularly true in both contexts when looking specifically at the S and M proteins, which are also the strongest and most frequently recognized antigens for both CD4+ and CD8+ T cells.

[0174] After examining relative immunodominance at the level of the different SARS-CoV-2 antigens, the inventors probed for variables that may influence which specific peptides are recognized within a given antigen/ORF. Previously, the inventors have shown that SARS-CoV-2 sequences recognized in unexposed individuals were associated with a higher degree of similarity to sequences encoded in the genome of various CCC. Here, repeating the same analysis with the SARS-CoV-2 epitopes recognized in COVID-19 donors, the inventors found no significant correlation. The inventors further show that while a large fraction of the epitopes previously identified in unexposed donors are re-identified in COVID-19 donors, about 80% of the epitopes are novel (not previously seen in unexposed), suggesting that the SARS-CoV-2-specific T cell repertoire of COVID-19 cases is overlapping, but substantially different from, the SARS-CoV-2-cross-reactive memory T cell repertoire of unexposed donors. This is consistent with the present inventors’ observation of a different pattern of reactivity (Mateus et al., 2020), and consistent with reports from other groups (Le Bert et al., 2020; Nelde et al., 2020).

[0175] HLA binding capacity was a major determinant of immunogenicity for CD4+ T cells (the influence of HLA binding was not evaluated for CD8+ T cell, since the tested epitope candidates were picked based of their predicted HLA binding capacity). As found in several previous large-scale pathogen-derived epitope identification studies, immunodominant epitopes were also found to be promiscuous HLA class II binders (Lindestam Arlehamn et al., 2016; Oseroff et al., 2010). Binding to multiple HLA allelic variants is an important mechanism to amplify the potential immunogenicity of peptide epitopes and specific regions within an antigen. It is possible that the dominance of particular regions might further correlate with processing. However, at this juncture, HLA class II processing algorithms do not effectively predict epitope recognition (Barra et al., 2018; Cassotta et al., 2020; Paul et al., 2018).

[0176] Further analysis projected the CD4+ T cell dominant regions on known or predicted SARS-CoV-2 protein structures. This established that the dominant epitope regions are different for B and T cells. This is of relevance for vaccine development, as inclusion of antigen sub-regions selected on the basis of dominance for antibody reactivity might result in an immunogen devoid of sufficient CD4+ T cell activity. In this context, it is important to note that the RBD region had very few CD4+ T cell epitopes recognized in COVID-19 donors, but inclusion of regions neighboring the RBD N- and C-termini would be expected to provide sufficient CD4+ T cell help.

[0177] In contrast to the clear demarcation of dominant regions for antibody and CD4+ T cell responses, CD8+ T cell epitopes were uniformly dispersed throughout the various antigens, consistent with previous in-depth analyses revealing little positional effect in CD8+ T cell epitope distribution (Kim et al., 2013). In the case of CD8+ T cell responses, these data highlights HLA-allele specific differences in the frequency and magnitude of responses. This effect was noted before in the case of dengue virus (Weiskopf et al., 2013) and related to potential HLA-linked protective versus susceptibility effects. The current study is not powered to test these potential effects, leaving it to future studies to examine this possibility. Regardless, this study provides a roadmap for inclusion of specific regions or discrete epitopes, to allow for CD8+ T cell epitope representation across a variety of different HLAs.

[0178] Finally, the functional relevance of this study was highlighted by the generation of novel and improved epitope MPs for measuring T cell responses to SARS-CoV-2; these newer experimentally defined pools are associated with increased activity and lower complexity when compared to the inventors’ previous MPs based on overlapping and predicted peptides. These epitope pools can be used by the scientific community at large and can facilitate further investigation of the role of T cell immunity in SARS-CoV-2 infection and COVID-19.

[0179] In conclusion, the present invention includes several hundred different HLA class I and class II restricted SARS-CoV-2-derived epitopes. These HLA class I and class II restricted SARS-CoV-2-derived epitopes can be used for basic investigation of SARS-CoV-2 immune responses and in the development of both multimeric staining reagents and T cell-based diagnostics, as well as in treatments, immunizations, and kits. In addition, the results shed light on the mechanisms of immunodominance of SARS-CoV-2, which have implications for understanding host-virus interactions, as well as for vaccine design.

[0180] Human Subjects. Convalescent COVID-19 Donors utilized for epitope identification. Blood donations from the 99 convalescent donors included in this study’s cohort were collected through either the UC San Diego Health Clinic under IRB approved protocols (200236X), or under IRB approval (VD-214) at the La Jolla Institute. Donations obtained through the CROs Sanguine, BioIVT and Stem Express were collected under the same IRB approval (VD-214) at the La Jolla Institute. Details of this cohort can be found in Table 1. All donors were over the age of 18 years and no exclusions were made due to disease severity, race, ethnicity, or gender. All donors were able to provide informed consent, or had a legal guardian or representative able to do so. Study exclusion criteria included lack of willingness or ability to provide informed consent, or lack of an appropriate legal guardian to provide informed consent.

[0181] Disease severity was defined as mild, moderate, severe or critical as previously described (Grifoni 2020). In brief, this classification of disease severity is based on a modified version of the WHO interim guidance, “Clinical management of severe acute respiratory infection when COVID-19 is suspected” (WHO Reference Number: WHO/2019-nCoV/clinical/2020.4). At the time of enrollment in the study, 80% of donors had been confirmed positive by swab test viral PCR during the acute phase of infection. Plasma samples from all donors were later tested by IgG ELISA for SARS-CoV-2 S protein RBD to verify previous infection (Table 1 and FIG. 2A).

[0182] Healthy Unexposed donors utilized for CD4-E and CD8-E megapool validation. Samples from healthy adult donors were obtained from the San Diego Blood Bank (SDBB). According to the criteria set up by the SDBB if a subject was eligible to donate blood, they were considered eligible for this study. All the donors were tested for SARS-CoV-2 RBD IgG serology and were found negative and therefore considered unexposed. An overview of the characteristics of these donors is provided in Table 3. Convalescent COVID-19 donors utilized for CD4-E and CD8-E megapool validation. The 31 convalescent donors tested in the megapool AIM and FluoroSpot assays (FIGS. 6A-6L) were collected from the same clinics using the same protocols as described above for the donors utilized for epitope identification. Similarly, no donors enrolled were under the age of 18 and none were excluded due to disease severity, race, ethnicity, or gender. All donors, or legal guardians, gave informed consent. Specific characteristics of these donors can be found in Table 3, including the summary of ELISA testing for SARS-CoV-2 S protein RBD.

[0183] Peptide Pools. Preparation of 15-mers and subsequent megapools and mesopools. To identify SARS-CoV-2-specific T cell epitopes, 15-mer peptides overlapping by 10 amino acids and spanning entire SARS-CoV-2 proteins were synthesized. All peptides were synthesized as crude material (A&A, San Diego, CA) and individually resuspended in dimethyl sulfoxide (DMSO) at a concentration of 10 mg/mL. Aliquots of these peptides were pooled by antigen of provenance into megapools (MP) (as described in Table 2) and sequentially lyophilized as previously reported (Carrasco Pro et al., 2015). Another portion of the 15-mer peptides were pooled into smaller mesopools of ten peptides each. All pools were resuspended at 1 mg/mL in DMSO.

[0184] Class I peptide preparation. Class I predicted peptides were designed using the protein sequences derived from the SARS-CoV-2 reference strain (GenBank: MN908947). Predictions were performed as previously reported using NetMHC pan EL 4.0 algorithm (Jurtz et al., 2017) for 28 HLA A and B alleles that were selected based on frequency in this cohort and also representative of the worldwide population (FIGS. 4E-4F). The top 200 predicted peptides were selected for each allele. In total 5,600 class I peptides were synthesized and resuspended in DMSO at 10 mg/mL.

[0185] PBMC isolation and HLA typing. Whole blood was collected from all donors in either Acid Citrate Dextrose (ACD) tubes or heparin coated blood bags. Whole blood was then centrifuged at room temperature for 15 minutes at 1850 rpm to separate the cellular fraction and plasma. The plasma was then carefully removed from the cell pellet and stored at -20 C. Peripheral blood mononuclear cells (PBMC) were isolated by density-gradient sedimentation using Ficoll-Paque (Lymphoprep, Nycomed Pharma) as previously described (Weiskopf et al., 2013). Isolated PBMC were cryopreserved in cell recovery media containing 10% DMSO (Gibco), supplemented with 90% heat-inactivated fetal bovine serum, depending on the processing laboratory, (FBS; Hyclone Laboratories, Logan UT) and stored in liquid nitrogen until used in the assays. Each sample was HLA typed by Murdoch University in Western Australia, an ASHI-Accredited laboratory (Voic 2020, Madden 1995, Gorse 2010). Typing was performed for the class I HLA A and B loci and class II DRBI, DQB1, and DPB1 loci.

[0186] SARS-CoV-2 RBD ELISA. The SARS-CoV-2 RBD ELISA has been described in detail elsewhere (Grifoni 2020, Amanat 2020). All convalescent COVID-19 donors had their serology determined by ELISA. Briefly, 96-well half-area plates (ThermoFisher 3690) were coated with 1 ug/mL SARS-CoV-2 Spike (S) Receptor Binding Domain (RBD) and incubated at 4° C. overnight. On the following day plates were blocked at room temperature for 2 hours with 3% milk in phosphate buffered saline (PBS) containing 0.05% Tween-20. Then, heat-inactivated plasma was added to the plates for another 90-minute incubation at room temperature followed by incubation with conjugated secondary antibody, detection, and subsequent data analysis by reading the plates on Spectramax Plate Reader at 450 nm using SoftMax Pro. Limit of detection (LOD) was defined as 1:3. Limit of sensitivity (LOS) for SARS-CoV-2 infected individuals was established based on uninfected subjects, using plasma from normal healthy donors not exposed to SARS-CoV-2.

[0187] Flow Cytometry. Activation induced cell marker (AIM) assay. The AIM assay was performed as previously described (Dan et al., 2016; Reiss et al., 2017). Cryopreserved PBMCs were thawed by diluting the cells in 10 mL complete RPMI 1640 with 5% human AB serum (Gemini Bioproducts) in the presence of benzonase [20 .Math.l/10 ml]. Cells were cultured for 20 to 24 hours in the presence of SARS-CoV-2 specific MPs [1 .Math.g/ml], mesopools [1 .Math.g/ml], 15-mers [10 .Math.g/ml], or class I predicted peptides [10 .Math.g/ml] in 96-wells U bottom plates with 1×106 PBMC per well. As a negative control, an equimolar amount of DMSO was used to stimulate the cells as a negative control in triplicate wells, and phytohemagglutinin (PHA, Roche, 1 .Math.g/ml) was included as the positive control. The cells were stained with CD3 AF700 (4:100; Life Technologies Cat# 56-0038-42), CD4 BV605 (4:100; BD Biosciences Cat# 562658), CD8 BV650 (2:100; Biolegend Cat# 301042), and Live/Dead Aqua (1:1000; eBioscience Cat# 65-0866-14). Activation was measured by the following markers: CD137 APC (4:100; Biolegend Cat# 309810), OX40 PE-Cy7 (2:100; Biolegend Cat#350012), and CD69 PE (10:100; BD Biosciences Cat# 555531). All samples were acquired on either a ZE5 cell analyzer (Bio-rad laboratories) or an Aurora flow cytometry system (Cytek), and analyzed with FlowJo software (Tree Star).

[0188] \\HLA binding assays. The binding of selected SARS-CoV-2 15-mer epitopes to HLA class II MHC molecules was measured as previously described (Sidney 2013, Voic 2020). In brief, the binding is quantified by each peptide’s capacity to inhibit the binding of a radiolabeled peptide probe to purified MHC in classical competition assays. The probe was incubated with purified MHC, a mixture of protease inhibitors, and different concentrations of unlabeled inhibitor peptide at room temperature or 37° C. for 2 days. MHC molecules were subsequently captured on HLA-DR-specific monoclonal antibody (L243) coated Lumitrac 600 plates (Greiner Bio-one, Frickenhausen, Germany) and radioactivity was measured using the TopCount microscintillation counter (Packard Instrument Co., Meriden, CT). Each peptide was tested at 6 concentrations to cover a 100,000-fold dose range, and an unlabeled version of the radiolabeled probe was included in each experiment as a positive control for inhibition. To analyze the results, the inventors calculated the concentration of peptide at which the binding was inhibited by 50% (IC50 nM). For these values to approximate true Kd values, the following conditions were met: 1) the concentration of radiolabelled probe is less than the concentration of MHC, and 2) the measured IC50 is greater than or equal to the concentration of MHC.

[0189] FluoroSpot. PBMCs derived from 25 unexposed donors were stimulated in triplicate at a single density of 200×103 cells/well (one donor was tested at 50×103 due to limitation in cell numbers). PBMCs from a cohort of 31 convalescent COVID-19 donors were stimulated in triplicates of 200×103 cells/well, with the exception of 5 donors tested at 50-100×103 cells/well due to cell limitations (FIGS. 6B, D, F, and H). Seventeen of these convalescent donors were further titrated at 200, 50, 25, and 12.5×103 cells/well (FIGS. 6I-L). The cells were stimulated with the different MPs analyzed (1 .Math.g/mL), PHA (10 .Math.g/mL), and DMSO (0.1%) in 96-well plates previously coated with anti-cytokine antibodies for IFNγ, (mAbs 1-D1K; Mabtech, Stockholm, Sweden) at a concentration of 10 .Math.g/mL. After 20 hours of incubation at 37° C., 5% CO2, cells were discarded and FluoroSpot plates were washed and further incubated for 2 hours with cytokine antibodies (mAbs 7-B6-1-BAM; Mabtech, Stockholm, Sweden). Subsequently, plates were washed again with PBS/0.05% Tween20 and incubated for 1 hour with fluorophore-conjugated antibodies (Anti-BAM-490). Computer-assisted image analysis was performed by counting fluorescent spots using an AID iSPOT FluoroSpot reader (AIS-diagnostika, Germany). Each megapool was considered positive compared to the background based on the following criteria: 20 or more spot forming cells (SFC) per 106 PBMC after background subtraction for each cytokine analyzed, a stimulation index (S.I.) greater than 2, and statistically different from the background (p <0.05) in either a Poisson or T test. Bioinformatic and statistical analysis. FlowJo 10 and GraphPad Prism 8.4 were used to perform data and statistical analyses, unless otherwise stated. Statistical details of the experiments are provided in the respective figure legends. Data plotted in linear scale are expressed as mean + standard deviation (SD). Data plotted in logarithmic scales are expressed as median + 95% confidence interval (CI) or geometric mean + geometric SD. Statistical analyses were performed using Spearman correlation and Mann-Whitney or Kolmogorov-Smirnov tests for unpaired comparisons. Details pertaining to significance are also noted in the respective figure legends.

[0190] AIM assay analysis. In analyzing data from the AIM assays, the counts of AIM+ CD4+ and CD8+ T cells were normalized based on the counts of CD4+ and CD8+ T cells in each well to be equivalent to 1×106 total CD8+ or CD4+ T cells. The background was removed from the data by subtracting the single or the average of the counts of AIM+ cells plated as single or triplicate wells stimulated with DMSO. The inventors included the triplicate wells stimulated with DMSO in the mesopools and epitope identification steps to take into account the variability of the weaker signals observed in those two respect to the original MP reactivity (da Silva Antunes et al., 2020). The Stimulation Index (SI) was calculated by dividing the count of AIM+ cells after SARS-CoV-2 stimulation with the ones in the negative control. A positive response had an SI greater than 2 and a minimum of 100 AIM+ cells after background subtraction. The gates for AIM+ cells were drawn relative to the negative and positive controls for each donor. A representative example of the gating strategy is depicted in FIG. 1.

[0191] HLA class I nested epitopes. For some alleles and proteins, multiple nested class I predicted peptides were tested in the AIM assay. In cases where a specific donor responded to multiple nested epitopes corresponding to the same allele and protein, the epitope with the highest magnitude of response was classified as the optimal epitope. If multiple nested epitopes had the same response (within a range of 50 AIM+ cells), the epitope with the shortest length was selected. Nested epitopes corresponding to different donors or different alleles were conserved as separate epitopes.

[0192] CCC homology analysis. SARS-CoV-2-derived 15-mer peptides were analyzed for their identity with the common cold coronaviruses (CCC) 229E, NL63, HKU1, and OC43, as previously described (Mateus et al., 2020). In brief, every SARS-CoV-2 15-mer peptide tested for immunogenicity was compared against every position in the corresponding protein sequences of common coronaviruses obtained from GenBank. The region that best matched the respective SARS-CoV-2 peptide was used to calculate percent sequence identity for each of the four CCC viruses individually, as well as the maximum across all four (FIGS. 4K-4Q). The same methodology was also used to calculate sequence identity for SARS-CoV-2 class I peptides (FIGS. 4K-4Q). Using the same set of common coronavirus reference sequences, an alternative analysis was performed by mapping each SARS-CoV-2 peptide with the S, M and N protein sequences corresponding to the four common coronavirus using Immunobrowser tool (Dhanda et al., 2018). The values resulted from this specific analysis are plotted in FIGS. 5.

[0193] T cell epitope restriction predictions. Putative HLA class II restrictions for individual 15-mer CD4+ T cell epitopes were inferred using the IEDB’s TepiTool resource (Paul 2016). All CD4+ T cell prediction analyses were performed applying the NetMHCIIpan algorithm (Karosiene et al., 2013). Prediction analyses were performed to either infer HLA restriction based on the HLA typing of the cohort or to assess potential binding promiscuity of experimentally defined epitopes, considering the 27 most frequent class II alleles in the worldwide population (Greenbaum et al., 2011). In both types of prediction analyses, a 20th percentile threshold was applied, as previously described (Mateus et al., 2020). Assigning regions within the linear structure. Simple diagrams were created to describe the linear structures of S, N, and M proteins (FIGS. 4). The different regions of the S protein were defined based on the works of Cai et al. 2020. The structure of the N protein was divided into 3 main regions, the N- and C-terminal domains, and the linker region in between (Zeng et al., 2020). For the M protein, the regions of the structure were extracted from UniProt (UniProtKB - P59596 (VME1_SARS).

[0194] 3D-rendering and model design. Three different approaches have been used to map T and B cell immunodominant regions on the 3D-structures for SARS-CoV-2 S, M and N proteins. The S protein model was based on the crystal structure described in Cai et al. 2020 (PDB ID: 6XR8) and using the glycosylation sites annotated in the submitted PDB. The M protein model has been previously described by Heo et al., 2020. The model for the N protein was run on four different homology prediction servers (SWISS-MODEL, RaptorX, iTasser and Phyre2). In order to have a complete N sequence, Phyre2 server was subsequently selected using the intensive mode (Kelley and Sternberg, 2009). The resulting model showed a variable level of confidence with higher percentages (>90%) in the C-Terminal domain (CTD) and N-terminal domain (NTD) regions and low confidence percentages (>10%) in the linker domain. The N model was superimposable with both the crystal structures for the CTD (PDB ID: 6WZO) and NTD (PDB ID: 6M3M). The current N model has the only purpose of visualization for mapping immunodominant regions. All the mapping analyses have been performed using the free version of YASARA (Land and Humble, 2018).

TABLE-US-00001 Characteristics of donor cohort utilized in the protein screen COVID-19 (n = 99) Age (years) 19-91 [median = 41, IQR = 23] Gender Male (%) 41% (42/99) Female (%) 59% (58/99) Sample Collection Date Mar-September 2020 SARS-CoV-2 PCR Positive = 100% (78/78) Not tested= 21% (21/99) S RBD IgG 98% (97/99), Peak disease Severity.sup.a Mild 91% (90/99) Moderate 2% (2/99) Severe 1% (1/99) Critical 6% (6/99) Race-Ethnicity White- not Hispanic or Latino 76% (76/99) Hispanic or Latino 12% (12/99) Asian 5% (5/99) American Indian/Alaska Native 1% (1/99), Native Hawaiian or other Pacific ......... Islander 0% (0/99) Black or African American 2%(2/99) More than one race 3% (3/99) Not reported 0% (0/99) Days Post Symptom Onset at Collection.sup.b 3-184 (108/108) [Median = 67, IQR = 48] .sup.aAccording to WHO criteria. .sup.bMultiple visits for the same donor have been analyzed.

TABLE-US-00002 Summary of SARS-CoV-2-specific T cell reactivity as a function of the most immunodominant proteins.sup.a CD4.sup.+ T cells s (n= 99) CD8.sup.+ T cell s (n=9 9) proteins Frequency (%) Total counts Average counts % of responses per protein Cumulative (%) # of peptides tested Cumulative (%) proteins Frequency (%) Total counts Average counts % of responses per protein Cumulative (%) # of peptides tested Cumulative (%) S 95 4718 73 4766 26 25 253 13 S 80 4409 27 4454 26 26 253 13 M 96 2688 83 2716 17 43 43 15 nsp3 49 1741 04 1759 17 43 388 33 N 93 2204 25 2227 15 58 82 20 N 75 1801 91 1820 15 58 82 38 nsp3 70 1605 67 1622 8 66 388 40 M 69 1490 71 1506 11 69 43 40 ORF 3a 76 9402 5 950 5 70 53 43 ORF 3a 47 5843 9 590 4 73 53 43 nsp1 2 64 7515 7 759 4 74 186 52 nsp4 45 3994 5 403 3 76 100 48 nsp4 58 6877 8 695 3 77 100 57 nsp1 2 35 2676 4 270 3 79 186 57 nsp1 3 58 5168 1 522 3 80 120 64 nsp6 34 2661 9 269 2 81 58 60 ORF 8 58 5021 7 507 2 83 23 65 nsp2 30 2232 4 225 2 83 127 67 nsp1 6 34 2917 5 295 2 85 59 68 nsp1 24 1839 3 186 2 85 36 69 nsp2 54 4867 4 492 2 87 127 74 nsp5 31 1713 6 173 2 87 61 72 ORF 7a 48 5927 0 599 2 89 23 76 nsp1 6 20 2022 1 204 2 89 59 75 Nsp6 49 2878 3 291 2 91 58 79 nsp1 3 25 1600 4 162 2 91 120 81 nsp1 4 44 2605 9 263 2 93 105 84 ORF 8 32 2238 9 226 1 92 23 83 nsp5 46 2913 9 294 2 94 61 87 ORF 7a 28 1961 2 198 1 93 23 84 E 33 2116 1 214 1 95 13 88 nsp1 4 19 1113 5 112 1 94 105 89 nsp1 22 2035 7 206 1 97 36 90 nsp7 18 7480 76 1 95 17 90 nsp8 -9-10 37 2141 9 216 1 98 91 95 nsp8 -9-10 18 1406 7 142 1 97 91 95 nsp1 5 29 1715 4 173 1 98 70 98 ORF 6 24 1294 7 131 1 98 11 95 ORF 6 27 1063 2 107 1 99 11 99 nsp1 5 14 1220 8 123 1 99 70 99 ORF 10 19 7551 76 0 100 6 99 ORF 10 20 1217 8 123 1 99 6 99 nsp7 19 1424 8 144 0 100 17 100 E 20 954296 1 100 13 100 .sup.aBold font indicates the top SARS-CoV-2 proteins accounting for a cumulative response >80% for CD4.sup.+ and CD8.sup.+ T cells.

TABLE-US-00003 Characteristics of donor cohorts utilized to validate megapools in FIGS. 6A-6L Unexposed (n = 25) COVID-19 (n = 31) Age (years) 24-82 [Median = 36, IQR = 31] 21-81 [Median = 38, IQR = 29] Gender Male (%) 52% (13/25) 35% (11/31) Female (%) 48% (12/25) 65% (20/31) Sample Collection Date March - May 2020 April - September 2020 SARS-CoV-2 PCR N/A Positive 100% (18/18) Not tested= 42% (13/31) S RBD IgG 0% (0/25) 100% (31/31) Peak disease Severity.sup.a Mild N/A 58% (18/31) Moderate N/A 36% (36/31) Severe N/A 6% (2/31) Critical N/A 0% (0/31) Race-Ethnicity White- not Hispanic or Latino 44% (11/25) 81% (25/31) Hispanic or Latino 8% (2/25) 13% (4/31) Asian 12% (3/25) 3% (1/31) American Indian/Alaska Native 0% (0/25) 0% (0/31) Native Hawaiian or Other Pacific ......... Islander 4% (1/25) 0% (0/31) Black or African American 0% (0/25) 0% (0/31) More than one race 0% (0/25) 0% (0/31) Not reported 32% (8/25) 3% (1/31) Days Post Symptom Onset at Collection N/A 22-128 [Median = 69, IQR = 50] .sup.aAccording to WHO criteria.

TABLE-US-00004 List of CD4+ T cell epitopes identified and their predicted HLA restriction(s). A total of 280 15-mer epitopes were identified by AIM assay and encompassed the 9 dominant SARS-CoV-2 antigens for CD4+ T cells Protein sequence HLA restriction Frequency of response (%) Sum of response Magnitude by # of responding donors SEQ ID NO M YRINWITGGIAIAMA DQB1*02:02, DQB1*03:01, DQB1*05:01, DQB1*05:02, DQB1*05:03, DQB1*06:02, DQB1*06:03, DRB1*07:01, DRB1*10:01, DRB1*12:01, DRB1*13:01, DRB1*14:01, DRB1*15:01, DRB1*16:01 58 2417 345 1 ORF8 PCPIHFYSKWYIRVG DRB1*08:02, DRB1*13:01, DRB1*15:01, DRB1*15:02, DRB1*16:01 55 2948 491 2 M KEITVATSRTLSYYK DQB1*06:03, DRB1*03:01, DRB1*07:01, DRB1*14:01, DRB1*14:06, DRB1*15:01, DRB1*16:02 54 3615 516 3 M LSYYKLGASQRVAGD DQB1*03:01, DQB1*06:02, DQB1*06:03, DRB1*01:01, DRB1*07:01, DRB1*14:06, DRB1*15:01, DRB1*16:01, DRB1*16:02 46 3465 578 4 ORF8 IGNYTVSCLPFTINC DQB1*03:03, DRB1*15:02 45 1223 245 5 S NIDGYFKIYSKHTPI DRB1*07:01, DRB1*15:01, DRB1*16:01 45 1475 295 6 M VLAAVYRINWITGGI DQB1*05:01, DQB1*05:03, DRB1*12:02, DRB1*14:01 42 2519 504 7 M RGHLRIAGHHLGRCD DRB1*07:01, DRB1*13:01, 42 2359 472 8 DRB1*14:01, DRB1*15:01 N ILLNKHIDAYKTFPP DRB1*14:06, DRB1*15:01 42 2416 483 9 ORF8 TQHQPYVVDDPCPIH DRB1*13:02 36 1352 338 10 ORF8 YVVDDPCPIHFYSKW DRB1*13:02, DRB1*15:02 36 3488 872 11 ORF8 RCSFYEDFLEYHDVR DQB1*05:02 36 696 174 12 S LMDLEGKQGNFKNLR HLA class II 36 1386 347 13 M CLVGLMWLSYFIASF DQB1*05:01, DQB1*05:03, DRB1*12:01, DRB1*12:02 33 1181 295 14 M SELVIGAVILRGHLR DQB1*06:02, DQB1*06:03, DRB1*01:02, DRB1*13:01, DRB1*14:01, DRB1*15:01, DRB1*16:01 33 563 141 15 N WPQIAQFAPSASAFF DQB1*02:02, DQB1*05:03, DRB1*04:04, DRB1*07:01, DRB1*15:01 33 1503 376 16 N FKDQVILLNKHIDAY DRB1*03:01, DRB1*14:01, DRB1*14:06, DRB1*15:01, DRB1*16:02 33 1785 446 17 nsp16 AVMSLKEGQINDMIL HLA class II 33 104 104 18 nsp16 KEGQINDMILSLLSK HLA class II 33 391 391 19 nsp16 RENNRVVISSDVLVN DQB1*02:02, DRB1*07:01 33 170 170 20 M SGFAAYSRYRIGNYK DRB1*15:01 31 739 185 21 N KKPRQKRTATKAYNV HLA class II 31 907 227 22 N KRTATKAYNVTQAFG DQB1*06:02, DQB1*06:03 31 752 188 23 N NKDGIIWVATEGALN DQB1*02:01, DQB1*02:02, DQB1*03:02, DQB1*05:03, DRB1*04:04, DRB1*07:01 29 1747 437 24 ORF8 FTINCQEPKLGSLVV HLA class II 27 502 167 25 ORF8 GSLVVRCSFYEDFLE DQB1*05:02, DQB1*05:03 27 694 231 26 S SSANNCTFEYVSQPF HLA class II 27 4279 1426 27 S NLVRDLPQGFSALEP DRB1*03:01 27 1822 607 28 S RFASVYAWNRKRISN DRB1*07:01, DRB1*13:01, DRB1*14:01 27 722 241 29 M MWLSYFIASFRLFAR DQB1*02:01, DQB1*05:01, DQB1*05:02, DQB1*05:03, DRB1*03:01, DRB1*14:01, DRB1*14:06, DRB1*16:01, DRB1*16:02 25 1030 343 30 M TNILLNVPLHGTILT DRB1*10:01, DRB1*12:02, DRB1*14:01, DRB1*14:06, DRB1*15:01, DRB1*16:02 25 1628 543 31 M IAGHHLGRCDIKDLP HLA class II 25 1565 522 32 M LGRCDIKDLPKEITV HLA class II 25 938 313 33 S AGFIKQYGDCLGDIA DQB1*05:03 25 2450 817 34 N SWFTALTQHGKEDLK HLA class II 23 3265 1088 35 N YYRRATRRIRGGDGK DRB1*13:01, DRB1*14:06 23 592 197 36 M IKDLPKEITVATSRT HLA class II 23 774 258 37 N AAEASKKPRQKRTAT HLA class II 23 537 179 38 ORF3a LYLYALVYFLQSINF DQB1*02:01, DQB1*03:02, DQB1*05:03, DRB1*11:01, DRB1*12:01 21 371 124 39 N AGNGGDAALALLLLD DQB1*03:01, DQB1*06:02 21 1249 416 40 M QFAYANRNRFLYIIK DRB1*14:01 20 978 326 41 ORF8 TTVAAFHQECSLQSC DQB1*05:02 18 2016 1008 42 ORF8 FHQECSLQSCTQHQP HLA class II 18 826 413 43 ORF8 ARKSAPLIELCVDEA HLA class II 18 658 329 44 ORF8 PLIELCVDEAGSKSP HLA class II 18 341 171 45 ORF3a CNLLLLFVTVYSHLL DQB1*02:01, DRB1*07:01, DRB1*11:01 18 424 212 46 ORF8 EDFLEYHDVRVVLDF DQB1*05:02, DQB1*06:04, DRB1*13:02, DRB1*15:02 18 1141 571 47 ORF8 DFLEYHDVRVVLDFI DQB1*05:02, DQB1*06:04, DRB1*15:02 18 681 341 48 S VSQPFLMDLEGKQGN DRB1*03:01 18 1694 847 49 S EFVFKNIDGYFKIYS DQB1*05:03, DRB1*14:01, DRB1*15:01 18 672 336 50 S FKIYSKHTPINLVRD DRB1*07:01, DRB1*13:01 18 967 484 51 S KHTPINLVRDLPQGF DRB1*03:01 18 1641 821 52 S LPQGFSALEPLVDLP DQB1*02:02, DQB1*03:03, DQB1*05:03 18 836 418 53 S IPFAMQMAYRFNGIG DQB1*04:02, DQB1*05:03, DRB1*12:01, DRB1*14:01, DRB1*15:01 18 373 187 54 nsp3 TLRVEAFEYYHTTDP DQB1*05:03 18 635 318 55 nsp3 HTTDPSFLGRYMSAL HLA class II 18 4921 2461 56 M LLWPVTLACFVLAAV DQB1*05:01, DQB1*05:03, DQB1*06:03 17 520 260 57 M ITGGIAIAMACLVGL DQB1*03:01 17 414 207 58 M TRSMWSFNPETNILL DQB1*05:01, DQB1*05:02, DQB1*05:03, DRB1*01:02 17 410 205 59 M GTILTRPLLESELVI DRB1*13:01 17 322 161 60 N QFAPSASAFFGMSRI DRB1*07:01 17 381 191 61 N LTYTGAIKLDDKDPN DRB1*07:01 17 1484 742 62 S KRISNCVADYSVLYN DQB1*02:01, DQB1*02:02, DRB1*03:01 17 327 164 63 S LKPFERDISTEIYQA HLA class II 17 1188 594 64 S AENSVAYSNNSIAIP DQB1*03:01, DRB1*15:01 17 805 403 65 S TNFTISVTTEILPVS DQB1*02:02, DQB1*06:03, DRB1*07:01, DRB1*14:01 17 663 332 66 S VTLADAGFIKQYGDC HLA class II 17 237 119 67 nsp4 YLTFYLTNDVSFLAH DQB1*05:02, DRB1*14:01, DRB1*15:01, DRB1*16:01 17 715 358 68 S VYYPDKVFRSSVLHS DRB1*03:01, DRB1*13:01, DRB1*14:01 15 395 198 69 S SVLHSTQDLFLPFFS DQB1*02:02, DRB1*07:01 15 609 305 70 N GGDGKMKDLSPRWYF HLA class II 15 295 148 71 M ATSRTLSYYKLGASQ DQB1*05:01, DQB1*05:03, DRB1*16:01 15 1386 693 72 M LGASQRVAGDSGFAA HLA class II 15 981 491 73 M RVAGDSGFAAYSRYR HLA class II 15 278 139 74 M YSRYRIGNYKLNTDH HLA class II 15 551 276 75 M IGNYKLNTDHSSSSD DRB1*03:01 15 267 134 76 N KAYNVTQAFGRRGPE HLA class II 15 530 265 77 N LIRQGTDYKHWPQIA HLA class II 15 431 216 78 nsp3 GYKKPASRELKVTFF HLA class II 15 491 246 79 nsp3 ASRELKVTFFPDLNG DQB1*05:03 15 324 162 80 nsp3 PDLNGDVVAIDYKHY HLA class II 15 430 215 81 nsp4 RYLALYNKYKYFSGA DRB1*15:01 15 1415 708 82 N MKDLSPRWYFYYLGT HLA class II 14 5072 2536 83 N LPYGANKDGIIWVAT HLA class II 14 835 418 84 ORF3a VRIIMRLWLCWKCRS DRB1*11:01 14 261 131 85 N EGALNTPKDHIGTRN HLA class II 14 369 185 86 ORF3a EHVTFFIYNKIVDEP DQB1*02:01, DQB1*05:01, DRB1*08:01, DRB1*11:01 14 277 139 87 ORF3a FIYNKIVDEPEEHVQ DQB1*05:01, DRB1*08:01 14 486 243 88 S VTQNVLYENQKLIAN DRB1*03:01, DRB1*12:01 14 705 353 89 nsp12 FVSLAIDAYPLTKHP DQB1*02:02, DQB1*03:02, DQB1*06:04, DRB1*15:01 14 230 115 90 nsp12 IDAYPLTKHPNQEYA HLA class II 14 229 115 91 M EELKKLLEQWNLVIG DQB1*05:01, DQB1*05:02 13 446 223 92 M LLEQWNLVIGFLFLT DQB1*02:01, DQB1*05:03 13 243 122 93 M NRNRFLYIIKLIFLW DQB1*02:01, DQB1*05:03, DRB1*03:01, DRB1*12:01 13 420 210 94 M LYIIKLIFLWLLWPV DQB1*02:01, DRB1*12:01 13 397 199 95 S VNNSYECDIPIGAGI HLA class II 11 398 398 96 ORF8 SLQSCTQHQPYVVDD HLA class II 9 1222 1222 97 S LPFFSNVTWFHAIHV DQB1*05:02, DRB1*15:01, DRB1*16:01 9 156 156 98 ORF8 CVDEAGSKSPIQYID HLA class II 9 327 327 99 ORF3a KIITLKKRWQLALSK DRB1*11:01 9 120 120 100 ORF8 IQYIDIGNYTVSCLP DRB1*11:04, DRB1*13:02 9 1805 1805 101 S NPVLPFNDGVYFAST HLA class II 9 413 413 102 ORF8 QEPKLGSLVVRCSFY DRB1*11:04 9 124 124 103 ORF3a LVAAGLEAPFLYLYA DQB1*02:01, DQB1*02:02 9 133 133 104 S EKSNIIRGWIFGTTL DRB1*15:01 9 299 299 105 S IRGWIFGTTLDSKTQ HLA class II 9 327 327 106 S FGTTLDSKTQSLLIV HLA class II 9 174 174 107 S DSKTQSLLIVNNATN HLA class II 9 108 108 108 S VVIKVCEFQFCNDPF HLA class II 9 2088 2088 109 S LGVYYHKNNKSWMES HLA class II 9 259 259 110 S HKNNKSWMESEFRVY DQB1*05:03 9 572 572 111 S GKQGNFKNLREFVFK HLA class II 9 129 129 112 S SALEPLVDLPIGINI HLA class II 9 167 167 113 S VIRGDEVRQIAPGQT DRB1*13:01 9 180 180 114 S WNSNNLDSKVGGNYN HLA class II 9 101 101 115 S LPPLLTDEMIAQYTS DQB1*04:02 9 153 153 116 S TDEMIAQYTSALLAG DQB1*06:02, DRB1*04:04, DRB1*15:01 9 745 745 117 S ALLAGTITSGWTFGA DQB1*06:02 9 116 116 118 S TITSGWTFGAGAALQ DQB1*04:02, DQB1*06:02 9 164 164 119 nsp3 LPNDDTLRVEAFEYY DQB1*03:02 9 162 162 120 nsp3 SFLGRYMSALNHTKK DRB1*04:04 9 219 219 121 nsp3 YMSALNHTKKWKYPQ HLA class II 9 109 109 122 nsp3 NHTKKWKYPQVNGLT HLA class II 9 123 123 123 nsp4 AVITREVGFVVPGLP HLA class II 9 682 682 124 nsp4 VPGLPGTILRTTNGD HLA class II 9 439 439 125 nsp4 FLHFLPRVFSAVGNI DRB1*15:01 9 491 491 126 nsp4 SIVAGGIVAIVVTCL DQB1*03:02, DQB1*04:02 9 109 109 127 S VSSQCVNLTTRTQLP HLA class II 8 274 274 128 S VNLTTRTQLPPAYTN HLA class II 8 170 170 129 M LIFLWLLWPVTLACF DQB1*05:01, DQB1*05:03, DRB1*01:02 8 1194 1194 130 N LTQHGKEDLKFPRGQ HLA class II 8 127 127 131 N FPRGQGVPINTNSSP HLA class II 8 397 397 132 N GVPINTNSSPDDQIG HLA class II 8 108 108 133 M AIAMACLVGLMWLSY HLA class II 8 151 151 134 N TRRIRGGDGKMKDLS HLA class II 8 151 151 135 M FIASFRLFARTRSMW DQB1*05:03, DRB1*03:01, DRB1*14:01 8 353 353 136 M RLFARTRSMWSFNPE DQB1*05:03, DRB1*14:01 8 141 141 137 M SFNPETNILLNVPLH DRB1*01:02 8 123 123 138 M NVPLHGTILTRPLLE HLA class II 8 263 263 139 M RPLLESELVIGAVIL DQB1*02:02 8 183 183 140 M GAVILRGHLRIAGHH DRB1*13:01, DRB1*15:01 8 512 512 141 M LNTDHSSSSDNIALL HLA class II 8 568 568 142 ORF3a YFTSDYYQLYSTQLS DRB1*16:02 8 198 198 143 N TQAFGRRGPEQTQGN HLA class II 8 151 151 144 N RRGPEQTQGNFGDQE HLA class II 8 518 518 145 N FGDQELIRQGTDYKH HLA class II 8 281 281 146 N TDYKHWPQIAQFAPS HLA class II 8 180 180 147 N ASAFFGMSRIGMEVT DQB1*05:03, DRB1*01:02, DRB1*14:01 8 337 337 148 N GMEVTPSGTWLTYTG HLA class II 8 380 380 149 N AIKLDDKDPNFKDQV DRB1*03:01 8 585 585 150 S YAWNRKRISNCVADY DRB1*13:01 8 582 582 151 S CVADYSVLYNSASFS DQB1*05:03, DQB1*06:02 8 210 210 152 S SVLYNSASFSTFKCY DRB1*15:01 8 892 892 153 S SASFSTFKCYGVSPT DRB1*15:01 8 294 294 154 S TFKCYGVSPTKLNDL HLA class II 8 221 221 155 S KLNDLCFTNVYADSF DQB1*02:01, DQB1*02:02, DRB1*07:01 8 130 130 156 S YADSFVIRGDEVRQI DQB1*02:02, DRB1*13:01 8 160 160 157 S EIYQAGSTPCNGVEG HLA class II 8 1121 1121 158 S FNCYFPLQSYGFQPT DQB1*05:03, DRB1*12:01 8 130 130 159 S TLEILDITPCSFGGV HLA class II 8 227 227 160 S SIAIPTNFTISVTTE HLA class II 8 274 274 161 S SVTTEILPVSMTKTS HLA class II 8 341 341 162 S STECSNLLLQYGSFC DQB1*06:02 8 314 314 163 S KNTQEVFAQVKQIYK HLA class II 8 125 125 164 S TPPIKDFGGFNFSQI DRB1*15:01 8 421 421 165 S LPDPSKPSKRSFIED HLA class II 8 109 109 166 S LLFNKVTLADAGFIK DQB1*06:02 8 297 297 167 S QYGDCLGDIAARDLI HLA class II 8 152 152 168 S LGDIAARDLICAQKF HLA class II 8 153 153 169 S ARDLICAQKFNGLTV HLA class II 8 232 232 170 nsp3 ADAVIKTLQPVSELL DRB1*14:01 8 436 436 171 nsp3 ESDDYIATNGPLKVG HLA class II 8 133 133 172 nsp3 IATNGPLKVGGSCVL DRB1*13:02 8 112 112 173 nsp3 SGHNLAKHCLHVVGP HLA class II 8 148 148 174 nsp3 NLYDKLVSSFLEMKS DQB1*05:02, DRB1*14:01 8 150 150 175 S QELGKYEQYIKWPWY HLA class II 8 768 768 176 nsp3 RFYFYTSKTTVASLI DQB1*06:01, DRB1*14:01, DRB1*15:02 8 126 126 177 nsp3 LNQLTGYKKPASREL HLA class II 8 168 168 178 nsp3 TPSFKKGAKLLHKPI HLA class II 8 103 103 179 nsp3 VWHVNNATNKATYKP HLA class II 8 158 158 180 nsp3 TFTRSTNSRIKASMP DRB1*14:01 8 120 120 181 nsp3 TNSRIKASMPTTIAK DRB1*04:04, DRB1*07:01 8 360 360 182 nsp3 NTVKSVGKFCLEASF HLA class II 8 113 113 183 nsp3 PNFSKLINIIIWFLL DRB1*07:01, DRB1*15:01 8 3802 3802 184 nsp3 WDLTAFGLVAEWFLA DQB1*05:03 8 134 134 185 nsp3 FGLVAEWFLAYILFT DQB1*05:03, DRB1*12:01 8 219 219 186 nsp4 PVYSFLPGVYSVIYL DRB1*15:01 8 650 650 187 nsp4 SFLAHIQWMVMFTPL DQB1*06:02, DRB1*15:01 8 554 554 188 nsp4 IQWMVMFTPLVPFWI DQB1*02:02, DRB1*04:04, DRB1*07:01 8 603 603 189 nsp4 MFTPLVPFWITIAYI DRB1*15:01 8 602 602 190 nsp4 LTQYNRYLALYNKYK DRB1*15:01 8 638 638 191 nsp4 YREAACCHLAKALND HLA class II 8 109 109 192 nsp4 CCHLAKALNDFSNSG HLA class II 8 111 111 193 nsp4 FSNSGSDVLYQPPQT DQB1*06:02 8 149 149 194 nsp4 SDVLYQPPQTSITSA HLA class II 8 394 394 195 nsp13 ELHLSWEVGKPRPPL HLA class II 8 103 103 196 nsp13 PRPPLNRNYVFTGYR HLA class II 8 101 101 197 nsp13 FTGYRVTKNSKVQIG DRB1*07:01 8 116 116 198 nsp13 VTKNSKVQIGEYTFE HLA class II 8 118 118 199 nsp13 VNARLRAKHYVYIGD HLA class II 8 116 116 200 M NLVIGFLFLTWICLL DQB1*05:01, DRB1*01:02 7 261 261 201 M FLFLTWICLLQFAYA DQB1*05:01, DQB1*05:03, DRB1*01:02 7 255 255 202 M WICLLQFAYANRNRF DQB1*05:03, DRB1*03:01, DRB1*14:01 7 234 234 203 ORF3a LEAPFLYLYALVYFL DQB1*02:01, DRB1*11:01 7 272 272 204 N PRWYFYYLGTGPEAG DQB1*02:01, DQB1*05:03 7 750 750 205 ORF3a RLWLCWKCRSKNPLL HLA class II 7 290 290 206 N IWVATEGALNTPKDH HLA class II 7 200 200 207 ORF3a YDANYFLCWHTNCYD HLA class II 7 209 209 208 ORF3a FLCWHTNCYDYCIPY DQB1*05:03 7 209 209 209 ORF3a TNCYDYCIPYNSVTS DQB1*05:01 7 402 402 210 ORF3a TDTGVEHVTFFIYNK HLA class II 7 118 118 211 N GKGQQQQGQTVTKKS HLA class II 7 318 318 212 ORF3a GSSGVVNPVMEPIYD DQB1*04:02 7 186 186 213 N HIDAYKTFPPTEPKK HLA class II 7 223 223 214 N QKKQQTVTLLPAADL DRB1*01:02 7 712 712 215 N TVTLLPAADLDDFSK DQB1*05:03, DRB1*01:02 7 648 648 216 S QPYRVVVLSFELLHA DQB1*05:03, DRB1*14:01 7 183 183 217 S VVLSFELLHAPATVC DQB1*05:03, DRB1*12:01, DRB1*14:01 7 317 317 218 S LTGTGVLTESNKKFL HLA class II 7 427 427 219 S QMAYRFNGIGVTQNV DQB1*03:01 7 160 160 220 S LYENQKLIANQFNSA DRB1*12:01 7 195 195 221 S HWFVTQRNFYEPQII HLA class II 7 598 598 222 S QRNFYEPQIITTDNT HLA class II 7 302 302 223 S FVSGNCDVVIGIVNN HLA class II 7 180 180 224 S GIVNNTVYDPLQPEL DQB1*02:02, DQB1*03:02 7 164 164 225 S LQPELDSFKEELDKY HLA class II 7 173 173 226 nsp3 YCIDGALLTKSSEYK DRB1*15:02 7 119 119 227 nsp3 MAAYVDNSSLTIKKP DQB1*05:03 7 185 185 228 nsp12 HCANFNVLFSTVFPP DQB1*02:02, DQB1*06:02, DRB1*07:01 7 211 211 229 nsp12 NVLFSTVFPPTSFGP DQB1*02:02 7 109 109 230 nsp12 YPKCDRAMPNMLRIM HLA class II 7 153 153 231 nsp12 RAMPNMLRIMASLVL DQB1*06:02, DRB1*15:01 7 144 144 232 nsp12 AVTANVNALLSTDGN HLA class II 7 201 201 233 nsp12 KTDGTLMIERFVSLA HLA class II 7 150 150 234 nsp12 DVFHLYLQYIRKLHD DRB1*04:04, DRB1*13:02 7 247 247 235 N PQNQRNAPRITFGGP HLA class II 6 222 222 236 N NAPRITFGGPSDSTG DQB1*03:01 6 259 259 237 N TFGGPSDSTGSNQNG DQB1*03:01 6 291 291 238 nsp12 QDALFAYTKRNVIPT HLA class II 6 132 132 239 nsp12 IAATRGATVVIGTSK DQB1*03:03, DRB1*07:01 6 117 117 240 nsp12 SHRFYRLANECAQVL DRB1*01:01, DRB1*08:01 6 535 535 241 nsp12 SEMVMCGGSLYVKPG HLA class II 6 217 217 242 nsp12 FNICQAVTANVNALL DQB1*03:01, DRB1*14:01 6 220 220 243 nsp4 KHFYWFFSNYLKRRV DRB1*15:01 8 959 959 244 N DDQIGYYRRATRRIR DRB1*13:01, DRB1*14:01, DRB1*14:06, DRB1*15:01, DRB1*16:02 23 803 268 245 N DAALALLLLDRLNQL DQB1*05:03, DQB1*06:02, DRB1*03:01, DRB1*12:01, DRB1*14:01, DRB1*15:01 21 1463 488 246 N LLLLDRLNQLESKMS DRB1*03:01, DRB1*12:01, DRB1*14:01, DRB1*15:01 21 1742 581 247 N PSGTWLTYTGAIKLD DQB1*06:03, DRB1*01:02, DRB1*07:01, DRB1*15:01 42 2583 517 248 ORF3a ALLAVFQSASKIITL DQB1*03:01, DRB1*11:01 9 178 178 249 ORF3a KKRWQLALSKGVHFV DRB1*07:01 18 287 144 250 ORF3a LVYFLQSINFVRIIM DQB1*05:03, DRB1*12:01, DRB1*14:01 7 218 218 251 ORF3a QSINFVRIIMRLWLC DQB1*06:02, DRB1*03:01, DRB1*11:01, DRB1*12:01, DRB1*14:01, DRB1*15:01 21 505 168 252 ORF3a KNPLLYDANYFLCWH DQB1*05:03, DRB1*15:01 7 112 112 253 ORF8 FLGIITTVAAFHQEC DQB1*03:02, DQB1*06:03, DRB1*04:02 9 185 185 254 ORF8 FYSKWYIRVGARKSA DQB1*06:01, DRB1*04:02, DRB1*07:01, DRB1*11:01, DRB1*11:04, DRB1*13:03, DRB1*14:01, DRB1*14:06, DRB1*15:01, DRB1*15:02, DRB1*16:01, DRB1*16:02 55 2805 468 255 ORF8 YIRVGARKSAPLIEL DQB1*03:01, DRB1*11:04, DRB1*13:02, DRB1*15:01, DRB1*16:01 18 731 366 256 nsp3 KVTFFPDLNGDVVAI DQB1*05:03 15 293 147 257 nsp12 KLLKSIAATRGATVV DQB1*03:03, DRB1*07:01 6 230 230 258 nsp12 LMIERFVSLAIDAYP DQB1*02:02, DQB1*03:02, DQB1*04:02, DQB1*05:01, DQB1*06:04, DRB1*01:01, DRB1*04:04, DRB1*07:01, DRB1*10:01, DRB1*13:02, DRB1*15:01 36 1941 388 259 S SLLIVNNATNVVIKV DRB1*12:01, DRB1*14:01 9 164 164 260 S CEFQFCNDPFLGVYY DQB1*05:02, DQB1*05:03 27 1077 359 261 S CTFEYVSQPFLMDLE DQB1*02:01, DQB1*02:02, DQB1*05:02, 64 4332 619 262 DQB1*05:03, DRB1*07:01, DRB1*16:01 S IGINITRFQTLLALH DRB1*07:01 9 177 177 263 S TRFQTLLALHRSYLT DQB1*05:03, DRB1*12:01, DRB1*14:01 18 4343 2172 264 S FTVEKGIYQTSNFRV DRB1*07:01 9 1202 1202 265 S SNFRVQPTESIVRFP DRB1*07:01 9 243 243 266 S IVRFPNITNLCPFGE DRB1*15:01 9 107 107 267 S CPFGEVFNATRFASV DQB1*06:03, DRB1*07:01, DRB1*13:01 9 108 108 268 S AYSNNSIAIPTNFTI DQB1*03:01 8 112 112 269 S NLLLQYGSFCTQLNR DQB1*05:03, DRB1*04:04, DRB1*15:01 31 4560 1140 270 S TQLNRALTGIAVEQD DQB1*04:02, DQB1*06:02 8 260 260 271 S VFAQVKQIYKTPPIK DRB1*15:01 8 268 268 272 S NFSQILPDPSKPSKR DRB1*03:01 33 2589 647 273 S KPSKRSFIEDLLFNK DQB1*02:02, DQB1*05:03 17 1243 622 274 S SFIEDLLFNKVTLAD DQB1*05:03, DRB1*03:01, DRB1*12:01, DRB1*14:01 17 812 406 275 S CAQKFNGLTVLPPLL DQB1*05:02, DQB1*06:02, DRB1*16:01 9 741 741 276 S AQYTSALLAGTITSG DQB1*06:02 9 336 336 277 S APHGVVFLHVTYVPA DRB1*12:01 7 293 293 278 S ELDKYFKNHTSPDVD HLA class II 7 361 361 279 S GINASVVNIQKEIDR HLA class II 8 267 267 280

TABLE-US-00005 List of CD8+ T cell epitopes identified and the HLA restrictions. A total of 523 class I epitopes were identified by AIM assay and encompassed the 8 dominant SARS-CoV-2 antigens for CD8+ T cells Protein Allele Start Length Sequence Frequency of positive response Sum of response Magnitude of response SEQ ID NO: nsp3 A*01:01 1636 11 HTTDPSFLGRY 100 9005 4503 281 nsp3 A*01:01 1637 11 TTDPSFLGRYM 100 22755 11378 282 N A*30:02 324 10 VTPSGTWLTY 100 902 451 283 M A*68:01 142 9 AVILRGHLR 100 666 333 284 S A*68:01 30 9 NSFTRGVYY 100 600 300 285 S A*68:01 69 9 HVSGTNGTK 100 972 486 286 S A*68:01 409 9 QIAPGQTGK 100 518 259 287 N B*57:01 43 10 QGLPNNTASW 100 1466 733 288 N B*57:01 100 9 KMKDLSPRW 100 426 213 289 ORF3a B*57:01 33 9 ATIPIQASL 100 363 182 290 nsp3 B*57:01 1551 9 ITFDNLKTL 100 400 200 291 S A*24:02 265 11 YYVGYLQPRTF 75 1452 484 292 S A*24:02 1137 12 VYDPLQPELDSF 75 2244 748 293 S A*26:01 258 9 WTAGAAAYY 75 815 272 294 S A*26:01 686 10 SVASQSIIAY 75 862 287 295 S B*35:01 687 9 VASQSIIAY 75 1444 481 296 nsp3 A*01:01 1322 8 TDNYITTY 67 2748 1374 297 N A*11:01 361 10 KTFPPTEPKK 67 411 206 298 N B*07:02 105 9 SPRWYFYYL 67 5911 2956 299 S B*15:01 634 10 RVYSTGSNVF 67 1045 523 300 ORF3a B*35:01 35 9 IPIQASLPF 67 1617 809 301 nsp4 B*35:01 2898 8 TPSKLIEY 67 1438 719 302 nsp4 B*35:01 3136 9 VPFWITIAY 67 1039 520 303 N B*44:02 289 10 QELIRQGTDY 67 456 228 304 S B*08:01 506 8 QPYRVVVL 60 1616 539 305 S B*44:02 747 10 TECSNLLLQY 60 794 265 306 S A*03:01 41 9 KVFRSSVLH 50 272 136 307 S A*24:02 159 10 VYSSANNCTF 50 719 360 308 S A*24:02 312 9 IYQTSNFRV 50 710 355 309 S A*26:01 718 9 FTISVTTEI 50 997 499 310 S A*29:02 162 9 SANNCTFEY 50 282 141 311 S A*29:02 192 9 FVFKNIDGY 50 314 157 312 S A*29:02 361 9 CVADYSVLY 50 931 466 313 S A*29:02 445 9 VGGNYNYLY 50 439 220 314 M B*07:02 131 8 RPLLESEL 50 537 269 315 M B*07:02 164 9 LPKEITVAT 50 515 258 316 S B*35:01 79 14 FDNPVLPFNDGVYF 50 270 135 317 S B*35:01 895 10 QIPFAMQMAY 50 404 202 318 nsp12 B*51:01 4586 9 DAMRNAGIV 50 508 254 319 nsp12 B*51:01 5220 10 YLPYPDPSRI 50 519 260 320 S B*07:02 462 11 KPFERDISTEI 40 2921 1461 321 S B*07:02 1052 9 FPQSAPHGV 40 413 207 322 S B*08:01 216 8 LPQGFSAL 40 816 408 323 S B*08:01 869 9 MIAQYTSAL 40 1025 513 324 N B*40:01 322 10 MEVTPSGTWL 40 452 226 325 S B*40:01 168 10 FEYVSQPFLM 40 748 374 326 S B*40:01 323 13 TESIVRFPNITNL 40 433 217 327 S B*40:01 1256 10 FDEDDSEPVL 40 430 215 328 S B*40:01 1261 10 SEPVLKGVKL 40 501 251 329 S B*44:02 297 10 SETKCTLKSF 40 619 310 330 S B*44:02 553 13 TESNKKFLPFQQF 40 813 407 331 S B*44:02 653 8 AEHVNNSY 40 1949 975 332 M A*02:01 65 9 FVLAAVYRI 38 751 250 333 N B*35:01 79 9 SPDDQIGYY 33 682 341 334 N B*35:01 266 9 KAYNVTQAF 33 1694 847 335 N B*35:01 307 9 FAPSASAFF 33 809 405 336 N B*35:01 325 9 TPSGTWLTY 33 975 488 337 N B*35:01 395 9 LPAADLDDF 33 440 220 338 M A*02:01 15 9 KLLEQWNLV 25 357 179 339 M A*02:01 108 9 SMWSFNPET 25 727 364 340 N B*07:02 257 9 KPRQKRTAT 33 5475 5475 341 S B*07:02 506 8 QPYRVVVL 25 3589 3589 342 S B*44:02 917 11 YENQKLIANQF 20 3070 3070 343 N B*07:02 66 9 FPRGQGVPI 33 2472 2472 344 nsp4 A*31:01 3155 9 WFFSNYLKR 100 2244 2244 345 nsp16 B*57:01 6875 12 GVAPGTAVLRQW 100 2223 2223 346 N A*68:01 311 9 ASAFFGMSR 50 2067 2067 347 M B*57:01 84 9 MACLVGLMW 50 1711 1711 348 nsp16 B*57:01 6913 10 CATVHTANKW 100 1697 1697 349 N A*24:02 306 10 QFAPSASAFF 25 1560 1560 350 nsp4 B*35:01 3199 9 LPLTQYNRY 33 1552 1552 351 M B*44:02 136 9 SELVIGAVI 33 1472 1472 352 S B*44:02 1016 9 AEIRASANL 20 1427 1427 353 N A*68:01 310 10 SASAFFGMSR 50 1407 1407 354 S B*35:01 258 9 WTAGAAAYY 25 1401 1401 355 M A*68:02 65 9 FVLAAVYRI 100 1303 1303 356 nsp4 A*02:01 2788 8 YLITPVHV 100 1151 1151 357 nsp3 B*07:02 2017 12 KPVETSNSFDVL 33 1129 1129 358 nsp12 B*44:02 4645 13 AESHVDTDLTKPY 33 1125 1125 359 S B*57:01 604 9 TSNQVAVLY 100 1099 1099 360 S B*44:02 989 9 AEVQIDRLI 20 1098 1098 361 ORF3a A*02:01 100 9 GLEAPFLYL 33 1086 1086 362 S B*57:01 1093 10 GVFVSNGTHW 100 1057 1057 363 M A*31:01 93 9 LSYFIASFR 100 1045 1045 364 N B*08:01 105 9 SPRWYFYYL 33 1034 1034 365 S B*08:01 691 9 SIIAYTMSL 20 1028 1028 366 M A*01:01 188 9 AGDSGFAAY 25 1020 1020 367 S A*02:01 1048 9 HLMSFPQSA 17 1011 1011 368 ORF3a B*08:01 57 9 QSASKIITL 33 986 986 369 nsp3 A*01:01 1637 10 TTDPSFLGRY 100 978 978 370 M B*57:01 67 9 LAAVYRINW 50 973 973 371 nsp12 B*57:01 4892 10 KSAGFPFNKW 100 950 950 372 ORF3a A*24:02 106 9 LYLYALVYF 50 943 943 373 nsp3 A*26:01 2495 10 TVKNGSIHLY 50 941 941 374 nsp3 B*44:02 1723 14 GELGDVRETMSYLF 100 939 939 375 M B*15:01 186 11 RVAGDSGFAAY 50 924 924 376 S A*29:02 1147 9 SFKEELDKY 25 898 898 377 nsp4 A*31:01 2941 9 GSVAYESLR 100 896 896 378 nsp3 A*26:01 2305 10 ETIQITISSF 50 893 893 379 ORF3a B*57:01 120 9 FVRIIMRLW 50 883 883 380 nsp4 A*31:01 3219 9 GAMDTTSYR 100 846 846 381 nsp12 B*44:02 5001 10 VENPHLMGWD 33 830 830 382 S A*24:02 169 9 EYVSQPFLM 25 815 815 383 S A*26:01 1095 9 FVSNGTHWF 25 812 812 384 nsp4 B*35:01 2960 9 SIIQFPNTY 33 803 803 385 nsp3 B*07:02 2109 9 KPNELSRVL 33 801 801 386 M A*30:01 171 10 ATSRTLSYYK 100 800 800 387 nsp16 B*07:02 7048 9 FPLKLRGTA 50 792 792 388 nsp3 A*26:01 2664 14 EVTGDSCNNYMLTY 50 789 789 389 nsp3 A*26:01 2089 11 EVGHTDLMAAY 50 785 785 390 nsp3 A*01:01 2086 14 ITEEVGHTDLMAAY 50 774 774 391 nsp3 B*44:02 941 9 FEPSTQYEY 100 771 771 392 nsp12 B*07:02 4503 9 VPHISRQRL 100 759 759 393 nsp3 A*02:01 2332 9 ILFTRFFYV 50 752 752 394 S B*44:03 1181 9 KEIDRLNEV 20 746 746 395 nsp3 B*44:02 1364 10 KQEILGTVSW 100 739 739 396 nsp4 A*02:01 3115 10 YLTNDVSFLA 100 737 737 397 S B*07:02 506 10 QPYRVVVLSF 25 721 721 398 S A*01:01 28 10 YTNSFTRGVY 33 711 711 399 nsp12 B*57:01 5299 10 LTNDNTSRYW 100 704 704 400 S A*31:01 458 9 KSNLKPFER 50 701 701 401 S B*08:01 269 9 YLQPRTFLL 20 691 691 402 S B*44:02 1201 9 QELGKYEQY 20 685 685 403 nsp3 A*26:01 1873 10 YTTTIKPVTY 50 683 683 404 nsp4 A*31:01 3004 9 WVLNNDYYR 100 678 678 405 nsp3 A*29:02 2389 9 SFYYVWKSY 50 677 677 406 nsp4 A*31:01 3060 9 LAYYFMRFR 100 676 676 407 ORF3a B*08:01 63 9 ITLKKRWQL 33 669 669 408 nsp3 A*26:01 2272 10 NSTNVTIATY 50 660 660 409 nsp3 A*26:01 2594 9 YVNTFSSTF 50 656 656 410 S A*29:02 1264 9 VLKGVKLHY 25 631 631 411 nsp4 A*02:01 3100 8 FLPGVYSV 100 626 626 412 N B*07:02 45 9 LPNNTASWF 33 609 609 413 S A*24:02 448 9 NYNYLYRLF 25 606 606 414 nsp3 A*26:01 2435 10 YVYANGGKGF 50 593 593 415 S B*35:01 896 9 IPFAMQMAY 25 588 588 416 nsp3 A*26:01 2585 10 EVAVKMFDAY 50 587 587 417 S B*44:03 297 10 SETKCTLKSF 20 559 559 418 S B*57:01 710 9 NSIAIPTNF 100 559 559 419 nsp4 B*35:01 3196 9 DVLLPLTQY 33 557 557 420 S A*26:01 340 12 EVFNATRFASVY 25 556 556 421 S A*24:02 1101 9 HWFVTQRNF 25 551 551 422 nsp3 B*44:02 2111 9 NELSRVLGL 33 551 551 423 nsp4 B*35:01 2949 9 RPDTRYVLM 33 542 542 424 nsp3 B*44:03 2680 9 VENMTPRDL 50 541 541 425 nsp3 B*44:02 1857 12 SEYKGPITDVFY 33 540 540 426 S A*24:02 328 11 RFPNITNLCPF 25 539 539 427 S B*35:01 1052 11 FPQSAPHGVVF 25 537 537 428 S B*57:01 685 9 RSVASQSII 100 534 534 429 nsp3 A*68:01 828 10 DTVIEVQGYK 50 533 533 430 nsp3 A*26:01 1966 10 DVVAIDYKHY 50 530 530 431 S A*29:02 30 9 NSFTRGVYY 25 507 507 432 M A*30:02 186 14 RVAGDSGFAAYSRY 100 505 505 433 ORF3a B*51:01 35 9 IPIQASLPF 50 491 491 434 S B*44:02 1206 9 YEQYIKWPW 20 489 489 435 nsp3 A*30:01 1647 9 MSALNHTKK 100 486 486 436 S B*44:02 339 9 GEVFNATRF 20 482 482 437 S A*24:02 193 9 VFKNIDGYF 25 467 467 438 S A*24:02 1094 10 VFVSNGTHWF 25 465 465 439 nsp3 B*44:02 1023 9 IEVNSFSGY 100 464 464 440 nsp3 A*26:01 2132 10 SVPWDTIANY 50 461 461 441 nsp3 B*44:02 2325 9 AEWFLAYIL 33 461 461 442 S B*44:02 95 10 TEKSNIIRGW 20 459 459 443 nsp16 B*07:02 7033 10 NPIQLSSYSL 50 453 453 444 nsp3 A*26:01 2582 9 DSAEVAVKM 50 452 452 445 nsp4 A*02:01 2884 9 FLPRVFSAV 100 447 447 446 nsp3 A*26:01 2201 9 NTVKSVGKF 50 443 443 447 nsp3 B*57:01 2254 9 MSNLGMPSY 100 443 443 448 S A*29:02 781 9 VFAQVKQIY 25 442 442 449 S B*07:02 229 10 LPIGINITRF 20 442 442 450 N B*57:01 123 10 YGANKDGIIW 50 441 441 451 S B*35:01 1095 9 FVSNGTHWF 25 436 436 452 S A*30:01 1065 9 VTYVPAQEK 33 435 435 453 nsp12 A*11:01 4733 9 VVSTGYHFR 100 434 434 454 nsp3 A*68:01 1504 9 TISLAGSYK 50 433 433 455 S A*26:01 28 10 YTNSFTRGVY 25 432 432 456 S A*30:01 634 9 RVYSTGSNV 33 428 428 457 N A*26:01 290 9 ELIRQGTDY 33 424 424 458 nsp3 B*57:01 1505 10 ISLAGSYKDW 50 424 424 459 nsp3 A*26:01 1891 9 EIDPKLDNY 50 422 422 460 nsp3 B*44:02 2618 9 AELAKNVSL 33 417 417 461 S A*26:01 442 10 DSKVGGNYNY 25 407 407 462 nsp3 B*44:02 1825 12 SEYTGNYQCGHY 33 407 407 463 S B*07:02 208 9 TPINLVRDL 20 406 406 464 S B*07:02 588 10 TPCSFGGVSV 20 405 405 465 S A*02:01 269 9 YLQPRTFLL 17 404 404 466 S B*08:01 233 9 INITRFQTL 20 402 402 467 S A*03:01 827 9 TLADAGFIK 25 398 398 468 nsp3 A*26:01 2323 9 LVAEWFLAY 50 394 394 469 S A*29:02 865 9 LTDEMIAQY 25 393 393 470 S B*53:01 712 9 IAIPTNFTI 100 393 393 471 nsp3 B*44:02 1869 14 KENSYTTTIKPVTY 33 392 392 472 nsp3 A*30:01 2189 9 RIKASMPTT 100 390 390 473 S A*26:01 298 9 ETKCTLKSF 25 387 387 474 nsp3 B*57:01 2318 10 LTAFGLVAEW 100 384 384 475 nsp3 A*30:01 2191 9 KASMPTTIA 100 382 382 476 M A*30:01 42 9 RNRFLYIIK 50 380 380 477 S A*24:02 268 10 GYLQPRTFLL 25 378 378 478 S A*29:02 687 9 VASQSIIAY 25 377 377 479 nsp3 A*26:01 2246 9 STAALGVLM 50 376 376 480 nsp3 B*40:01 1006 9 VEVQPQLEM 50 374 374 481 S A*02:01 1060 9 VVFLHVTYV 17 365 365 482 S A*24:02 78 9 RFDNPVLPF 25 365 365 483 S A*26:01 192 9 FVFKNIDGY 25 365 365 484 S A*26:01 361 9 CVADYSVLY 25 362 362 485 N A*01:01 75 13 NTNSSPDDQIGYY 33 359 359 486 nsp3 B*44:02 2513 9 YERHSLSHF 33 359 359 487 nsp12 B*44:02 4998 12 YSDVENPHLMGW 33 359 359 488 S B*51:01 712 9 IAIPTNFTI 25 355 355 489 nsp3 A*26:01 2456 9 DTFCAGSTF 50 351 351 490 nsp3 B*44:02 2550 11 EESSAKSASVY 33 350 350 491 S A*24:02 634 10 RVYSTGSNVF 25 349 349 492 S A*24:02 144 9 YYHKNNKSW 25 348 348 493 nsp12 B*51:01 4971 9 IAATRGATV 25 343 343 494 S A*68:01 89 9 GVYFASTEK 50 340 340 495 S B*44:03 1201 9 QELGKYEQY 20 339 339 496 M A*68:02 212 9 SSSDNIALL 100 337 337 497 M A*11:01 171 9 ATSRTLSYY 100 336 336 498 S A*26:01 780 10 EVFAQVKQIY 25 336 336 499 nsp12 B*51:01 5221 10 LPYPDPSRIL 25 335 335 500 M B*07:02 122 8 VPLHGTIL 25 334 334 501 S B*44:02 779 11 QEVFAQVKQIY 20 333 333 502 nsp12 A*68:01 4938 10 YAISAKNRAR 100 331 331 503 nsp3 B*40:01 843 11 FELDERIDKVL 50 329 329 504 M A*68:01 137 10 ELVIGAVILR 50 328 328 505 nsp3 A*30:01 2192 9 ASMPTTIAK 100 327 327 506 S B*44:03 95 10 TEKSNIIRGW 25 327 327 507 S A*68:01 1173 9 NASVVNIQK 50 326 326 508 nsp3 A*11:01 1582 9 QVVDMSMTY 100 325 325 509 nsp3 A*68:01 1378 9 MLAHAEETR 50 324 324 510 nsp3 A*26:01 1865 9 DVFYKENSY 50 322 322 511 S A*68:01 35 10 GVYYPDKVFR 50 314 314 512 S A*26:01 30 9 NSFTRGVYY 25 313 313 513 S B*07:02 1262 9 EPVLKGVKL 20 313 313 514 nsp3 A*68:01 1636 10 HTTDPSFLGR 50 312 312 515 S B*08:01 234 8 NITRFQTL 20 312 312 516 nsp3 B*44:02 2616 9 AEAELAKNV 33 312 312 517 nsp12 B*44:03 4558 9 VENPDILRV 50 312 312 518 nsp3 B*40:01 1135 9 YENFNQHEV 50 310 310 519 nsp3 B*51:01 1048 9 EAKKVKPTV 33 308 308 520 S B*51:01 923 9 IANQFNSAI 25 307 307 521 S A*26:01 603 10 NTSNQVAVLY 25 304 304 522 S A*26:01 583 10 EILDITPCSF 25 302 302 523 M A*68:01 6 9 GTITVEELK 50 302 302 524 S A*32:01 1059 9 GVVFLHVTY 50 301 301 525 S B*07:02 84 9 LPFNDGVYF 20 299 299 526 nsp12 B*44:02 5193 12 TETDLTKGPHEF 33 299 299 527 S B*44:03 1091 12 REGVFVSNGTHW 20 299 299 528 S B*08:01 202 9 KIYSKHTPI 20 298 298 529 S A*02:01 109 9 TLDSKTQSL 17 296 296 530 M A*68:01 93 9 LSYFIASFR 50 294 294 531 S B*35:01 865 9 LTDEMIAQY 25 294 294 532 nsp3 B*35:01 1270 9 LVSDIDITF 100 294 294 533 S B*40:01 339 9 GEVFNATRF 20 294 294 534 ORF3a B*44:02 98 12 AAGLEAPFLYLY 33 294 294 535 S B*51:01 224 8 EPLVDLPI 25 294 294 536 S B*51:01 351 8 YAWNRKRI 25 293 293 537 M A*68:01 138 9 LVIGAVILR 50 292 292 538 S B*44:03 339 9 GEVFNATRF 20 292 292 539 nsp12 A*68:01 4840 10 AAISDYDYYR 100 290 290 540 S B*44:02 1181 9 KEIDRLNEV 20 286 286 541 nsp3 B*44:02 2584 8 AEVAVKMF 33 284 284 542 S B*44:03 747 10 TECSNLLLQY 20 284 284 543 nsp3 B*44:03 1364 10 KQEILGTVSW 100 284 284 544 nsp3 A*30:01 1951 9 ASRELKVTF 100 283 283 545 nsp3 B*44:03 2088 12 EEVGHTDLMAAY 50 283 283 546 S B*08:01 680 8 SPRRARSV 20 282 282 547 S A*30:02 628 9 QLTPTWRVY 100 280 280 548 S B*51:01 780 9 EVFAQVKQI 25 280 280 549 S A*24:02 706 9 AYSNNSIAI 25 278 278 550 S B*35:01 604 9 TSNQVAVLY 25 278 278 551 nsp3 A*26:01 2468 10 EVARDLSLQF 50 275 275 552 ORF3a B*35:01 97 9 VAAGLEAPF 33 275 275 553 nsp3 A*68:01 1155 9 GADPIHSLR 50 274 274 554 nsp3 A*68:01 1296 9 LTAV V IPTK 50 274 274 555 nsp3 B*35:01 1056 9 VVVNAANVY 100 273 273 556 ORF3a A*02:01 89 9 TVYSHLLLV 33 272 272 557 N A*11:01 134 10 ATEGALNTPK 33 272 272 558 S B*35:01 84 9 LPFNDGVYF 25 272 272 559 S A*03:01 142 9 GVYYHKNNK 25 270 270 560 M A*30:01 198 9 RYRIGNYKL 100 270 270 561 S A*68:01 400 9 FVIRGDEVR 50 269 269 562 N B*07:02 308 10 APSASAFFGM 33 269 269 563 S A*03:01 1019 10 RASANLAATK 25 268 268 564 ORF3a A*68:01 8 9 FTIGTVTLK 100 268 268 565 N A*02:01 222 9 LLLDRLNQL 20 266 266 566 N A*30:01 147 9 GTRNPANNA 50 265 265 567 S B*44:02 829 9 ADAGFIKQY 20 265 265 568 S A*02:01 1000 9 RLQSLQTYV 17 264 264 569 S B*35:01 861 9 LPPLLTDEM 25 264 264 570 nsp3 B*40:01 1012 9 LEMELTPVV 50 262 262 571 nsp3 A*03:01 2749 9 QVVNVVTTK 100 260 260 572 nsp12 A*68:01 5025 9 MASLVLARK 100 260 260 573 N B*07:02 5 13 GPQNQRNAPRITF 33 260 260 574 nsp12 A*32:01 5315 9 AMYTPHTVL 50 258 258 575 N B*07:02 41 10 RPQGLPNNTA 33 258 258 576 nsp3 A*26:01 2136 10 DTIANYAKPF 50 256 256 577 S B*40:01 1181 9 KEIDRLNEV 20 256 256 578 N A*03:01 361 10 KTFPPTEPKK 33 255 255 579 nsp12 A*11:01 4814 9 FAVSKGFFK 100 255 255 580 S B*51:01 896 9 IPFAMQMAY 25 255 255 581 S B*07:02 714 9 IPTNFTISV 20 254 254 582 M B*35:01 39 9 YANRNRFLY 25 254 254 583 S A*03:01 725 9 EILPVSMTK 25 253 253 584 S A*29:02 444 10 KVGGNYNYLY 25 253 253 585 ORF3a A*68:01 227 9 HVTFFIYNK 100 252 252 586 nsp12 B*40:01 5308 9 WEPEFYEAM 33 252 252 587 S A*68:01 1064 10 HVTYVPAQEK 50 250 250 588 nsp12 A*11:01 4800 10 QTVKPGNFNK 100 249 249 589 nsp3 B*44:02 862 10 VELGTEVNEF 100 249 249 590 nsp3 B*40:01 887 9 SELLTPLGI 50 245 245 591 ORF3a B*51:01 158 12 IPYNSVTSSIVI 50 245 245 592 nsp3 B*51:01 2268 9 EGYLNSTNV 33 245 245 593 N B*51:01 121 10 LPYGANKDGI 33 244 244 594 nsp3 B*57:01 1999 10 NKATYKPNTW 100 244 244 595 S A*02:06 612 9 YQDVNCTEV 50 243 243 596 S A*29:02 258 9 WTAGAAAYY 25 243 243 597 nsp12 B*51:01 5217 13 DYVYLPYPDPSRI 25 243 243 598 N A*68:01 361 9 KTFPPTEPK 50 242 242 599 M B*57:01 68 8 AAVYRINW 50 242 242 600 M A*30:01 101 9 RLFARTRSM 100 241 241 601 nsp12 A*33:01 4810 13 DFYDFAVSKGFFK 100 239 239 602 nsp3 B*51:01 1283 9 APYIVGDVV 33 238 238 603 S B*35:01 898 9 FAMQMAYRF 25 236 236 604 S A*03:01 1065 9 VTYVPAQEK 25 235 235 605 S A*24:02 1051 12 SFPQSAPHGVVF 25 234 234 606 S A*31:01 454 9 RLFRKSNLK 50 233 233 607 S B*53:01 24 9 LPPAYTNSF 100 232 232 608 nsp3 A*24:02 2593 10 AYVNTFSSTF 50 231 231 609 S A*29:02 261 9 GAAAYYVGY 25 231 231 610 nsp3 B*44:03 1365 9 QEILGTVSW 100 230 230 611 nsp3 A*68:01 1217 9 ESKPSVEQR 50 229 229 612 ORF3a B*51:01 41 8 LPFGWLIV 50 229 229 613 nsp3 B*51:01 2194 10 MPTTIAKNTV 33 228 228 614 S B*08:01 109 9 TLDSKTQSL 20 227 227 615 nsp4 B*40:01 2804 9 SEIIGYKAI 100 227 227 616 S A*03:01 1136 14 TVYDPLQPELDSFK 25 225 225 617 S A*29:02 151 10 SWMESEFRVY 25 225 225 618 nsp3 B*44:03 2616 9 AEAELAKNV 50 225 225 619 S A*30:01 41 9 KVFRSSVLH 33 223 223 620 nsp3 B*51:01 2604 9 VPMEKLKTL 33 223 223 621 M B*35:01 37 9 FAYANRNRF 25 222 222 622 nsp12 B*51:01 5219 11 VYLPYPDPSRI 25 222 222 623 nsp4 A*24:02 3131 9 MFTPLVPFW 50 220 220 624 nsp12 B*51:01 4920 9 FAYTKRNVI 25 219 219 625 nsp3 B*57:01 1170 9 RTNVYLAVF 50 219 219 626 nsp12 A*68:01 4732 10 FVVSTGYHFR 100 217 217 627 nsp12 A*33:01 5024 9 IMASLVLAR 100 216 216 628 nsp3 B*40:01 2030 10 SEDAQGMDNL 50 216 216 629 nsp3 B*57:01 2704 10 AKSHNIALIW 100 216 216 630 S A*29:02 1102 9 WFVTQRNFY 25 215 215 631 nsp12 A*33:01 4953 9 SICSTMTNR 100 215 215 632 S A*24:02 1208 9 QYIKWPWYI 25 214 214 633 M A*68:01 5 10 NGTITVEELK 50 214 214 634 nsp4 A*02:06 3122 9 FLAHIQWMV 100 212 212 635 nsp3 A*24:02 2167 9 NYMPYFFTL 50 209 209 636 nsp12 A*29:02 4533 9 TLKEILVTY 100 208 208 637 S B*51:01 495 9 YGFQPTNGV 25 208 208 638 nsp12 B*51:01 5318 9 TPHTVLQAV 25 206 206 639 S A*68:01 88 10 DGVYFASTEK 50 205 205 640 nsp16 A*32:01 7020 9 YVMHANYIF 100 204 204 641 S B*44:03 464 10 FERDISTEIY 20 204 204 642 nsp3 B*44:03 2049 9 EEVVENPTI 50 204 204 643 N B*57:01 266 9 KAYNVTQAF 50 204 204 644 nsp6 A*02:01 3666 9 WLDMVDTSL 100 203 203 645 N A*30:01 119 9 AGLPYGANK 50 203 203 646 M A*33:01 97 9 IASFRLFAR 100 203 203 647 nsp12 A*11:01 4433 10 KVAGFAKFLK 100 202 202 648 S A*31:01 677 9 QTNSPRRAR 50 200 200 649 S B*44:03 653 8 AEHVNNSY 25 199 199 650 nsp3 A*24:02 2098 10 AYVDNSSLTI 50 197 197 651 nsp3 A*11:01 1090 9 YIATNGPLK 100 196 196 652 nsp4 B*57:01 2875 10 RTTNGDFLHF 100 196 196 653 S A*23:01 1208 10 QYIKWPWYIW 50 193 193 654 S B*35:01 321 9 QPTESIVRF 25 193 193 655 nsp3 A*01:01 1863 11 ITDVFYKENSY 50 192 192 656 S B*35:01 162 9 SANNCTFEY 25 192 192 657 S A*03:01 349 9 SVYAWNRKR 25 190 190 658 nsp3 A*03:01 1646 9 YMSALNHTK 100 190 190 659 nsp3 B*44:02 2325 10 AEWFLAYILF 33 190 190 660 S B*51:01 714 9 IPTNFTISV 25 190 190 661 S B*07:02 216 8 LPQGFSAL 20 189 189 662 S B*51:01 84 9 LPFNDGVYF 25 189 189 663 nsp3 B* 15:01 2254 9 MSNLGMPSY 100 188 188 664 nsp3 B*40:01 1014 10 MELTPVVQTI 50 188 188 665 M A*68:01 190 9 DSGFAAYSR 50 187 187 666 ORF3a A*29:02 99 9 AGLEAPFLY 50 185 185 667 S B*35:01 229 10 LPIGINITRF 25 185 185 668 nsp12 A*11:01 4977 9 ATVVIGTSK 100 184 184 669 nsp12 B*44:02 4558 10 VENPDILRVY 33 183 183 670 nsp3 B*40:01 960 10 LEFGATSAAL 50 182 182 671 nsp3 B*40:01 2111 9 NELSRVLGL 50 182 182 672 S B*07:02 24 9 LPPAYTNSF 20 181 181 673 nsp3 A*29:02 2323 9 LVAEWFLAY 50 175 175 674 S B*51:01 8 9 LPLVSSQCV 25 175 175 675 nsp3 B*57:01 1648 9 SALNHTKKW 50 175 175 676 S A*02:06 1060 9 VVFLHVTYV 50 174 174 677 nsp12 A*11:01 4841 9 AISDYDYYR 100 173 173 678 nsp3 B*51:01 2169 8 MPYFFTLL 33 173 173 679 ORF3a B*53:01 137 9 NPLLYDANY 100 172 172 680 nsp3 B*57:01 2469 9 VARDLSLQF 100 172 172 681 nsp4 A*02:06 2864 9 FVVPGLPGT 100 170 170 682 S A*31:01 449 9 YNYLYRLFR 50 170 170 683 M B*35:01 170 9 VATSRTLSY 25 169 169 684 nsp3 B*51:01 1658 10 YPQVNGLTSI 33 169 169 685 nsp3 B*44:02 1890 11 TEIDPKLDNYY 33 168 168 686 S A*24:02 36 8 VYYPDKVF 25 167 167 687 nsp4 B*51:01 2854 9 IAAVITREV 100 167 167 688 S A*03:01 378 9 KCYGVSPTK 25 166 166 689 nsp3 A*68:01 1210 10 EVKPFITESK 50 166 166 690 S A*02:01 691 9 SIIAYTMSL 17 165 165 691 S B*40:01 1194 10 NESLIDLQEL 20 165 165 692 S A*31:01 1099 9 GTHWFVTQR 50 164 164 693 S A*68:01 347 9 FASVYAWNR 50 164 164 694 S B*35:01 24 9 LPPAYTNSF 25 163 163 695 S B*44:03 779 11 QEVFAQVKQIY 20 163 163 696 S B*53:01 55 10 FLPFFSNVTW 100 163 163 697 S B*35:01 343 9 NATRFASVY 25 162 162 698 S B*07:02 321 9 QPTESIVRF 20 160 160 699 nsp3 B*57:01 1951 9 ASRELKVTF 100 159 159 700 nsp3 A*02:06 1923 9 ASFDNFKFV 100 158 158 701 nsp3 B*57:01 1477 10 VSSPDAVTAY 50 158 158 702 M A*01:01 39 9 YANRNRFLY 25 157 157 703 nsp16 B*44:02 7014 13 REQIDGYVMHANY 50 157 157 704 S B*51:01 574 9 DAVRDPQTL 25 157 157 705 S B*51:01 1089 8 FPREGVFV 25 156 156 706 nsp6 A*24:02 3653 9 VYMPASWVM 100 155 155 707 S B*57:01 622 12 VAIHADQLTPTW 100 155 155 708 nsp6 A*02:01 3605 9 FLYENAFLP 100 154 154 709 S A*31:01 346 10 RFASVYAWNR 50 154 154 710 S B*40:01 464 9 FERDISTEI 20 154 154 711 nsp3 B*57:01 2355 9 AVHFISNSW 100 154 154 712 nsp3 A*29:02 2384 9 YIFFASFYY 50 153 153 713 S A*02:01 857 9 GLTVLPPLL 17 151 151 714 N A*11:01 249 9 KSAAEASKK 33 151 151 715 nsp4 A*24:02 3108 9 IYLYLTFYL 50 151 151 716 nsp3 A*03:01 2753 9 VVTTKIALK 100 149 149 717 nsp3 A*24:02 1971 9 DYKHYTPSF 50 149 149 718 ORF3a A*01:01 207 9 FTSDYYQLY 33 147 147 719 nsp12 A*02:06 4557 10 FVENPDILRV 100 147 147 720 nsp3 A*24:02 1899 9 YYKKDNSYF 50 147 147 721 nsp3 A*24:02 2330 8 AYILFTRF 50 147 147 722 nsp3 B* 15:01 1967 9 VVAIDYKHY 100 147 147 723 nsp3 B*57:01 1647 10 MSALNHTKKW 50 147 147 724 nsp3 A*30:01 2196 9 TTIAKNTVK 100 146 146 725 M B*57:01 171 9 ATSRTLSYY 50 145 145 726 S A*68:01 975 9 SVLNDILSR 50 142 142 727 S B* 15:01 1000 8 RLQSLQTY 33 142 142 728 ORF3a A*29:02 206 10 YFTSDYYQLY 50 140 140 729 ORF3a B*57:01 58 12 SASKIITLKKRW 50 140 140 730 ORF3a B*57:01 63 9 ITLKKRWQL 50 140 140 731 N A*68:01 360 10 YKTFPPTEPK 50 139 139 732 S B*44:03 1016 9 AEIRASANL 20 139 139 733 nsp3 B*57:01 1586 9 MSMTYGQQF 50 139 139 734 nsp3 A*01:01 1415 9 VVDYGARFY 33 138 138 735 nsp12 A*29:02 5267 10 QEYADVFHLY 100 138 138 736 nsp3 B*57:01 2553 9 SAKSASVYY 100 138 138 737 nsp6 B*07:02 3655 9 MPASWVMRI 50 137 137 738 S A*31:01 637 10 STGSNVFQTR 50 136 136 739 N A*02:01 316 9 GMSRIGMEV 20 135 135 740 nsp3 A*24:02 2589 10 KMFDAYVNTF 50 135 135 741 nsp3 A*01:01 1937 11 FADDLNQLTGY 50 134 134 742 nsp3 A*02:01 2242 9 SLIYSTAAL 50 134 134 743 nsp12 A*03:01 4892 9 KSAGFPFNK 100 133 133 744 nsp3 A*01:01 2494 11 VTVKNGSIHLY 50 131 131 745 nsp3 A*32:01 2625 9 SLDNVLSTF 50 131 131 746 N B*07:02 150 10 NPANNAAIVL 33 131 131 747 nsp4 B*57:01 3148 8 ISTKHFYW 100 131 131 748 nsp3 A*01:01 2273 9 STNVTIATY 50 129 129 749 S A*03:01 454 9 RLFRKSNLK 25 128 128 750 S A*68:01 637 10 STGSNVFQTR 50 128 128 751 nsp3 A*29:02 2208 10 KFCLEASFNY 50 126 126 752 nsp3 B*57:01 1538 9 TSNPTTFHL 50 126 126 753 S B*35:01 699 9 LGAENSVAY 25 125 125 754 nsp3 A*03:01 1768 9 VMYMGTLSY 100 124 124 755 nsp4 B*51:01 2885 8 LPRVFSAV 100 124 124 756 nsp4 B*51:01 3101 8 LPGVYSVI 100 124 124 757 nsp3 A*01:01 2660 14 QSDIEVTGDSCNNY 50 123 123 758 S A*03:01 292 9 ALDPLSETK 25 123 123 759 nsp4 B*40:01 3071 10 FGEYSHVVAF 100 123 123 760 N A*03:01 361 14 KTFPPTEPKKDKKK 50 122 122 761 S B*53:01 624 10 IHADQLTPTW 100 122 122 762 nsp3 A*03:01 1397 9 AIVSTIQRK 100 121 121 763 M A*30:01 196 10 YSRYRIGNYK 100 121 121 764 nsp16 A*32:01 6980 9 KLMGHFAWW 100 121 121 765 M A*01:01 186 11 RVAGDSGFAAY 33 120 120 766 S A*68:01 725 9 EILPVSMTK 50 120 120 767 nsp3 B* 15:01 2552 9 SSAKSASVY 100 120 120 768 nsp3 A*02:01 1675 9 YLATALLTL 33 119 119 769 S A*31:01 558 10 KFLPFQQFGR 50 119 119 770 nsp3 A*32:01 2273 9 STNVTIATY 50 119 119 771 nsp3 B* 15:01 2435 10 YVYANGGKGF 100 117 117 772 nsp12 B*57:01 4710 9 STVFPPTSF 100 117 117 773 nsp3 A*32:01 2225 9 KLINIIIWF 50 116 116 774 ORF3a A*29:02 204 9 HSYFTSDYY 50 115 115 775 nsp4 B*35:01 2936 10 TNVLEGSVAY 33 115 115 776 nsp3 A*01:01 1891 9 EIDPKLDNY 50 114 114 777 S A*03:01 35 10 GVYYPDKVFR 25 114 114 778 N A*26:01 323 11 EVTPSGTWLTY 33 114 114 779 nsp12 A*32:01 4433 9 KVAGFAKFL 50 113 113 780 nsp4 B*35:01 2924 9 DASGKPVPY 33 113 113 781 S B*40:01 1016 9 AEIRASANL 20 113 113 782 nsp3 A*24:02 1182 9 LYDKLVSSF 100 112 112 783 ORF3a A*29:02 101 9 LEAPFLYLY 50 112 112 784 S A*68:01 370 9 NSASFSTFK 50 112 112 785 S A*26:01 886 9 WTFGAGAAL 25 111 111 786 ORF3a A*24:02 211 9 YYQLYSTQL 50 109 109 787 S A*26:01 604 9 TSNQVAVLY 25 109 109 788 M B*57:01 105 8 RTRSMWSF 50 109 109 789 nsp12 A*33:01 5133 10 FVNEFYAYLR 100 108 108 790 S A*68:01 394 10 NVYADSFVIR 50 108 108 791 nsp4 B*51:01 3022 9 DAVNLLTNM 100 108 108 792 nsp16 B*57:01 6807 9 VAMPNLYKM 100 108 108 793 S A*29:02 686 10 SVASQSIIAY 33 107 107 794 nsp6 B*07:02 3612 10 LPFAMGIIAM 50 107 107 795 M A*03:01 150 9 RIAGHHLGR 50 106 106 796 S A*26:01 695 13 YTMSLGAENSVAY 25 106 106 797 nsp3 A*02:01 843 10 FELDERIDKV 33 105 105 798 S B*44:03 989 9 AEVQIDRLI 20 105 105 799 S B*57:01 880 9 GTITSGWTF 100 105 105 800 S B*53:01 1052 9 FPQSAPHGV 100 103 103 801 S B*40:01 660 11 YECDIPIGAGI 20 101 101 802 S B*40:01 989 8 AEVQIDRL 20 101 101 803

TABLE-US-00006 Cross-reactive CD4 non-spike SARS-CoV-2 Epitopes Sequence Protein Total SFC IFNg IL13 IL5 SEQ ID NO NHNFLVQAGNVQLRV 3CL 51387 33520 1373 10640 804 QNCVLKLKVDTANPK 3CL 1133 147 0 240 805 SEETGTLIVNSVLLF envelope protein 267 267 0 0 806 LAILTALRLCAYCCN envelope protein 1800 1760 0 0 807 TSHKLVLSVNPYVCN Hel 147 133 0 0 808 ISPYNSQNAVASKIL Hel 4267 4093 0 107 809 NVNRFNVAITRAKVG Hel 827 707 0 0 810 QPYVFIKRSDARTAP nsp1 493 360 107 0 811 VLSFCAFAVDAAKAY nsp10 373 160 0 0 812 NMFITREEAIRHVRA nsp14 627 613 0 0 813 REEAIRHVRAWIGFD nsp14 1467 173 0 0 814 PLMYKGLPWNVVRIK nsp14 127 0 0 0 815 EIIKSQDLSVVSKVV nsp15 613 0 0 280 816 TQLCQYLNTLTLAVP nsp16 1227 1027 0 133 817 QIDGYVMHANYIFWR nsp16 773 440 160 0 818 PLNSIIKTIQPRVEK nsp2 2653 1280 0 920 819 EEIAIILASFSASTS nsp2 13813 7773 1507 1587 820 SPLYAFASEAARVVR nsp2 16987 7173 1160 5320 821 AITILDGISQYSLRL nsp2 307 0 0 0 822 QTFFKLVNKFLALCA nsp2 1173 640 107 133 823 GETFVTHSKGLYRKC nsp2 307 0 0 0 824 KGGKIVNNWLKQLIK nsp4 253 0 0 253 825 LFVAAIFYLITPVHV nsp4 880 427 0 0 826 DTRYVLMDGSIIQFP nsp4 213 213 0 0 827 FGEYSHVVAFNTLLF nsp4 960 0 0 0 828 NTLLFLMSFTVLCLT nsp4 333 213 0 0 829 TIAYIICISTKHFYW nsp4 773 533 0 0 830 CTFLLNKEMYLKLRS nsp4 547 493 0 0 831 LLVLVQSTQWSLFFF nsp6 387 253 0 0 832 SLFFFLYENAFLPFA nsp6 240 213 0 0 833 LCLFLLPSLATVAYF nsp6 147 120 0 0 834 TLVYKVYYGNALDQA nsp6 120 0 0 0 835 NRYFRLTLGVYDYLV nsp6 4413 2627 0 200 836 DAFKLNIKLLGVGGK nsp6 400 400 0 0 837 VLKKLKKSLNVAKSE nsp8 2937 2357 0 420 838 LIVTALRANSAVKLQ nsp8 800 773 0 0 839 SDFVRATATIPIQAS ORF3a protein 19453 1453 2827 8853 840 MFHLVDFQVTIAEIL ORF6 protein 11073 9167 340 1220 841 IAEILLIIMRTFKVS ORF6 protein 387 0 0 0 842 LIIMRTFKVSIWNLD ORF6 protein 733 587 0 0 843 TFKVSIWNLDYIINL ORF6 protein 2547 2360 0 0 844 IWNLDYIINLIIKNL ORF6 protein 800 760 0 0 845 YIINLIIKNLSKSLT ORF6 protein 1393 1283 0 0 846 MKIILFLALITLATC ORF7a protein 373 293 0 0 847 VKHVYQLRARSVSPK ORF7a protein 3640 2947 0 227 848 LYSPIFLIVAAIVFI ORF7a protein 520 400 0 0 849 ENLLLYIDINGNLHP PLpro 493 267 0 0 850 EAARYMRSLKVPATV PLpro 227 0 0 0 851 DNFKFVCDNIKFADD PLpro 173 0 0 0 852 NELSRVLGLKTLATH PLpro 547 213 0 0 853 LEASFNYLKSPNFSK PLpro 933 627 0 0 854 GSLIYSTAALGVLMS PLpro 733 733 0 0 855 ISSFKWDLTAFGLVA PLpro 267 173 0 0 856 FDAYVNTFSSTFNVP PLpro 400 347 0 0 857 SHNIALIWNVKDFMS PLpro 1133 320 0 347 858 PDILRVYANLGERVR RdRpol 133 117 0 0 859 SLLMPILTLTRALTA RdRpol 333 267 0 0 860 EFYAYLRKHFSMMIL RdRpol 880 320 0 0 861 LRKHFSMMILSDDAV RdRpol 373 0 0 0 862 GLVASIKNFKSVLYY RdRpol 533 240 0 277 863 KHFYWFFSNYLKRRV nsp4 1853 0 173 347 244 DDQIGYYRRATRRIR nucleocapsid phosphoprotein 787 400 120 0 245 DAALALLLLDRLNQL nucleocapsid phosphoprotein 3813 3520 0 0 246 LLLLDRLNQLESKMS nucleocapsid phosphoprotein 1053 1053 0 0 247 PSGTWLTYTGAIKLD nucleocapsid phosphoprotein 1227 947 0 0 248 ALLAVFQSASKIITL ORF3a protein 1293 360 147 467 249 KKRWQLALSKGVHFV ORF3a protein 907 227 0 0 250 LVYFLQSINFVRIIM ORF3a protein 240 0 0 107 251 QSINFVRIIMRLWLC ORF3a protein 413 213 0 0 252 KNPLLYDANYFLCWH ORF3a protein 427 307 0 0 253 FLGIITTVAAFHQEC ORF8 protein 560 0 0 0 254 FYSKWYIRVGARKSA ORF8 protein 13327 10597 1020 1097 255 YIRVGARKSAPLIEL ORF8 protein 713 590 0 0 256 KVTFFPDLNGDVVAI PLpro 2453 2120 0 253 257 KLLKSIAATRGATVV RdRpol 200 173 0 0 258 LMIERFVSLAIDAYP RdRpol 2113 1650 0 140 259

TABLE-US-00007 31 Best Cross-reactive CD4 Spike SARS-CoV-2 Epitopes peptide sequence Peptide start Peptide end Protein specific name Organism category SEQ ID NO NNATNVVIKVCEFQF 121 135 S SARS-Cov-2 preferred spike epitopes 864 QPTESIVRFPNITNL 321 335 S SARS-Cov-2 preferred spike epitopes 865 VFNATRFASVYAWNR 341 355 S SARS-Cov-2 preferred spike epitopes 866 SVASQSIIAYTMSLG 686 700 S SARS-Cov-2 preferred spike epitopes 867 WTFGAGAALQIPFAM 886 900 S SARS-Cov-2 preferred spike epitopes 868 AQALNTLVKQLSSNF 956 970 S SARS-Cov-2 preferred spike epitopes 869 GAISSVLNDILSRLD 971 985 S SARS-Cov-2 preferred spike epitopes 870 VQIDRLITGRLQSLQ 991 1005 S SARS-Cov-2 preferred spike epitopes 871 LNEVAKNLNESLIDL 1186 1200 S SARS-Cov-2 preferred spike epitopes 872 YEQYIKWPWYIWLGF 1206 1220 S SARS-Cov-2 preferred spike epitopes 873 SLLIVNNATNVVIKV 116 130 S SARS-Cov-2 preferred spike epitopes 260 CEFQFCNDPFLGVYY 131 145 S SARS-Cov-2 preferred spike epitopes 261 CTFEYVSQPFLMDLE 166 180 S SARS-Cov-2 preferred spike epitopes 262 IGINITRFQTLLALH 231 245 S SARS-Cov-2 preferred spike epitopes 263 TRFQTLLALHRSYLT 236 250 S SARS-Cov-2 preferred spike epitopes 264 FTVEKGIYQTSNFRV 306 320 S SARS-Cov-2 preferred spike epitopes 265 SNFRVQPTESIVRFP 316 330 S SARS-Cov-2 preferred spike epitopes 266 IVRFPNITNLCPFGE 326 340 S SARS-Cov-2 preferred spike epitopes 267 CPFGEVFNATRFASV 336 350 S SARS-Cov-2 preferred spike epitopes 268 AYSNNSIAIPTNFTI 706 720 S SARS-Cov-2 preferred spike epitopes 269 NLLLQYGSFCTQLNR 751 765 S SARS-Cov-2 preferred spike epitopes 270 TQLNRALTGIAVEQD 761 775 S SARS-Cov-2 preferred spike epitopes 271 VFAQVKQIYKTPPIK 781 795 S SARS-Cov-2 preferred spike epitopes 272 NFSQILPDPSKPSKR 801 815 S SARS-Cov-2 preferred spike epitopes 273 KPSKRSFIEDLLFNK 811 825 S SARS-Cov-2 preferred spike epitopes 274 SFIEDLLFNKVTLAD 816 830 S SARS-Cov-2 preferred spike epitopes 275 CAQKFNGLTVLPPLL 851 865 S SARS-Cov-2 preferred spike epitopes 276 AQYTSALLAGTITSG 871 885 S SARS-Cov-2 preferred spike epitopes 277 APHGVVFLHVTYVPA 1056 1070 S SARS-Cov-2 preferred spike epitopes 278 ELDKYFKNHTSPDVD 1151 1165 S SARS-Cov-2 preferred spike epitopes 279 GINASVVNIQKEIDR 1171 1185 S SARS-Cov-2 preferred spike epitopes 280

TABLE-US-00008 129 Common Cold Coronavirus Epitopes homologous to C30 subset Peptide ID Sequence Organism SEQ ID NO: 5 NSLFRMPLGVYNYKI OC43 874 10 NHAFWVFSYCRKLGT OC43 875 15 PLLENIDYFNMRRAK OC43 876 25 EYYEFLNKHFSMMIL OC43 877 31 NDVAFVSTFNVLQDV OC43 878 36 KEEAVKRVRAWVGFD OC43 879 42 YQKVFRVYLAYIKKL OC43 880 52 LNKHFSMMILSDDGV OC43 881 61 VPLNAIPSLAANTLN OC43 882 66 MRFYIIIASFIKLFS OC43 883 71 QLKQLEKACNIAKSA OC43 884 83 ISPYNSQNFAAKRVL OC43 885 88 TDHKYVLSVSPYVCN OC43 886 94 KITEWPTATGDVVLA OC43 887 99 QYSFKLVMNGLVFGL OC43 888 115 TDLTVTSAGQPCVAS OC43 889 119 ALIATAHSSIKQGTQ OC43 890 124 LQSAATIRSVAYVAN OC43 891 129 YENKLKAKNESSSLC OC43 892 134 MPFLLDDLVPRAYYL OC43 893 139 NSSILSLCAFSVDPK OC43 894 144 SPCKELEGVGAKVSA OC43 895 149 DLALKLKGLDAMFFY OC43 896 154 KDVYELRYNGAIRFD OC43 897 159 SLFVDYSNLLHSKVK OC43 898 4 NRFFKCTMGVYDFKV NL63 899 9 GHFNEEFYNFLRLRG NL63 900 14 LLSSLTLTVKFVVES NL63 901 19 VLLERYVSLAIDAYP NL63 902 24 DYYGYLRKHFSMMIL NL63 903 30 LHNFSVSHNGVFLGV NL63 904 35 RDFAIRNVRGWLGMD NL63 905 41 LFTNSILMLDKQGQL NL63 906 51 LRKHFSMMILSDDGV NL63 907 60 SDLSTLAVTAIVVVG NL63 908 65 KAINNIVASFSSVND NL63 909 70 LIKQLKRAMNIAKSE NL63 910 75 TQLCQYLNSTTMCVP NL63 911 82 ISPYNSQNYVASRFL NL63 912 93 KDGFFTYLNGVIREK NL63 913 98 VPFDVLCNEFLATFI NL63 914 103 KHLKSIVNTRNATVV NL63 915 108 FIAGNTVHANYIFWR NL63 916 114 GVFVQDPAPIDIDAF NL63 917 123 STILQAAGLCVVCGS NL63 918 128 YVTNEIGLNASVTLK NL63 919 133 MDLLLDDFVTILKSL NL63 920 138 VDISYLNRARGSSAA NL63 921 143 ANGFFYIDVGNHRSA NL63 922 148 IIAVELLLLDFKTAV NL63 923 153 PSVAVRTYSEAAAQG NL63 924 158 LNLSSELKQLEAKTA NL63 925 56 LNKHFSMIILSDDGV MM3-5 926 55 LNKHFNMMILSDDGV MM3-4 927 78 TQLCQYLSTTTLAVP MM3-4 928 47 NVNRFNVAITRARKG MM3-3 929 54 LFFHFSMMILSDDGV MM3-3 930 77 TQLCQYLSTTTIAVP MM3-3 931 110 EIDGSVMHANYLFWR MM3-3 932 20 LLIKRFVSLAIHAYP MM3-2 933 26 EFYEFLNKHFSMMIL MM3-2 934 104 KCLKSIAATRGVSVV MM3-2 935 37 RDEAIRRVRAWVGFD MM3-1 936 46 NVNRFNLAITRAKKG MM3-1 937 53 FNKHFSMMILSDDGV MM3-1 938 76 TQLCQYLNTTTIAVP MM3-1 939 84 ISPYNSQNYVAKRIL MM3-1 940 89 TDHKYVLSVAPYVCN MM3-1 941 109 DIDGNVMHANYLFWR MM3-1 942 3 NSVFRMPMGVYNYKI HKU1 943 8 NHVLWLFSYCRKIGV HKU1 944 13 PSNSIVCRFDTRVLN HKU1 945 18 LLIERFVSLAIDAYP HKU1 946 23 EYYEFLCKHFSMMIL HKU1 947 29 FYGPYRDAQVVQLPV HKU1 948 34 KDEAIKRVRGWVGFD HKU1 949 40 LERVSLWNYGKP1NL HKU1 950 45 NVNRFNVAITRAKKG HKU1 951 50 LCKHFSMMILSDDGV HKU1 952 59 SKLFITKDEAIKRVR HKU1 953 64 LEYPIISNEVSINTS HKU1 954 69 QIKQLEKACNIAKSV HKU1 955 74 TQLCQYLNTTTLAVP HKU1 956 81 ISPYNSONYVAKRVL HKU1 957 87 TNHKYVLSVSPYVCN HKU1 958 92 KVTVWPVATGDVVLA HKU1 959 97 ETFGKPVIWFCHDEA HKU1 960 102 KCLKSIAATRGVPVV HKU1 961 107 EIDGNVMHANYLFWR HKU1 962 113 SRFVMRLQTIATICG HKU1 963 118 VLLTVDGVNFKSISL HKU1 964 122 LALLYRNLKCSYVLN HKU1 965 127 KIEDLSIRNLQKRLY HKU1 966 132 MHWLIRFIVFVANML HKU1 967 137 VDNVYVTYAGSVWHI HKU1 968 142 TRSMTYCRVGACEYA HKU1 969 147 APATGWLLYQLLNGL HKU1 970 152 PGNTFITVEAAIELS HKU1 971 157 WLLPDAAEELASPMK HKU1 972 2 NRFCKCTLGVYDFCV 229E 973 7 KSFSTFESAYMPIAD 229E 974 12 PCPSILKVIDGGKIW 229E 975 17 ILLERYVSLAIDAYP 229E 976 22 DFYGYLQKHFSMMIL 229E 977 28 LHNFSIISGTAFLGV 229E 978 33 RDFAMRHVRGWLGMD 229E 979 39 NDKITEFQLDYSIDV 229E 980 44 NANRFNVAITRAKKG 229E 981 49 LQKHFSMMILSDDSV 229E 982 58 VDHSAFAYESAVVNG 229E 983 63 NLVFNILSMFSSSFS 229E 984 68 IIKQLKKAMNVAKAE 229E 985 73 TQLCQYFNSTTLCVP 229E 986 80 ISPYNSQNYVAARLL 229E 987 86 TDHKFILAITPYVCN 229E 988 91 QEATLPDIAEDVVDQ 229E 989 96 QTLFCNIMKFSDRPF 229E 990 101 KCLKSIVATRNATVV 229E 991 106 FIDGNIIHANYVFWR 229E 992 112 SAVAVVGGTIQILAS 229E 993 117 ALLAFFLSKHSDFGL 229E 994 121 LAKFTKLLLLIYTLY 229E 995 126 VIDNEIIVKPNISLC 229E 996 131 NVHLKDVTKENQEIL 229E 997 136 IKNVNSVRDWLKSLK 229E 998 141 FISVLDITDAAVKAA 229E 999 146 DAGHSLTWLWLLCGL 229E 1000 151 PEGCVLTNTGSVVKP 229E 1001 156 ELLLALLAFFLSKHS 229E 1002

TABLE-US-00009 124 Common Cold Coronavirus Epitopes homologous to C31 subset peptide sequence Organism category SEQ ID NO: ALDKLYKVFGSPVMT 229E common cold corona analogs 1003 APEGLVFLHTVLLPT 229E common cold corona analogs 1004 AWYFLAMLTGLLPSL 229E common cold corona analogs 1005 CAQYYNGIMVLPGVA 229E common cold corona analogs 1006 CVEMHNKINLCDDPE 229E common cold corona analogs 1007 EEIEYVHGDALHTLR 229E common cold corona analogs 1008 ELLQFVTDPTLIVAS 229E common cold corona analogs 1009 ESAYMPIADPTHFDI 229E common cold corona analogs 1010 FAVESGGYIPSDFAF 229E common cold corona analogs 1011 FSFGKVNNFVKFGSV 229E common cold corona analogs 1012 GLNKVKYATVVVGST 229E common cold corona analogs 1013 GNQTLFCNIMKFSDR 229E common cold corona analogs 1014 GNSLNHLTSQLRQNF 229E common cold corona analogs 1015 LLLWESGKAKPPLNR 229E common cold corona analogs 1016 NGSNILEAFTKPVFI 229E common cold corona analogs 1017 NPVSFVVKPVCSSIF 229E common cold corona analogs 1018 QAISSSIQAIYDRLD 229E common cold corona analogs 1019 QPVEGVSSFMNVTLD 229E common cold corona analogs 1020 QQVDRLITGRLAALN 229E common cold corona analogs 1021 RLHNFSIISGTAFLG 229E common cold corona analogs 1022 RVAGRSAIEDILFSK 229E common cold corona analogs 1023 SAIEDILFSKLVTSG 229E common cold corona analogs 1024 SNSNYLLEE FFFDVVFG 229E common cold corona analogs 1025 TGVNDAITQTSQALQ 229E common cold corona analogs 1026 TPFMILLVALSLCLT 229E common cold corona analogs 1027 TTQQAGAGIKYFCGM 229E common cold corona analogs 1028 VETYIKWPWWVWLCI 229E common cold corona analogs 1029 VMLQIQLTGILDGDY 229E common cold corona analogs 1030 VVGGTIQILASVPEK 229E common cold corona analogs 1031 VWHAKDFNSLSAEGR 229E common cold corona analogs 1032 WNGVIKNVNSVRDWL 229E common cold corona analogs 1033 APYGLLFMHFSYKPI HKU1 common cold corona analogs 1034 AQALNSLLQQLFNKF HKU1 common cold corona analogs 1035 AWRFPCAGRKVNFNE HKU1 common cold corona analogs 1036 CGIKYVAQPTEDVVD HKU1 common cold corona analogs 1037 CKFAVCGDGFVPFLL HKU1 common cold corona analogs 1038 CNAQEQQIYFFEGVA HKU1 common cold corona analogs 1039 CVQSFNGIKVLPPIL HKU1 common cold corona analogs 1040 DLLSEYGTFCDNINS HKU1 common cold corona analogs 1041 EDAIIVNDENSSIKV HKU1 common cold corona analogs 1042 ELSHWFKNQTSIAPN HKU1 common cold corona analogs 1043 ESQGNVVTSVMESQI HKU1 common cold corona analogs 1044 FEVEKGVTVDDFVAV HKU1 common cold corona analogs 1045 FKFDEPSDATDFIRV HKU1 common cold corona analogs 1046 FPKGYVMGLFRSYKT HKU1 common cold corona analogs 1047 GAISSSLQEILSRLD HKU1 common cold corona analogs 1048 GSSSRSFFEDLLFDK HKU1 common cold corona analogs 1049 IFKNNTSFPTNIAVE HKU1 common cold corona analogs 1050 IQESIKSLNNSYINL HKU1 common cold corona analogs 1051 KLITTACNGISVTQT HKU1 common cold corona analogs 1052 LIPRSYYLIQSGIFF HKU1 common cold corona analogs 1053 LLCRVTLGDFTIMSG HKU1 common cold corona analogs 1054 MLHGGGVAKAIAVAA HKU1 common cold corona analogs 1055 NFVALIPDYAKILVN HKU1 common cold corona analogs 1056 QPTEDVVDGDVVIRE HKU1 common cold corona analogs 1057 SFFEDLLFDKVKLSD HKU1 common cold corona analogs 1058 SVATFYIEHYVNRLV HKU1 common cold corona analogs 1059 VGGLYEIKIPTNFTI HKU1 common cold corona analogs 1060 VQIDRLINGRLTALN HKU1 common cold corona analogs 1061 WFNTMLDASAPATGW HKU1 common cold corona analogs 1062 YEMYVKWPWYVWLLI HKU1 common cold corona analogs 1063 YSFGRCPTSSIIKHP HKU1 common cold corona analogs 1064 APDGLLFLHTVLLPT NL63 common cold corona analogs 1065 ASGVFGVNLRTNFTI NL63 common cold corona analogs 1066 CAQYYNGIMVLPGVA NL63 common cold corona analogs 1067 CVDLHNKINLCDDPE NL63 common cold corona analogs 1068 DTCFGVSKPNAIDVE NL63 common cold corona analogs 1069 EFRDYFNNNTDSIVI NL63 common cold corona analogs 1070 FDVVFGHGAGSVVFV NL63 common cold corona analogs 1071 FENYIKWPWWVWLII NL63 common cold corona analogs 1072 FSPFNSLLCGDIVSG NL63 common cold corona analogs 1073 GLNASVTLKICKFSR NL63 common cold corona analogs 1074 GSALNHLTSQLRHNF NL63 common cold corona analogs 1075 GTFESAAAGTFVLDM NL63 common cold corona analogs 1076 GVFGVNLRTNFTIKG NL63 common cold corona analogs 1077 LFVVALFIGVSFIDY NL63 common cold corona analogs 1078 NIAFNVVKKGCFTGV NL63 common cold corona analogs 1079 NLLKQYTSACKTIED NL63 common cold corona analogs 1080 NNTDSIVIGGVTYQL NL63 common cold corona analogs 1081 NQLRLAFLGASVTED NL63 common cold corona analogs 1082 QPFSFSFRDELGVRV NL63 common cold corona analogs 1083 QQVDRLITGRLAALN NL63 common cold corona analogs 1084 RIAGRSALEDLLFSK NL63 common cold corona analogs 1085 SALEDLLFSKVVTSG NL63 common cold corona analogs 1086 SAMHSLLFGMLRRLD NL63 common cold corona analogs 1087 SLWRVTAVHSDGMFV NL63 common cold corona analogs 1088 SSATDAIIAVFTLLL NL63 common cold corona analogs 1089 STVVEVKSAIVCASV NL63 common cold corona analogs 1090 TLFKFLLLLYAIYAL NL63 common cold corona analogs 1091 VMNNIVLFLTWLLSM NL63 common cold corona analogs 1092 VTEDVKFAASTGVID NL63 common cold corona analogs 1093 WFCANQSTSVYSANG NL63 common cold corona analogs 1094 YFSQLLCEPIKLVNS NL63 common cold corona analogs 1095 AEALNNLLQQLSNRF OC43 common cold corona analogs 1096 APYGLYFIHFSYVPT OC43 common cold corona analogs 1097 AQIDRLINGRLTALN OC43 common cold corona analogs 1098 CQFKDKNLQDLWVLY OC43 common cold corona analogs 1099 CVQSYKGIKVLPPLL OC43 common cold corona analogs 1100 ELDQWFKNQTSVAPD OC43 common cold corona analogs 1101 ETFTVCADGFMPFLL OC43 common cold corona analogs 1102 GAISASLQEILSRLD OC43 common cold corona analogs 1103 GIFAKVKNTKVIKDR OC43 common cold corona analogs 1104 ICSASDMTNPDYTNL OC43 common cold corona analogs 1105 IFINNTTYPTNVAVE OC43 common cold corona analogs 1106 ISSTVRLQAGTATEY OC43 common cold corona analogs 1107 KASSRSAIEDLLFDK OC43 common cold corona analogs 1108 KRGEKGAYNKDHGRG OC43 common cold corona analogs 1109 LIREIVMNASPYDLE OC43 common cold corona analogs 1110 LLFDVIVAWHVVRDP OC43 common cold corona analogs 1111 LQEAIKVLNQSYINL OC43 common cold corona analogs 1112 LVPQENYSSIRFASV OC43 common cold corona analogs 1113 NIEAWLNDKSVPSPL OC43 common cold corona analogs 1114 NPPTNVVSHVNGDWF OC43 common cold corona analogs 1115 SAIEDLLFDKVKLSD OC43 common cold corona analogs 1116 SLGFYNPPTNVVSHV OC43 common cold corona analogs 1117 SQLVEYGSFCDNINA OC43 common cold corona analogs 1118 SVKSYDSLVYTGVLG OC43 common cold corona analogs 1119 SVVEVVTTSLTPCGY OC43 common cold corona analogs 1120 TIFNCVYALNNVYLG OC43 common cold corona analogs 1121 TILNTACGVFEVDDT OC43 common cold corona analogs 1122 VGGLYEIQIPSEFTI OC43 common cold corona analogs 1123 VKNIPRYASAVAQAF OC43 common cold corona analogs 1124 VSATVLQNNELMPAK OC43 common cold corona analogs 1125 YEYYVKWPWYVWLLI OC43 common cold corona analogs 1126

Vaccine Composition Embodiments

[0195] In certain embodiments described herein, constructs and compositions designed to induce optimal Neutralizing antibody and T cell activity against COVID targets are provided. These constructs and compositions are provided to elicit maximal focused neutralizing antibodies, plus CD4 and CD8 T cells.

Example 1

[0196] In some embodiments, these constructs may encompass, by way of example and not by way of limitation, two components; component A and component B (E.g., SARS-COV-2 mRBD + nsp6).

[0197] Examples of component A are:

[0198] Example A.1: Membrane tethered RBD (mRBD). RBD-linker-spikeTM-dCT (spikeTM = spike transmembrane domain, dCT = deletion of the cytoplasmic tail as described in https://science.sciencemag.org/content/early/2020/05/19/science.abc6284.full). Example construct formula: RBD-short linker-PADRE-short linker-spikeTMdCT (underlined).

[0199] A.1

TABLE-US-00010 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVL YNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDI STEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL HAPATVCGPKKSTNLVKNGGSGGGSGYEQYIKWPWYIWLGFIAGLIAIVM VTIMLCCMTSCCSCLK (SEQ ID NO: 1127)

[0200] Example A.2: Same as above, but with an added PADRE sequence (PADRE stands for synthetic Pan DR epitope, example sequence AKFVAAWTLKAAA (SEQ ID NO: 1128)(bold, as described at least in (www.ncbi.nlm.nih.gov/pmc/articles/PMC46405401) to make sure RBD has T cell help.

[0201] A.2

TABLE-US-00011 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVL YNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDI STEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL HAPATVCGPKKSTNLVKNGGSGGGSGAKFVAAWTLKAAAGGSGGGSGYEO YIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLK (SEQ ID NO:1 129)

[0202] Examples of component B are:

1.B.1.

[0203] N, M, ORF3a, or nsp6, or any combination thereof, either under the control of a second promoter or physically associated via a linker. The linker could have a 2A-protease-type sequence or not, to elicit an enhanced CD4 and CD8 T cell response.

[0204] Designs: the sequences for each protein - protein sequences derived from the SARS-CoV-2 reference (GenBank: MN908947). Example construct sequence to be provided. See protein sequences in “SARS-CoV-2 aa seq” below.

1.B.2

[0205] Same as above but including SARS-CoV-2 proteins modified to contain any of the 4 ‘common cold’ coronavirus sequences homologous to the identified SARS-COV-2 epitopes identified (selected from Table 8 and/or Table 9), from which the corresponding common cold corona virus sequences can be identified (e.g., taking an identified SARS-COV-2 epitope and modifying it to a homolog found in one of the common cold corona strains (229E, HKU1, NL63, OC43) - examples of such SARS-COV-2 peptides appear in Table 6 and Table 7, and their corresponding homologs appear in Table 8 and Table 9. An example is NRYFRLTLGVYDYLV (SEQ ID NO:836) selected from Table 6.

Example 2. SARS-CoV-2 Spike Protein Sequence With Enhanced Activity by Incorporating Common Cold Corona T Cell Epitopes

[0206] In certain embodiments, the SARS-COV-2 spike protein is provided, with incorporated common cold corona epitopes that are cross-reactive with SARS-CoV-2, for example, those amino acid sequences provided in either Table 8 or Table 9. These compositions 1) to maximally recruit memory CD4 T cells to help the antibody responses, and 2) induce CD8 T cell responses.

[0207] Two general classes of constructs:

2.1

[0208] Constructs which include SARS-CoV-2 spike and additional T cell epitopes to the N- and C-termini of S. In the most preferred application 2-5 epitopes will be selected, from Table 6 or Table 8.

[0209] SARS-COV-2 S protein with 3CL epitope conjugated to C-term (SEQ ID NO:1130):

TABLE-US-00012 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI IRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGY FKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLT PGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT NGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG VLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCL IGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASSVASQSIIAYTMSLG AENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECS NLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGF NFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLI CAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQD VVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGR LQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGT HWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKE ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGGSGGSNHNFLVQ AGNVQLRV

2.2.

[0210] Constructs which include SARS-COV-2 spike (Table 7) and additional ‘common cold’ epitope homologs to SARS-COV-2 spike epitopes (selected from Table 9) to recruit memory T cells.

[0211] S protein with OC43 and HKU1 T cell epitope replacement. (SEQ ID NO:1131)

TABLE-US-00013 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI IRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGY FKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLT PGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF VIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPT NGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTG VLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCL IGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASSVASQSIIAYTMSLG AENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSAACK SQLVEYGSFCDNINRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGF NFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLI CAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQD VVNQNAQALNSLLQQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGR LQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGT HWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKE ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQGSGYIPEAPRDGQAYVRKDGEWVLLSTFL

2.3

[0212] Same as either 2.1 or 2.2 but incorporating additional CD4 and CD8 epitopes selected from Table 4 and/or Table 5.

Example 3: SARS-CoV-2 Spike RBD With Enhanced T Cell Epitopes. A Construct Encompassing The Minimal SARS-COV-2 RBD Domain and Additional Cross-Reactive Epitopes Added

[0213] The RBD domain is the dominant target of neutralizing antibodies against SARS-COV-2 and is a relatively unique domain. However, it has limited T cell help.

[0214] As above, disclosed are two general classes of constructs;

3.1

[0215] Constructs with additional T cell epitopes to the N- and C-termini of RBD. (Same as above) Top 2-5 epitopes might be selected, from Table 6 and/or Table 8.

[0216] RBD with N-term ORF3a epitope, C-term 3CL epitope. (SEQ ID NO:1132)

TABLE-US-00014 SDFVRATATIPIQASRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAW NRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIR GDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLY RLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGV GYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNGGSGGGSGNHNFLVOAG NVOLRV

3.2

[0217] Constructs which incorporate ‘common cold’ epitope homologs within the RBD sequence, to recruit memory T cells. (SEQ ID NO:1133)

TABLE-US-00015 RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVL YNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKI ADYNYRIDTTATSCQIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDI STEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELL HAPATVCGPKKSTNLVKN

[0218] It is demonstrated herein that CD4 and CD8 T cell responses are present to many SARS-COV-2 proteins (Cell 2020). Most importantly, it is also shown that epitopes from Table 6 and Table 8 and the spike epitopes set forth in Tables 7 have all been shown to be recognized by human T cells as a pool or in isolation.

3.3

[0219] Same as either 3.1 or 3.2, but incorporating additional CD4 or CD8 epitopes selected from Table 4 and/or Table 5.

Example 4. Constructs Incorporating Spike and Additional CD4 and CD8 Epitopes

4.1.

[0220] Constructs which encompass spike protein or RDB of spike protein from SARS-CoV-2, as described above, and a number of CD4 or CD8 epitopes derived from the remainder of the genome (e.g., those epitopes set forth in Table 4 and/or Table 5). The epitopes are delivered as minigenes, string of beads or other convenient modalities to deliver multiple identified epitopes described in the art.

Example 5

[0221] Further embodiments comprise the prior embodiments (Examples 1-4), but with additional help. In some embodiments, the signal peptide MFVFLVLLPLVSSQ (SEQ ID NO:1134) is added to the C or N terminal end of the construct. In alternative embodiments, pSer (GGSGHHHHHHC) (SEQ ID NO:1135) is added to the C or N terminal end of the construct. In other embodiments, PADRE (AKFVAAWTLKAA) (SEQ ID NO:1136) is added to either or both the N and C terminal ends of any of the above embodiments. In further examples, the construct comprises an RBD trimer by trimerizing RBD with a foldon trimer domain.

[0222] SARS-CoV-2 aa seq:

Membrane (M): 222 AA

[0223] NCBI Reference Sequence: YP_009724393.1 (SEQ ID NO:1137)

TABLE-US-00016 1 MADSNGTITV EELKKLLEQW NLVIGFLFLT WICLLQFAYA NRNRFLYIIK LIFLWLLWPV 61 TLACFVLAAV YRINWITGGI AIAMACLVGL MWLSYFIASF RLFARTRSMW SFNPETNILL 121 NVPLHGTILT RPLLESELVI GAVILRGHLR IAGHHLGRCD IKDLPKEITV ATSRTLSYYK 181 LGASQRVAGD SGFAAYSRYR IGNYKLNTDH SSSSDNIALL VQ

Nucleocapsid (N): 419 AA

[0224] NCBI Reference Sequence: YP_009724397.2 (SEQ ID NO:1138)

TABLE-US-00017 1 MSDNGPQNQR NAPRITFGGP SDSTGSNQNG ERSGARSKQR RPQGLPNNTA SWFTALTQHG 61 KEDLKFPRGQ GVPINTNSSP DDQIGYYRRA TRRIRGGDGK MKDLSPRWYF YYLGTGPEAG 121 LPYGANKDGI IWVATEGALN TPKDHIGTRN PANNAAIVLQ LPQGTTLPKG FYAEGSRGGS 181 QASSRSSSRS RNSSRNSTPG SSRGTSPARM AGNGGDAALA LLLLDRLNQL ESKMSGKGQQ 241 QQGQTVTKKS AAEASKKPRQ KRTATKAYNV TQAFGRRGPE QTQGNFGDQE LIRQGTDYKH 301 WPQIAQFAPS ASAFFGMSRI GMEVTPSGTW LTYTGAIKLD DKDPNFKDQV ILLNKHIDAY 361 KTFPPTEPKK DKKKKADETQ ALPQRQKKQQ TVTLLPAADL DDFSKQLQQS MSSADSTQA

Nsp6: 209 Aa; Processed From ORF1a and ORFlab

[0225] NCBI Reference Sequence: YP_009725302.1 (orf1ab) & NCBI Reference Sequence: YP_009742613.1 (orfla) (SEQ ID NO:1139)

TABLE-US-00018 1 SAVKRTIKGT HHWLLLTILT SLLVLVQSTQ WSLFFFLYEN AFLPFAMGII AMSAFAMMFV 61 KHKHAFLCLF LLPSLATVAY FNMVYMPASW VMRIMTWLDM VDTSLSGFKL KDCVMYASAV 121 VLLILMTART VYDDGARRVW TLMNVLTLVY KVYYGNALDQ AISMWALIIS VTSNYSGVVT 181 TVMFLARGIV FMCVEYCPIF FITGNTLQCI MLVYCFLGYF CTCYFGLFCL LNRYFRLTLG 241 VYDYLVSTQE FRYMNSQGLL PPKNSIDAFK LNIKLLGVGG KPCIKVATVQ

ORF3a: 275 AA

[0226] NCBI Reference Sequence: YP_009724391.1 (SEQ ID NO:1140)

TABLE-US-00019 1 MDLFMRIFTI GTVTLKQGEI KDATPSDFVR ATATIPIQAS LPFGWLIVGV ALLAVFQSAS 61 KIITLKKRWQ LALSKGVHFV CNLLLLFVTV YSHLLLVAAG LEAPFLYLYA LVYFLQSINF 121 VRIIMRLWLC WKCRSKNPLL YDANYFLCWH TNCYDYCIPY NSVTSSIVIT SGDGTTSPIS 181 EHDYQIGGYT EKWESGVKDC VVLHSYFTSD YYQLYSTQLS TDTGVEHVTF FIYNKIVDEP 241 EEHVQIHTID GSSGVVNPVM EPIYDEPTTT TSVPL

Common Cold HCoV Proteins (Amino Acid Sequences)

Membrane (M):

HCoV-229E

[0227] NCBI Reference Sequence: NP_073555.1 (225 aa) (SEQ ID NO:1141)

TABLE-US-00020 1 MSNDNCTGDI VTHLKNWNFG WNVILTIFIV ILQFGHYKYS RLFYGLKMLV LWLLWPLVLA 61 LSIFDTWANW DSNWAFVAFS FFMAVSTLVM WVMYFANSFR LFRRARTFWA WNPEVNAITV 121 TTVLGQTYYQ PIQQAPTGIT VTLLSGVLYV DGHRLASGVQ VHNLPEYMTV AVPSTTIIYS 181 RVGRSVNSQN STGWVFYVRV KHGDFSAVSS PMSNMTENER LLHFF

HCoV-HKU1

[0228] NCBI Reference Sequence: YP_173241.1 (223 aa) (SEQ ID NO:1142)

TABLE-US-00021 1 MNKSFLPQFT SDQAVTFLKE WNFSLGVILL FITIILQFGY TSRSMFVYLI KMIILWLMWP 61 LTITLTIFNC FYALNNAFLA FSIVFTIISI VIWILYFVNS IRLFIRTGSW WSFNPETNNL 121 MCIDMKGKMF VRPVIEDYHT LTATVIRGHL YIQGVKLGTG YTLSDLPVYV TVAKVQVLCT 181 YKRAFLDKLD VNSGFAVFVK SKVGNYRLPS SKPSGMDTAL LRA

HCoV-NL63

[0229] NCBI Reference Sequence: YP_003770.1 (226 aa) (SEQ ID NO:1143)

TABLE-US-00022 1 MSNSSVPLLE VYVHLRNWNF SWNLILTLFI VVLQYGHYKY SRLLYGLKMS VLWCLWPLVL 61 ALSIFDCFVN FNVDWVFFGF SILMSIITLC LWVMYFVNSF RLWRRVKTFW AFNPETNAII 121 SLQVYGHNYY LPVMAAPTGV TLTLLSGVLL VDGHKIATRV QVGQLPKYVI VATPSTTIVC 181 DRVGRSVNET SQTGWAFYVR AKHGDFSGVA SQEGVLSERE KLLHLI

HCoV-OC43

[0230] NCBI Reference Sequence: YP_009555244.1 (230 aa) (SEQ ID NO:1144)

TABLE-US-00023 1 MSSKTTPAPV YIWTADEAIK FLKEWNFSLG IILLFITIIL QFGYTSRSMF VYVIKMIILW 61 LMWPLTIILT IFNCVYALNN VYLGLSIVFT IVAIIMWIVY FVNSIRLFIR TGSFWSFNPE 121 TNNLMCIDMK GTMYVRPIIE DYHTLTVTII RGHLYIQGIK LGTGYSLADL PAYMTVAKVT 181 HLCTYKRGFL DRISDTSGFA VYVKSKVGNY RLPSTQKGSG MDTALLRNNI

Nucleocapsid (N):

HCoV-229E

[0231] NCBI Reference Sequence: NP_073556.1 (389 aa) (SEQ ID NO:1145)

TABLE-US-00024 1 MATVKWADAS EPQRGRQGRI PYSLYSPLLV DSEQPWKVIP RNLVPINKKD KNKLIGYWNV 61 QKRFRTRKGK RVDLSPKLHF YYLGTGPHKD AKFRERVEGV VWVAVDGAKT EPTGYGVRRK 121 NSEPEIPHFN QKLPNGVTVV EEPDSRAPSR SQSRSQSRGR GESKPQSRNP SSDRNHNSQD 181 DIMKAVAAAL KSLGFDKPQE KDKKSAKTGT PKPSRNQSPA SSQTSAKSLA RSQSSETKEQ 241 KHEMQKPRWK RQPNDDVTSN VTQCFGPRDL DHNFGSAGVV ANGVKAKGYP QFAELVPSTA 301 AMLFDSHIVS KESGNTVVLT FTTRVTVPKD HPHLGKFLEE LNAFTREMQQ HPLLNPSALE 361 FNPSQTSPAT AEPVRDEVSI ETDIIDEVN

HCoV-HKU1

[0232] NCBI Reference Sequence: YP_173242.1 (441 aa) (SEQ ID NO:1146)

TABLE-US-00025 1 MSYTPGHYAG SRSSSGNRSG ILKKTSWADQ SERNYQTFNR GRKTQPKFTV STQPQGNTIP 61 HYSWFSGITQ FQKGRDFKFS DGQGVPIAFG VPPSEAKGYW YRHSRRSFKT ADGQQKQLLP 121 RWYFYYLGTG PYANASYGES LEGVFWVANH QADTSTPSDV SSRDPTTQEA IPTRFPPGTI 181 LPQGYYVEGS GRSASNSRPG SRSQSRGPNN RSLSRSNSNF RHSDSIVKPD MADEIANLVL 241 AKLGKDSKPQ QVTKQNAKEI RHKILTKPRQ KRTPNKHCNV QQCFGKRGPS QNFGNAEMLK 301 LGTNDPQFPI LAELAPTPGA FFFGSKLDLV KRDSEADSPV KDVFELHYSG SIRFDSTLPG 361 FETIMKVLEE NLNAYVNSNQ NTDSDSLSSK PQRKRGVKQL PEQFDSLNLS AGTQHISNDF 421 TPEDHSLLAT LDDPYVEDSV A

CoV-NL63

[0233] NCBI Reference Sequence: YP_003771.1 (377 aa) (SEQ ID NO:1147)

TABLE-US-00026 1 MASVNWADDR AARKKFPPPS FYMPLLVSSD KAPYRVIPRN LVPIGKGNKD EQIGYWNVQE 61 RWRMRRGQRV DLPPKVHFYY LGTGPHKDLK FRQRSDGVVW VAKEGAKTVN TSLGNRKRNQ 121 KPLEPKFSIA LPPELSVVEF EDRSNNSSRA SSRSSTRNNS RDSSRSTSRQ QSRTRSDSNQ 181 SSSDLVAAVT LALKNLGFDN QSKSPSSSGT STPKKPNKPL SQPRADKPSQ LKKPRWKRVP 241 TREENVIQCF GPRDFNHNMG DSDLVQNGVD AKGFPQLAEL IPNQAALFFD SEVSTDEVGD 301 NVQITYTYKM LVAKDNKNLP KFIEQISAFT KPSSIKEMQS QSSHVAQNTV LNASIPESKP 361 LADDDSAIIE IVNEVLH

HCoV-OC43

[0234] NCBI Reference Sequence: YP_009555245.1 (448 aa) (SEQ ID NO:1148)

TABLE-US-00027 1 MSFTPGKQSS SRASSGNRSG NGILKWADQS DQFRNVQTRG RRAQPKQTAT SQQPSGGNVV 61 PYYSWFSGIT QFQKGKEFEF VEGQGVPIAP GVPATEAKGY WYRHNRRSFK TADGNQRQLL 121 PRWYFYYLGT GPHAKDQYGT DIDGVYWVAS NQADVNTPAD IVDRDPSSDE AIPTRFPPGT 181 VLPQGYYIEG SGRSAPNSRS TSRTSSRASS AGSRSRANSG NRTPTSGVTP DMADQIASLV 241 LAKLGKDATK PQQVTKHTAK EVRQKILNKP RQKRSPNKQC TVQQCFGKRG PNQNFGGGEM 301 LKLGTSDPQF PILAELAPTA GAFFFGSRLE LAKVQNLSGN PDEPQKDVYE LRYNGAIRFD 361 STLSGFETIM KVLNENLNAY QQQDGMMNMS PKPQRQRGHK NGQGENDNIS VAVPKSRVQQ 421 NKSRELTAED ISLLKKMDEP YTEDTSEI

Non-Structural Protein 6 (nsp6):

HCoV-229E

[0235] NCBI Reference Sequence: NP_073549.1 (6758 aa) polyprotein 1ab (SEQ ID NO:1149)

[0236] UniProt (Predicted Nsp6; 279 AA)

[0237] >sp|P0C6X1|3268-3546

TABLE-US-00028 SGKTTSMFKSISLFAGFFVMFWAELFVYTTTIWVNPGFLTPFMILLVALS LCLTFVVKHKVLFLQVFLLPSIIVAAIQNCAWDYHVTKVLAEKFDYNVSV MQMDIQGFVNIFICLFVALLHTWRFAKERCTHWCTYLFSLIAVLYTALYS YDYVSLLVMLLCAISNEWYIGAIIFRICRFGVAFLPVEYVSYFDGVKTVL LFYMLLGFVSCMYYGLLYWINRFCKCTLGVYDFCVSPAEFKYMVANGLNA PNGPFDALFLSFKLMGIGGPRTIKVSTVQ

HCoV-HKU1

[0238] NCBI Reference Sequence: YP_009742613.1 (287 aa) hydrophobic domain (SEQ ID NO:1150)

TABLE-US-00029 1 SKTKRFIKET IYWILISTFL FSCIISAFVK WTIFMYINTH MIGVTLCVLC FVSFMMLLVK 61 HKHFYLTMYI IPVLCTLFYV NYLVVYKEGF RGFTYVWLSY FVPAVNFTYV YEVFYGCILC 121 VFAIFITMHS INHDIFSLMF LVGRIVTLIS MWYFGSNLEE DVLLFITAFL GTYTWTTILS 181 LAIAKIVANW LSVNIFYFTD VPYIKLILLS YLFIGYILSC YWGFFSLLNS VFRMPMGVYN 241 YKISVQELRY MNANGLRPPRNSFEAILLNL KLLGIGGVPV IEVSQIQ

HCoV-NL63

[0239] NCBI Reference Sequence: YP_003766.2 (6729 aa) polyprotein 1ab (SEQ ID NO:1151)

UniProt (predicted Nsp6; 279 Aa)

[0240] >sp|P0C6X5|3243-3521

TABLE-US-00030 SGKVIFGLKTMFLFSVFFTMFWAELFIYTNTIWINPVILTPIFCLLLFLS LVLTMFLKHKFLFLQVFLLPTVIATALYNCVLDYYIVKFLADHFNYNVSV LQMDVQGLVNVLVCLFVVFLHTWRFSKERFTHWFTYVCSLIAVAYTYFYS GDFLSLLVMFLCAISSDWYIGAIVFRLSRLIVFFSPESVFSVFGDVKLTL VVYLICGYLVCTYWGILYWFNRFFKCTMGVYDFKVSAAEFKYMVANGLHA PHGPFDALWLSFKLLGIGGDRCIKISTVQ

HCoV-OC43

[0241] NCBI Reference Sequence: YP_009555252.1 (110 aa) (SEQ ID NO:1152)

TABLE-US-00031 1 NNELMPAKLK IQVVNSGPDQ TCNTPTQCYY NNSNNGKIVY AILSDVDGLK YTKILKDDGN 61 FVVLELDPPC KFTVQDAKGL KIKYLYFVKG CNTLARGWVV GTISSTVRLQ

ORF3a:

HCoV-229E

[0242] ORF4a* NCBI Reference Sequence: NP_073552.1 (133 aa) (SEQ ID NO:1153)

TABLE-US-00032 1 MALGLFTLQL VSAVNQSLSN AKVSAEVSRQ VIQDVKDGTV TFNLLAYTLM SLFVVYFALF 61 KARSHRGRAA LIVFKILILF VYVPLLYWSQ AYIYATLIAV ILLGRFFHTA WHCWLYKTWD 121 FIVFNVTTLC YAR

HCoV-HKU1

[0243] NCBI Reference Sequence: (aa) NONE

HCoV-NL63

[0244] NCBI Reference Sequence: YP_003768.1 (225 aa) (SEQ ID NO:1154)

TABLE-US-00033 1 MPFGGLFQLT LESTINKSVA NLKLPPHDVT VLRDNLKPVT TLSTITAYLL VSLFVTYFAL 61 FKPLTARGRV ACFVLKLLTL FVYVPLLVLF GMYLDSFIIF STLLFRFIHV GYYAYLYKNF 121 SFVLFNVTKL CFVSGKCWYL EQSFYENRFA AIYGGDHYVV LGGETITFVS FDDLYVAIRG 181 SCEKNLQLMR KVDLYNGAVI YIFAEEPVVG IVYSSQLYED VPSIN

[0245] It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method, kit, reagent, or composition of the invention, and vice versa. Furthermore, compositions of the invention can be used to achieve methods of the invention.

[0246] It will be understood that particular embodiments described herein are shown by way of illustration and not as limitations of the invention. The principal features of this invention can be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of this invention and are covered by the claims.

[0247] All publications and patent applications mentioned in the specification are indicative of the level of skill of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

[0248] The use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.” The use of the term “or” in the claims is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.” Throughout this application, the term “about” is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among the study subjects.

[0249] As used in this specification and claim(s), the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. In embodiments of any of the compositions and methods provided herein, “comprising” may be replaced with “consisting essentially of” or “consisting of”. As used herein, the phrase “consisting essentially of” requires the specified integer(s) or steps as well as those that do not materially affect the character or function of the claimed invention. As used herein, the term “consisting” is used to indicate the presence of the recited integer (e.g., a feature, an element, a characteristic, a property, a method/process step or a limitation) or group of integers (e.g., feature(s), element(s), characteristic(s), propertie(s), method/process steps or limitation(s)) only.

[0250] The term “or combinations thereof” as used herein refers to all permutations and combinations of the listed items preceding the term. For example, “A, B, C, or combinations thereof” is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB. Continuing with this example, expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, AB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth. The skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.

[0251] As used herein, words of approximation such as, without limitation, “about”, “substantial” or “substantially” refers to a condition that when so modified is understood to not necessarily be absolute or perfect but would be considered close enough to those of ordinary skill in the art to warrant designating the condition as being present. The extent to which the description may vary will depend on how great a change can be instituted and still have one of ordinary skilled in the art recognize the modified feature as still having the required characteristics and capabilities of the unmodified feature. In general, but subject to the preceding discussion, a numerical value herein that is modified by a word of approximation such as “about” may vary from the stated value by at least ±1, 2, 3, 4, 5, 6, 7, 10, 12 or 15%.

[0252] Additionally, the section headings herein are provided for consistency with the suggestions under 37 CFR 1.77 or otherwise to provide organizational cues. These headings shall not limit or characterize the invention(s) set out in any claims that may issue from this disclosure. Specifically, and by way of example, although the headings refer to a “Field of Invention,” such claims should not be limited by the language under this heading to describe the so-called technical field. Further, a description of technology in the “Background of the Invention” section is not to be construed as an admission that technology is prior art to any invention(s) in this disclosure. Neither is the “Summary” to be considered a characterization of the invention(s) set forth in issued claims. Furthermore, any reference in this disclosure to “invention” in the singular should not be used to argue that there is only a single point of novelty in this disclosure. Multiple inventions may be set forth according to the limitations of the multiple claims issuing from this disclosure, and such claims accordingly define the invention(s), and their equivalents, that are protected thereby. In all instances, the scope of such claims shall be considered on their own merits in light of this disclosure, but should not be constrained by the headings set forth herein.

[0253] All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.

[0254] To aid the Patent Office, and any readers of any patent issued on this application in interpreting the claims appended hereto, applicants wish to note that they do not intend any of the appended claims to invoke paragraph 6 of 35 U.S.C. § 112, U.S.C. § 112 paragraph (f), or equivalent, as it exists on the date of filing hereof unless the words “means for” or “step for” are explicitly used in the particular claim.

[0255] For each of the claims, each dependent claim can depend both from the independent claim and from each of the prior dependent claims for each and every claim so long as the prior claim provides a proper antecedent basis for a claim term or element.

REFERENCES

[0256] Altmann, D.M., and Boyton, R.J. (2020). SARS-CoV-2 T cell immunity: Specificity, function, durability, and role in protection. Science immunology 5.

[0257] Barra, C., Alvarez, B., Paul, S., Sette, A., Peters, B., Andreatta, M., Buus, S., and Nielsen, M. (2018). Footprints of antigen processing boost MHC class II natural ligand predictions. Genome medicine 10, 84.

[0258] Braun, J., Loyal, L., Frentsch, M., Wendisch, D., Georg, P., Kurth, F., Hippenstiel, S., Dingeldey, M., Kruse, B., Fauchere, F., et al. (2020). SARS-CoV-2-reactive T cells in healthy donors and patients with COVID-19. Nature.

[0259] Bui, H.H., Sidney, J., Dinh, K., Southwood, S., Newman, M.J., and Sette, A. (2006). Predicting population coverage of T-cell epitope-based diagnostics and vaccines. BMC Bioinformatics 7, 153.

[0260] Cai, Y., Zhang, J., Xiao, T., Peng, H., Sterling, S.M., Walsh, R.M., Jr., Rawson, S., Rits-Volloch, S., and Chen, B. (2020). Distinct conformational states of SARS-CoV-2 spike protein. Science 369, 1586-1592.

[0261] Carrasco Pro, S., Sidney, J., Paul, S., Lindestam Arlehamn, C., Weiskopf, D., Peters, B., and Sette, A. (2015). Automatic Generation of Validated Specific Epitope Sets. Journal of immunology research 2015, 763461.

[0262] Cassotta, A., Paparoditis, P., Geiger, R., Mettu, R.R., Landry, S.J., Donati, A., Benevento, M., Foglierini, M., Lewis, D.J.M., Lanzavecchia, A., et al. (2020). Deciphering and predicting CD4+ T cell immunodominance of influenza virus hemagglutinin. J Exp Med 217.

[0263] da Silva Antunes, R., Quiambao, L.G., Sutherland, A., Soldevila, F., Dhanda, S.K., Armstrong, S.K., Brickman, T.J., Merkel, T., Peters, B., and Sette, A. (2020). Development and Validation of a Bordetella pertussis Whole-Genome Screening Strategy. Journal of immunology research 2020, 8202067.

[0264] Dan, J.M., Lindestam Arlehamn, C.S., Weiskopf, D., da Silva Antunes, R., Havenar-Daughton, C., Reiss, S.M., Brigger, M., Bothwell, M., Sette, A., and Crotty, S. (2016). A Cytokine-Independent Approach To Identify Antigen-Specific Human Germinal Center T Follicular Helper Cells and Rare Antigen-Specific CD4+ T Cells in Blood. J Immunol 197, 983-993.

[0265] Dhanda, S.K., Mahajan, S., Paul, S., Yan, Z., Kim, H., Jespersen, M.C., Jurtz, V., Andreatta, M., Greenbaum, J.A., Marcatili, P., et al. (2019). IEDB-AR: immune epitope database-analysis resource in 2019. Nucleic Acids Res 47, W502-W506.

[0266] Dhanda, S.K., Vita, R., Ha, B., Grifoni, A., Peters, B., and Sette, A. (2018). ImmunomeBrowser: a tool to aggregate and visualize complex and heterogeneous epitopes in reference proteins. Bioinformatics 34, 3931-3933.

[0267] Ferretti, A.P., Kula, T., Wang, Y., Nguyen, D.M.V., Weinheimer, A., Dunlap, G.S., Xu, Q., Nabilsi, N., Perullo, C.R., Cristofaro, A.W., et al. (2020). Unbiased Screens Show CD8(+) T Cells of COVID-19 Patients Recognize Shared Epitopes in SARS-CoV-2 that Largely Reside outside the Spike Protein. Immunity.

[0268] Gonzalez-Galarza, F.F., McCabe, A., Santos, E., Jones, J., Takeshita, L., Ortega-Rivera, N.D., Cid-Pavon, G.M.D., Ramsbottom, K., Ghattaoraya, G., Alfirevic, A., et al. (2020). Allele frequency net database (AFND) 2020 update: gold-standard data classification, open access genotype data and new query tools. Nucleic Acids Res 48, D783-D788.

[0269] Goulder, P.J., Phillips, R.E., Colbert, R.A., McAdam, S., Ogg, G., Nowak, M.A., Giangrande, P., Luzzi, G., Morgan, B., Edwards, A., et al. (1997). Late escape from an immunodominant cytotoxic T-lymphocyte response associated with progression to AIDS. Nat Med 3, 212-217.

[0270] Greenbaum, J., Sidney, J., Chung, J., Brander, C., Peters, B., and Sette, A. (2011). Functional classification of class II human leukocyte antigen (HLA) molecules reveals seven different supertypes and a surprising degree of repertoire sharing across supertypes. Immunogenetics 63, 325-335.

[0271] Grifoni, A., Angelo, M.A., Lopez, B., O’Rourke, P.H., Sidney, J., Cerpas, C., Balmaseda, A., Silveira, C.G.T., Maestri, A., Costa, P.R., et al. (2017). Global Assessment of Dengue Virus-Specific CD4+ T Cell Responses in Dengue-Endemic Areas. Front Immunol 8, 1309.

[0272] Grifoni, A., Weiskopf, D., Ramirez, S.I., Mateus, J., Dan, J.M., Moderbacher, C.R., Rawlings, S.A., Sutherland, A., Premkumar, L., Jadi, R.S., et al. (2020). Targets of T Cell Responses to SARS-CoV-2 Coronavirus in Humans with COVID-19 Disease and Unexposed Individuals. Cell.

[0273] Jurtz, V., Paul, S., Andreatta, M., Marcatili, P., Peters, B., and Nielsen, M. (2017). NetMHCpan-4.0: Improved Peptide-MHC Class I Interaction Predictions Integrating Eluted Ligand and Peptide Binding Affinity Data. J Immunol 199, 3360-3368.

[0274] Karosiene, E., Rasmussen, M., Blicher, T., Lund, O., Buus, S., and Nielsen, M. (2013). NetMHCIIpan-3.0, a common pan-specific MHC class II prediction method including all three human MHC class II isotypes, HLA-DR, HLA-DP and HLA-DQ. Immunogenetics 65, 711-724.

[0275] Keller, M.D., Harris, K.M., Jensen-Wachspress, M.A., Kankate, V., Lang, H., Lazarski, C.A., Durkee-Shock, J.R., Lee, P.H., Chaudhry, K., Webber, K., et al. (2020). SARS-CoV-2 specific T-cells Are Rapidly Expanded for Therapeutic Use and Target Conserved Regions of Membrane Protein. Blood.

[0276] Kelley, L.A., and Sternberg, M.J. (2009). Protein structure prediction on the Web: a case study using the Phyre server. Nature protocols 4, 363-371.

[0277] Kim, Y., Yewdell, J.W., Sette, A., and Peters, B. (2013). Positional bias of MHC class I restricted T-cell epitopes in viral antigens is likely due to a bias in conservation. PLoS Comput Biol 9, e1002884.

[0278] Land, H., and Humble, M.S. (2018). YASARA: A Tool to Obtain Structural Guidance in Biocatalytic Investigations. Methods Mol Biol 1685, 43-67.

[0279] Le Bert, N., Tan, A.T., Kunasegaran, K., Tham, C.Y.L., Hafezi, M., Chia, A., Chng, M.H.Y., Lin, M., Tan, N., Linster, M., et al. (2020). SARS-CoV-2-specific T cell immunity in cases of COVID-19 and SARS, and uninfected controls. Nature.

[0280] Lindestam Arlehamn, C.S., Gerasimova, A., Mele, F., Henderson, R., Swann, J., Greenbaum, J.A., Kim, Y., Sidney, J., James, E.A., Taplitz, R., et al. (2013). Memory T cells in latent Mycobacterium tuberculosis infection are directed against three antigenic islands and largely contained in a CXCR3+CCR6+ Th1 subset. PLoS Pathog 9, e1003130.

[0281] Lindestam Arlehamn, C.S., McKinney, D.M., Carpenter, C., Paul, S., Rozot, V., Makgotlho, E., Gregg, Y., van Rooyen, M., Ernst, J.D., Hatherill, M., et al. (2016). A Quantitative Analysis of Complexity of Human Pathogen-Specific CD4 T Cell Responses in Healthy M. tuberculosis Infected South Africans. PLoS Pathog 12, e1005760.

[0282] Mateus, J., Grifoni, A., Tarke, A., Sidney, J., Ramirez, S.I., Dan, J.M., Burger, Z.C., Rawlings, S.A., Smith, D.M., Phillips, E., et al. (2020). Selective and cross-reactive SARS-CoV-2 T cell epitopes in unexposed humans. Science 370, 89-94.

[0283] Meckiff, B.J., Ramirez-Suastegui, C., Fajardo, V., Chee, S.J., Kusnadi, A., Simon, H., Eschweiler, S., Grifoni, A., Pelosi, E., Weiskopf, D., et al. (2020). Imbalance of Regulatory and Cytotoxic SARS-CoV-2-Reactive CD4(+) T Cells in COVID-19. Cell.

[0284] Nelde, A., Bilich, T., Heitmann, J.S., Maringer, Y., Salih, H.R., Roerden, M., Lubke, M., Bauer, J., Rieth, J., Wacker, M., et al. (2020). SARS-CoV-2-derived peptides define heterologous and COVID-19-induced T cell recognition. Nat Immunol.

[0285] Oseroff, C., Sidney, J., Kotturi, M.F., Kolla, R., Alam, R., Broide, D.H., Wasserman, S.I., Weiskopf, D., McKinney, D.M., Chung, J.L., et al. (2010). Molecular determinants of T cell epitope recognition to the common Timothy grass allergen. J Immunol 185, 943-955.

[0286] Paul, S., Grifoni, A., Peters, B., and Sette, A. (2019). Major Histocompatibility Complex Binding, Eluted Ligands, and Immunogenicity: Benchmark Testing and Predictions. Frontiers in immunology 10, 3151.

[0287] Paul, S., Karosiene, E., Dhanda, S.K., Jurtz, V., Edwards, L., Nielsen, M., Sette, A., and Peters, B. (2018). Determination of a Predictive Cleavage Motif for Eluted Major Histocompatibility Complex Class II Ligands. Front Immunol 9, 1795.

[0288] Paul, S., Weiskopf, D., Angelo, M.A., Sidney, J., Peters, B., and Sette, A. (2013). HLA class I alleles are associated with peptide-binding repertoires of different size, affinity, and immunogenicity. J Immunol 191, 5831-5839.

[0289] Peng, Y., Mentzer, A.J., Liu, G., Yao, X., Yin, Z., Dong, D., Dejnirattisai, W., Rostron, T., Supasa, P., Liu, C., et al. (2020). Broad and strong memory CD4(+) and CD8(+) T cells induced by SARS-CoV-2 in UK convalescent individuals following COVID-19. Nat Immunol 21, 1336-1345.

[0290] Peters, B., Nielsen, M., and Sette, A. (2020). T Cell Epitope Predictions. Annu Rev Immunol 38, 123-145.

[0291] Reiss, S., Baxter, A.E., Cirelli, K.M., Dan, J.M., Morou, A., Daigneault, A., Brassard, N., Silvestri, G., Routy, J.P., Havenar-Daughton, C., et al. (2017). Comparative analysis of activation induced marker (AIM) assays for sensitive identification of antigen-specific CD4 T cells. PLoS One 12, e0186998.

[0292] Rydyznski Moderbacher, C., Ramirez, S.I., Dan, J.M., Grifoni, A., Hastie, K.M., Weiskopf, D., Belanger, S., Abbott, R.K., Kim, C., Choi, J., et al. (2020). Antigen-Specific Adaptive Immunity to SARS-CoV-2 in Acute COVID-19 and Associations with Age and Disease Severity. Cell.

[0293] Schub, D., Klemis, V., Schneitler, S., Mihm, J., Lepper, P.M., Wilkens, H., Bals, R., Eichler, H., Gartner, B.C., Becker, S.L., et al. (2020). High levels of SARS-CoV-2-specific T cells with restricted functionality in severe courses of COVID-19. JCI insight 5.

[0294] Sekine, T., Perez-Potti, A., Rivera-Ballesteros, O., Stralin, K., Gorin, J.B., Olsson, A., Llewellyn-Lacey, S., Kamal, H., Bogdanovic, G., Muschiol, S., et al. (2020). Robust T Cell Immunity in Convalescent Individuals with Asymptomatic or Mild COVID-19. Cell 183, 158-168 e114.

[0295] Sette, A., Moutaftsi, M., Moyron-Quiroz, J., McCausland, M.M., Davies, D.H., Johnston, R.J., Peters, B., Rafii-El-Idrissi Benhnia, M., Hoffmann, J., Su, H.P., et al. (2008). Selective CD4+ T cell help for antibody responses to a large viral pathogen: deterministic linkage of specificities. Immunity 28, 847-858.

[0296] Shrock, E., Fujimura, E., Kula, T., Timms, R.T., Lee, I.H., Leng, Y., Robinson, M.L., Sie, B.M., Li, M.Z., Chen, Y., et al. (2020). Viral epitope profiling of COVID-19 patients reveals cross-reactivity and correlates of severity. Science.

[0297] Sidney, J., Southwood, S., Moore, C., Oseroff, C., Pinilla, C., Grey, H.M., and Sette, A. (2013). Measurement of MHC/peptide interactions by gel filtration or monoclonal antibody capture. Curr Protoc Immunol Chapter 18, Unit 18 13.

[0298] Snyder, T.M., Gittelman, R.M., Klinger, M., May, D.H., Osborne, E.J., Taniguchi, R., Zahid, H.J., Kaplan, I.M., Dines, J.N., Noakes, M.N., et al. (2020). Magnitude and Dynamics of the T-Cell Response to SARS-CoV-2 Infection at Both Individual and Population Levels. medRxiv.

[0299] Southwood, S., Sidney, J., Kondo, A., del Guercio, M.F., Appella, E., Hoffman, S., Kubo, R.T., Chesnut, R.W., Grey, H.M., and Sette, A. (1998). Several common HLA-DR types share largely overlapping peptide binding repertoires. J Immunol 160, 3363-3373.

[0300] Stadlbauer, D., Amanat, F., Chromikova, V., Jiang, K., Strohmeier, S., Arunkumar, G.A., Tan, J., Bhavsar, D., Capuano, C., Kirkpatrick, E., et al. (2020). SARS-CoV-2 Seroconversion in Humans: A Detailed Protocol for a Serological Assay, Antigen Production, and Test Setup. Curr Protoc Microbiol 57, e100.

[0301] Weiskopf, D., Angelo, M.A., de Azeredo, E.L., Sidney, J., Greenbaum, J.A., Fernando, A.N., Broadwater, A., Kolla, R.V., De Silva, A.D., de Silva, A.M., et al. (2013). Comprehensive analysis of dengue virus-specific responses supports an HLA-linked protective role for CD8+ T cells. Proc Natl Acad Sci U S A 110, E2046-2053.

[0302] Weiskopf, D., Cerpas, C., Angelo, M.A., Bangs, D.J., Sidney, J., Paul, S., Peters, B., Sanches, F.P., Silvera, C.G., Costa, P.R., et al. (2015). Human CD8+ T-Cell Responses Against the 4 Dengue Virus Serotypes Are Associated With Distinct Patterns of Protein Targets. J Infect Dis 212, 1743-1751.

[0303] Weiskopf, D., Schmitz, K.S., Raadsen, M.P., Grifoni, A., Okba, N.M.A., Endeman, H., van den Akker, J.P.C., Molenkamp, R., Koopmans, M.P.G., van Gorp, E.C.M., et al. (2020). Phenotype and kinetics of SARS-CoV-2-specific T cells in COVID-19 patients with acute respiratory distress syndrome. Science immunology 5.

[0304] Xie, X., Muruato, A., Lokugamage, K.G., Narayanan, K., Zhang, X., Zou, J., Liu, J., Schindewolf, C., Bopp, N.E., Aguilar, P.V., et al. (2020). An Infectious cDNA Clone of SARS-CoV-2. Cell host & microbe 27, 841-848 e843.

[0305] Zeng, W., Liu, G., Ma, H., Zhao, D., Yang, Y., Liu, M., Mohammed, A., Zhao, C., Yang, Y., Xie, J., et al. (2020). Biochemical characterization of SARS-CoV-2 nucleocapsid protein. Biochem Biophys Res Commun 527, 618-623.