MUC16 monoclonal antibody and uses thereof

Abstract

The present document describes an antibody or an antigen-binding fragment that bind to O-glycan mucin-type glycoprotein MUC16 comprising three variable heavy domain complementarity determining regions (CDR)(CDR H1, H2 and H3), and three variable lighy domain CDR (CDR L1, L2 and L3). The present invention also relates to pharmaceutical compositions, nucleic acid vectors, cells comprising the nucleic acid vectors, and methods of inhibiting tumor growth of a tumor expressing O-glycan mucin-type glycoprotein MUC16.

Claims

1. An antibody or an antigen-binding fragment thereof that binds to O-glycan mucin-type glycoprotein MUC16, comprising three variable heavy domain complementarity determining regions (CDR) (CDR H1, H2, and H3), and three variable light domain CDR (CDR L1, L2, and L3), wherein the CDR H1, H2, H3, L1, L2, and L3 comprise the amino acid sequence: TABLE-US-00022 CDR H1: (SEQ ID NO: 1) GFTFSTF, CDR H2: (SEQ ID NO: 2) SSGSST, CDR H3: (SEQ ID NO: 3) SGYDYDPIYYALDY, CDR L1: (SEQ ID NO: 4) RASESVDNYGISFMN, CDR L2: (SEQ ID NO: 5) GASNQGS, and CDR L3: (SEQ ID NO: 6) QQTKEVPWT.

2. The antibody or the antigen binding fragment thereof of claim 1, further comprising four variable heavy domain framework regions (HFR)(HFR 1, 2, 3, and 4), wherein the HFR 1, 2, 3, and 4 comprise the amino acid sequence: TABLE-US-00023 HFR 1: (SEQ ID NO: 7) EVQLVESGGGLVQPGGSRKLSCAAS, HFR 2: (SEQ ID NO: 8) GMHWVRQAPEKGLEWVAYI, HFR 3: (SEQ ID NO: 9) IYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMYYCAR, and HFR 4: (SEQ ID NO: 10) WGQGTSVTVSS.

3. The antibody or the antigen binding fragment thereof of claim 1, further comprising four variable light domain framework regions (LFR) (LFR 1, 2, 3, and 4), wherein the LFR 1, 2, 3, and 4 comprise the amino acid sequence: TABLE-US-00024 LFR 1: (SEQ ID NO: 11) DIVLTQSPASLAVSLGQRATISC, LFR 2: (SEQ ID NO: 12) WFQQKPGHPPKLLIY, LFR 3: (SEQ ID NO: 13) GVPARFSGSGSGTDFSLNIHPMEEDDAAMYFC, and LFR 4: (SEQ ID NO: 14) FGGGTKVEIKR.

4. The antibody or the antigen binding fragment thereof of claim 1, comprising a variable heavy domain (VH) comprising the amino acid sequence: TABLE-US-00025 (SEQ ID NO: 15) EVQLVESGGGLVQPGGSRKLSCAASGFTFSTFGMHWVRQAPEKGLEWVAY ISSGSSTIYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMYYCARSG YDYDPIYYALDYWGQGTSVTVSS.

5. The antibody or the antigen binding fragment thereof of claim 1, comprising a variable light domain (VL) comprising the amino acid sequence: TABLE-US-00026 (SEQ ID NO: 16) DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGHPPKL LIYGASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDAAMYFCQQTKEVPW TFGGGTKVEIKR.

6. The antibody or the antigen binding fragment thereof of claim 1, comprising a variable heavy domain (VH) comprising the amino acid sequence: TABLE-US-00027 (SEQ ID NO: 15) EVQLVESGGGLVQPGGSRKLSCAASGFTFSTFGMHWVRQAPEKGLEWVAY ISSGSSTIYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMYYCARSG YDYDPIYYALDYWGQGTSVTVSS, and a variable light domain (VL) comprising the amino acid sequence: TABLE-US-00028 (SEQ ID NO: 16) DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGHPPKL LIYGASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDAAMYFCQQTKEVPW TFGGGTKVEIKR.

7. The antibody or the antigen binding fragment thereof of claim 1, wherein the antibody is an IgA, IgD, IgE, IgG, or IgM.

8. The antibody or the antigen binding fragment thereof of claim 1, wherein the antigen-binding fragment is a single domain antibody (sdAb) or a single-chain variable fragment (scFv).

9. The antibody or the antigen binding fragment thereof of claim 1, wherein the antibody or the antigen-binding fragment thereof is humanized or partially humanized.

10. The antibody or the antigen binding fragment thereof of claim 1, wherein the antibody is POCmAb.

11. A composition, comprising the antibody or the antigen binding fragment thereof of claim 1 and a pharmaceutically acceptable diluent, carrier, or excipient.

12. A method of inhibiting tumor growth of a tumor expressing O-glycan mucin-type glycoprotein MUC16 in a subject in need thereof, comprising administering to the subject the antibody or the antigen binding fragment thereof that targets O-glycan mucin-type glycoprotein MUC16 of claim 1.

13. The method of claim 12, wherein the antibody or the antigen binding fragment thereof is an antibody.

14. The method of claim 13, wherein the antibody is a monoclonal antibody.

15. The method of claim 12, further comprising administering a second therapeutic agent comprising at least one of a cytotoxic agent, an additional antibody or a therapeutically active fragment thereof, or a chemotherapy regimen.

16. The method of claims 15, wherein the cytotoxic agent is at least one of an inhibitor of ErbB signaling, an inhibitor of phosphoinositide 3-kinases (PI3Ks)/Akt signaling, gemcitabine and abraxane or combinations thereof; wherein the additional antibody or therapeutically fragment thereof is oregovomab antibody B43.13, AR9.6 antibody, or combinations thereof; and wherein the chemotherapy regimen is Folfirinox.

17. The method of claim 12, wherein the tumor is chosen from a pancreatic tumor, a gall bladder tumor, a gastric tumor, a colon tumor, an ovarian tumor, a breast tumor, and a liver tumor.

18. The method of claim 12, wherein the method is for the treatment of a cancer.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) Further features and advantages of the present disclosure will become apparent from the following detailed description, taken in combination with the appended drawings, in which:

(2) FIG. 1 illustrates O-glycan mucin-type glycoprotein MUC16 and the region of this protein from which the antigen of interest was derived from.

(3) FIG. 2A illustrates the binding specificity of humanized (POCmAb) anti-MUC16 antibody against different pancreatic cancer cells.

(4) FIG. 2B illustrates the binding specificity of murine (mAR9.6) anti-MUC16 antibody against different pancreatic cancer cells.

(5) FIG. 3A illustrates the binding specificity of humanized (POCmAb) antibody to pancreatic cancer cells treated with sialidase, O-glycanase and N-glycanase glycosidases.

(6) FIG. 3B illustrates the binding specificity of murine (mAR9.6) antibodies to pancreatic cancer cells treated with sialidase, O-glycanase and N-glycanase glycosidases.

(7) FIG. 4 illustrates the binding specificity of humanized (POCmAb) or murine (mAR9.6) antibodies to MUC16 TR1.2 purified from WT CHO cells treated with sialidase, O-glycanase and N-glycanase glycosidases.

(8) FIG. 5A illustrates the binding specificity of humanized (POCmAb) antibody to pancreatic cancer patients ascites fluid samples.

(9) FIG. 5B illustrates the binding specificity of murine (mAR9.6) antibodies to pancreatic cancer patients ascites fluid samples.

(10) FIG. 6 illustrates the results of the treatment of T3M4 WT and SC cells with a control IgG antibody, mAR9.6 monoclonal antibody, and the POCmAb monoclonal antibody of the present invention. The left column represents merged images of the live and dead cells, the center column the live cells and the right column the dead cells.

(11) FIG. 7 illustrates the quantification of cell death pursuant to the treatment described in FIG. 6.

(12) FIG. 8 illustrates the results of the treatment of T3M4 WT cells with either 1) a control IgG antibody; 2) mAR9.6 monoclonal antibody; 3) Sapitinib with either control IgG or mAR9.6; 4) LY294002 with either control IgG or mAR9.6; and 5) a combination of Sapitinib and LY294002 with either control IgG or mAR9.6. The left column represents merged images of the live and dead cells, the center column the live cells and the right column the dead cells.

(13) FIG. 9 illustrates quantification of cell death pursuant to each the treatment conditions described in FIG. 8.

(14) FIG. 10 illustrates the results of the treatment of T3M4 WT cells with either 1) a control IgG antibody; 2) POCmAb monoclonal antibody; 3) Sapitinib with either control IgG or POCmAb; 4) LY294002 with either control IgG or POCmAb; and 5) a combination of Sapitinib and LY294002 with either control IgG or POCmAb. The left column represents merged images of the live and dead cells, the center column the live cells and the right column the dead cells.

(15) FIG. 11 illustrates the quantification of cell death pursuant to each the treatment conditions described in FIG. 10.

(16) FIG. 12 illustrates the normalized fold-change based on the results presented in FIGS. 8 to 11, that show that the POCmAb antibody was found to be unexpectedly and surprisingly more effective than the mAR9.6 antibody in inducing cell death in PDAC cells.

DETAILED DESCRIPTION

(17) The present invention is directed to alternative antibodies or antigen-binding fragments thereof that bind binds to O-glycan mucin-type glycoprotein MUC16, for use as therapeutics or for diagnostic imaging.

(18) In a first embodiments there is disclosed an antibody or an antigen-binding fragment thereof that binds to O-glycan mucin-type glycoprotein MUC16. The antibody or an antigen-binding fragment thereof comprises three variable heavy domain complementarity determining regions (CDR)(CDR H1, H2 and H3), and three variable light domain CDR (CDR L1, L2 and L3). These CDR H1, H2, H3, L1, L2, and L3 comprise an amino acid sequence comprising CDR H1: GFTFSTF (SEQ ID NO:1), CDR H2: SSGSST (SEQ ID NO:2), CDR H3: SGYDYDPIYYALDY (SEQ ID NO:3), CDR L1: RASESVDNYGISFMN (SEQ ID NO:4), CDR L2: GASNQGS (SEQ ID NO:5), and CDR L3: QQTKEVPWT (SEQ ID NO:6), respectively.

(19) According to a second embodiment, there is disclosed an antibody or an antigen-binding fragment thereof that binds to O-glycan mucin-type glycoprotein MUC16, which comprises three variable heavy domain complementarity determining regions (CDR)(CDR H1, H2 and H3) which comprise an amino acid sequence comprising: CDR H1: GFTFSTF (SEQ ID NO:1), CDR H2: SSGSST (SEQ ID NO:2), and CDR H3: SGYDYDPIYYALDY (SEQ ID NO:3), respectively.

(20) According to a third embodiment, there is disclosed an antibody or an antigen-binding fragment thereof that binds to O-glycan mucin-type glycoprotein MUC16 comprising three variable light domain complementarity determining regions (CDR)(CDR L1, L2 and L3) which comprise an amino acid sequence comprising: CDR L1: RASESVDNYGISFMN (SEQ ID NO:4), CDR L2: GASNQGS (SEQ ID NO:5), and CDR L3: QQTKEVPWT (SEQ ID NO:6), respectively.

(21) In embodiments, the antibody or antigen binding fragment thereof of the present invention may further comprise four variable heavy domain framework regions (HFR)(HFR 1, 2, 3 and 4), which comprise an amino acid sequence comprising:

(22) TABLE-US-00010 HFR 1: (SEQ ID NO: 7) EVQLVESGGGLVQPGGSRKLSCAAS, HFR 2: (SEQ ID NO: 8) GMHWVRQAPEKGLEWVAYI, HFR 3: (SEQ ID NO: 9) IYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMYYCAR, and HFR 4: (SEQ ID NO: 10) WGQGTSVTVSS.

(23) In other embodiments, the antibody or antigen binding fragment thereof of the present invention may further comprise four variable light domain framework regions (LFR)(LFR 1, 2, 3 and 4) which comprise an amino acid sequence comprising:

(24) TABLE-US-00011 LFR 1: (SEQ ID NO: 11) DIVLTQSPASLAVSLGQRATISC, LFR 2: (SEQ ID NO: 12) WFQQKPGHPPKLLIY, LFR 3: (SEQ ID NO: 13) GVPARFSGSGSGTDFSLNIHPMEEDDAAMYFC, and LFR 4: (SEQ ID NO: 14) FGGGTKVEIKR.

(25) According to an embodiment, the antibody or antigen binding fragment thereof of the present invention may comprise a variable heavy domain (V.sub.H) comprising amino acid sequence comprising:

(26) TABLE-US-00012 (SEQ ID NO  15) EVQLVESGGGLVQPGGSRKLSCAASGFTFSTFGMHWVRQAPEKGLEW VAYISSGSSTIYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMY YCARSGYDYDPIYYALDYWGQGTSVTVSS.

(27) According to an embodiment, the antibody or antigen binding fragment thereof of the present invention may comprise a variable light domain (V.sub.L) comprising amino acid sequence comprising:

(28) TABLE-US-00013 (SEQ ID NO: 16) DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGHP PKLLIYGASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDAAMYFCQQ TKEVPWTFGGGTKVEIKR.

(29) According to another embodiment, the antibody or antigen binding fragment thereof of the present invention may comprise a variable heavy domain (V.sub.H) comprising amino acid sequence comprising:

(30) TABLE-US-00014 (SEQ ID NO: 15) EVQLVESGGGLVQPGGSRKLSCAASGFTFSTFGMHWVRQAPEKGLEWVAY ISSGSSTIYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMYYCARSG YDYDPIYYALDYWGQGTSVTVSS,
and a variable light domain (V.sub.L) comprising amino acid sequence comprising:

(31) TABLE-US-00015 (SEQ ID NO: 16) DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKPGHPPKL LIYGASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDAAMYFCQQTKEVPW TFGGGTKVEIKR.

(32) According to other embodiments, the antibody or an antigen-binding fragment of the present invention may have sequences substantially identical to the sequences disclosed above, operable to bind to O-glycan mucin-type glycoprotein MUC16. A substantially identical sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutation to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, physico-chemical or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered “substantially identical” polypeptides. A conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity). According to one embodiment, these conservative amino acid mutations may be made to the framework regions of the antibody or an antigen-binding fragment while maintaining the CDR sequences listed above and the overall structure of the CDR of the antibody or fragment; thus the specificity and binding of the antibody are maintained. According to another embodiment, these conservative amino acid mutations may be made to the framework regions of the antibody or an antigen-binding fragment and the CDR sequence listed above while maintaining the antigen-binding function of the overall structure of the CDR of the antibody or fragment; thus the specificity and binding of the antibody are maintained.

(33) In a non-limiting example, a conservative mutation may be an amino acid substitution. Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group. By the term “basic amino acid” it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH. Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K). By the term “neutral amino acid” (also “polar amino acid”), it is meant hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms. Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gln or Q). The term “hydrophobic amino acid” (also “non-polar amino acid”) is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (Iie or 1), phenylalanine (Phe or F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G). “Acidic amino acid” refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).

(34) Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2 service maintained by the Swiss Institute of Bioinformatics (and as found at ca.expasy.org/tools/blast/), BLAST-P, Blast-N, or FASTA-N, or any other appropriate software that is known in the art.

(35) The substantially identical sequences of the present invention may be at least 90% identical; in another example, the substantially identical sequences may be at least 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical, or any percentage therebetween, at the amino acid level to sequences described herein. Importantly, the substantially identical sequences retain the activity and specificity of the reference sequence. In a non-limiting embodiment, the difference in sequence identity may be due to conservative amino acid mutation(s). In a non-limiting example, the present invention may be directed to an antibody or antigen-binding fragment comprising a sequence at least 95%, 96%, 97%, 98%, or 99% identical to that of the antibodies described herein.

(36) According to embodiment, the antibody or antigen-binding fragment thereof of the present invention may be an IgA, IgD, IgE, IgG, or IgM.

(37) In yet another embodiment, the antibody or antigen-binding fragment thereof of the present invention may be a single-domain antibody (sdAb), or a single-chain variable fragment (scFv). According to an example, the sdAb may comprise three CDR (CDR1, 2 and 3) comprising SEQ ID NO:1, SEQ ID NO:2, and SEQ ID NO:3, respectively. In yet another example, the sdAb may comprise three CDR (CDR1, 2 and 3) comprising SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, respectively.

(38) According to an embodiment, the antibody or antigen-binding fragment thereof may be humanized or partially humanized.

(39) According to an embodiment, the antibody or antigen-binding fragment thereof may be antibody POCmAb.

(40) In another embodiment there is disclosed a composition comprising the antibody or antigen-binding fragment thereof of the present invention, and a pharmaceutically acceptable diluent, carrier or excipient. The composition may comprise a single antibody or antigen-binding fragment thereof of the present invention as described above, or may be a mixture of antibody or antigen-binding fragment thereof of the present invention. Furthermore, in a composition comprising a mixture of antibody or antigen-binding fragment thereof of the present invention, the antibody or antigen-binding fragment thereof may have the same specificity, or may differ in their specificities; for example, and without wishing to be limiting in any manner, the composition may comprise antibody or antigen-binding fragment thereof of the present invention specific to MUC16 (same or different epitope).

(41) The composition may also comprise a pharmaceutically acceptable diluent, excipient, or carrier. The diluent, excipient, or carrier may be any suitable diluent, excipient, or carrier known in the art, and must be compatible with other ingredients in the composition, with the method of delivery of the composition, and is not deleterious to the recipient of the composition. The composition may be in any suitable form; for example, the composition may be provided in suspension form, powder form (for example, but limited to lyophilised or encapsulated), capsule or tablet form. For example, and without wishing to be limiting, when the composition is provided in suspension form, the carrier may comprise water, saline, a suitable buffer, or additives to improve solubility and/or stability; reconstitution to produce the suspension is effected in a buffer at a suitable pH to ensure the viability of the antibody or antigen-binding fragment. Dry powders may also include additives to improve stability and/or carriers to increase bulk/volume; for example, and without wishing to be limiting, the dry powder composition may comprise sucrose or trehalose. In a specific, non-limiting example, the composition may be so formulated as to deliver the antibody or antigen-binding fragment to the gastrointestinal tract of the subject. Thus, the composition may comprise encapsulation, time release, or other suitable technologies for delivery of the antibody or antigen-binding fragment thereof of the present invention. It would be within the competency of a person of skill in the art to prepare suitable compositions comprising the antibody or antigen-binding fragment thereof.

(42) In another embodiment, there is disclosed a method of inhibiting tumor growth of a tumor expressing O-glycan mucin-type glycoprotein MUC16 in a subject in need thereof, comprising administering to the subject an antibody or an antigen binding fragment thereof that targets O-glycan mucin-type glycoprotein MUC16, according to the present invention.

(43) In an embodiment, the antibody or an antigen binding fragment thereof of the present invention is an antibody, in order for the constant domain of the antibody to be present and interact with effector cells of the immune system in order to carry out an appropriate immune response. Without wishing to be bound by theory, the Applicant believes that such interaction may be necessary for carrying out the method of the present invention. In a specific embodiment of the present invention, the antibody is a monoclonal antibody.

(44) According to an embodiment, the O-glycan mucin-type glycoprotein MUC16 that is targeted by the antibody or an antigen binding fragment thereof comprises a truncated O-glycan, for example a truncated O-glycan that comprises a Tn antigen, a sialyl Tn antigen (STn), or a combination thereof. According to some embodiments, the antibody or an antigen binding fragment thereof of the present invention binds to a conformational epitope of tandem repeat (TR) SEA domain 5 and 6 without glycosylation of the O-glycan mucin-type glycoprotein MUC16. According to such embodiments of the present invention, targeting truncated mucin-type glycoproteins is believed to inhibit their role in tumorigenicity and tumor progression.

(45) In embodiments, a therapeutic effective amount of the antibody or an antigen binding fragment thereof of the present invention may be used to target truncated O-glycans on the MUC16 glycoprotein, thereby inhibiting the phosphatidylinositol 3-kinase/Akt (PI3K/Akt) signaling pathway.

(46) The present method teaches, amongst other things, that cancer specific truncation of O-glycans on the MUC16 glycoprotein (also known as CA125) creates a ligand for Her2/Neu (also known as ErbB2) receptors, which results in an oncogenic signaling cascade through Akt that increases the oncogenic potential of cancer cells. This method provides that in addition to serving as a biomarker for carcinomas, aberrant glycoforms of MUC16 can serve as a form of oncogenic cytokine.

(47) MUC16 is a membrane bound, heavily glycosylated, cell surface glycoprotein that is expressed in normal epithelium of endometrium, trachea and cornea. The expression of MUC16 is also often upregulated in malignant tumors that also produce circulating soluble forms of MUC16. It is known that aberrant expression of membrane mucin MUC16 is associated with tumorigenicity and metastasis of cancers, such as pancreatic cancer. Further, MUC16 is not detected in pancreatic intraepithelial neoplasia (PanIN) and increased in primary tumors and metastatic lesions, suggesting that expression of this mucin is a later event in disease progression. Aberrant expression of MUC16 in ovarian cancer cells facilitates peritoneal metastasis through interactions with mesothelin (a tumor differentiation factor) and through immunosuppressive functions by blocking natural killer cell-mediated cytotoxicity. A recent study also showed that overexpression MUC16 increases breast cancer cell proliferation via stimulation of Janus Kinase 2 (JAK2). These reports strongly suggest that MUC16 plays a major role in tumor progression and metastasis through interaction with oncogenic modulators. Therefore, research suggests that MUC16 plays a major role in cancer through interaction with oncogenic modulators, however little has been done to study oligosaccharide (O-linked glycosylation) modification on mucin-type glycoproteins such as MUC16, particularly as a potential cancer therapy.

(48) According to another embodiment, the method of the present invention may further comprise administering a second therapeutic agent comprising at least one of a cytotoxic agent, an additional antibody or a therapeutically active fragment thereof, or a chemotherapy regimen.

(49) Indeed, it is contemplated that the present method and therapeutic strategies may be used alone or in combination with cytotoxic agents to increase overall patient survival. The cytotoxic therapeutic agents include, but are not limited to, angiogenesis inhibitors, antiproliferative agents, kinase inhibitors, receptor tyrosine kinase inhibitors, aurora kinase inhibitors, polo-like kinase inhibitors, bcr-abl kinase inhibitors, growth factor inhibitors, COX-2 inhibitors, non-steroidal anti-inflammatory drugs (NSAIDS), antimitotic agents, alkylating agents, antimetabolites, intercalating antibiotics, platinum containing agents, growth factor inhibitors, ionizing radiation, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biologic response modifiers, immunologicals, antibodies, hormonal therapies, retinoids/deltoids plant alkaloids, proteasome inhibitors, HSP-90 inhibitors, histone deacetylase inhibitors (HDAC) inhibitors, purine analogs, pyrimidine analogs, MEK inhibitors, CDK inhibitors, ErbB (such as ErbB2) receptor inhibitors, phosphoinositide 3-kinases (PI3Ks)/Akt signaling inhibitors, mTOR inhibitors and combinations thereof as well as other antitumor agents.

(50) Angiogenesis inhibitors include, but are not limited to, EGFR inhibitors, PDGFR inhibitors, VEGFR inhibitors, TTE2 inhibitors, IGFIR inhibitors, matrix metalloproteinase 2 (MMP-2) inhibitors, matrix metalloproteinase 9 (MMP-9) inhibitors, thrombospondin analogs such as thrombospondin- 1 and N-Ac-Sar-Gly-Val-D-allolle-Thr-Nva-He-Arg-Pro-NHCH2CH3 or a salt thereof and analogues of N-Ac-Sar-Gly-Val-D-allolle-Thr-Nva-Ile-Arg-PrO-NHCH.sub.2CH.sub.3 such as N-Ac-GlyVal-D-allolle-Ser-Gln-Ile-Arg-ProNHCH2CH3 or a salt thereof.

(51) Examples of EGFR inhibitors include, but are not limited to, Iressa (gefitinib), Tarceva (erlotinib or OSI-774), Icotinib, Erbitux (cetuximab), EMD-7200, ABX-EGF, HR3, IgA antibodies, TP-38 (IVAX), EGFR fusion protein, EGF-vaccine, anti-EGFr immunoliposomes, Tykerb (lapatinib) and AZD-8931 (sapitinib).

(52) Examples of PDGFR inhibitors include, but are not limited to, CP-673,451 and CP-868596.

(53) Examples of VEGFR inhibitors include, but are not limited to, Avastin (bevacizumab), Sutent (sunitinib, SUI 1248), Nexavar (sorafenib, BAY43-9006), CP-547,632, axitinib (AG13736), Apatinib, cabozantinib, Zactima (vandetanib, ZD-6474), AEE788, AZD-2171, VEGF trap, Vatalanib (PTK-787, ZK-222584), Macugen, M862, Pazopanib (GW786034), ABT-869 and angiozyme.

(54) Examples of thrombospondin analogs include, but are not limited to, TSP-I and ABT-510.

(55) Examples of aurora kinase inhibitors include, but are not limited to, VX-680, AZD-1152 and MLN-8054. Example of polo-like kinase inhibitors include, but are not limited to, BI-2536.

(56) Examples of bcr-abl kinase inhibitors include, but are not limited to, Gleevec (imatinib) and Dasatinib (BMS354825).

(57) Examples of platinum containing agents includes, but are not limited to, cisplatin, Paraplatin (carboplatin), eptaplatin, lobaplatin, nedaplatin, Eloxatin (oxaliplatin) or satraplatin.

(58) Examples of mTOR inhibitors includes, but are not limited to, CCI-779, rapamycin, temsirolimus, everolimus, RAD001, INK-128 and ridaforolimus.

(59) Examples of HSP-90 inhibitors includes, but are not limited to, geldanamycin, radicicol, 17-AAG, KOS-953, 17-DMAG, CNF-101, CNF-1010, 17-AAG-nab, NCS-683664, Mycograb, CNF-2024, PU3, PU24FC1, VER49009, IPI-504, SNX-2112 and STA-9090.

(60) Examples of histone deacetylase inhibitors (HDAC) includes, but are not limited to, Suberoylanilide hydroxamic acid (SAHA), MS-275, valproic acid, TSA, LAQ-824, Trapoxin, tubacin, tubastatin, ACY-1215 and Depsipeptide.

(61) Examples of MEK inhibitors include, but are not limited to, PD325901, ARRY-142886, ARRY-438162 and PD98059.

(62) Examples of CDK inhibitors include, but are not limited to, flavopyridol, MCS-5A, CVT-2584, seliciclib (CYC-202, R-roscovitine), ZK-304709, PHA-690509, BMI-1040, GPC-286199, BMS-387,032, PD0332991 and AZD-5438.

(63) Examples of COX-2 inhibitors include, but are not limited to, CELEBREX™ (celecoxib), parecoxib, deracoxib, ABT-963, MK-663 (etoricoxib), COX-189 Lumiracoxib), BMS347070, RS 57067, NS-398, Bextra (valdecoxib), paracoxib, Vioxx (rofecoxib), SD-8381, 4-Methyl-2-(3,4-dimethylphenyl)-l-(4-sulfamoyl-phenyl-lH-pyrrole, T-614, JTE-522, S-2474, SVT-2016, CT-3, SC-58125 and Arcoxia (etoricoxib).

(64) Examples of non-steroidal anti-inflammatory drugs (NSAIDs) include, but are not limited to, Salsalate (Amigesic), Diflunisal (Dolobid), Ibuprofen (Motrin), Ketoprofen (Orudis), Nabumetone (Relafen), Piroxicam (Feldene), Naproxen (Aleve, Naprosyn), Diclofenac (Voltaren), Indomethacin (Indocin), Sulindac (Clinoril), Tolmetin (Tolectin), Etodolac (Lodine), Ketorolac (Toradol) and Oxaprozin (Daypro).

(65) Exambles of ErbB (e.g. ErbB2) receptor inhibitors include, but are not limited to, CP-724-714, CI-1033, (canertinib), Herceptin (trastuzumab), Omitarg (2C4, petuzumab), TAK-165, GW-572016 (Ionafarnib), GW-282974, EKB-569, PI-166, AZD-8931 (sapitinib), dHER2 (HER2 Vaccine), APC8024 (HER2 Vaccine), anti-HER/2neu bispecific antibody, B7.her2IgG3, AS HER2 trifunctional bispecific antibodies, mAB AR-209 and mAB 2B-1.

(66) Exambles of Phosphoinositide 3-kinase inhibitor include, but are not limited to, Wortmannin, LY294002, hibiscone C, Idelalisib, Copanlisib, Duvelisib, Taselisib, Perifosine, Idelalisib, Buparlisib, Duvelisib, Alpelisib, Umbralisib, Copanlisib, PX-866, Dactolisib, CUDC-907, Voxtalisib (also known as SAR245409, XL765), CUDC-907, ME-401, IPI-549, SF1126, RP6530, INK1117, pictilisib, XL147 (also known as SAR245408), Palomid 529, GSK1059615, ZSTK474, PWT33597, IC87114, TG100-115, CAL263, RP6503, PI-103, GNE-477, and AEZS-136.

(67) Examples of alkylating agents include, but are not limited to, nitrogen mustard N-oxide, cyclophosphamide, ifosfamide, trofosfamide, Chlorambucil, melphalan, busulfan, mitobronitol, carboquone, thiotepa, ranimustine, nimustine, temozolomide, AMD-473, altretamine, AP-5280, apaziquone, brostallicin, bendamustine, carmustine, estramustine, fotemustine, glufosfamide, KW-2170, mafosfamide, and mitolactol, carmustine (BCNU), lomustine (CCNU), Busulfan, Treosulfan, Decarbazine and Temozolomide.

(68) Examples of antimetabolites include but are not limited to, methotrexate, 6-mercaptopurine riboside, mercaptopurine, uracil analogues such as 5-fluorouracil (5-FU) alone or in combination with leucovorin, tegafur, UFT, doxifluridine, carmofur, cytarabine, cytarabine ocfosfate, enocitabine, S-I, Alimta (premetrexed disodium, LY231514, MTA), Gemzar (gemcitabine), fludarabine, 5-azacitidine, capecitabine, cladribine, clofarabine, decitabine, eflornithine, ethnylcytidine, cytosine arabinoside, hydroxyurea, TS-I, melphalan, nelarabine, nolatrexed, ocfosate, disodium premetrexed, pentostatin, pelitrexol, raltitrexed, triapine, trimetrexate, vidarabine, vincristine, vinorelbine, mycophenolic acid, tiazofurin, Ribavirin, EICAR, hydroxyurea and deferoxamine.

(69) Examples of antibiotics include intercalating antibiotics but are not limited to, aclarubicin, actinomycins such as actinomycin D, amrubicin, annamycin, adriamycin, bleomycin a, bleomycin b, daunorubicin, doxorubicin, elsamitrucin, epirbucin, glarbuicin, idarubicin, mitomycin C, nemorubicin, neocarzinostatin, peplomycin, pirarubicin, rebeccamycin, stimalamer, streptozocin, valrubicin, zinostatin and combinations thereof.

(70) Examples of topoisomerase inhibiting agents include, but are not limited to, one or more agents selected from the group consisting of aclarubicin, amonafide, belotecan, camptothecin, 10-hydroxycamptothecin, 9-aminocamptothecin, diflomotecan, irinotecan HCL (Camptosar), edotecarin, epirubicin (Ellence), etoposide, exatecan, gimatecan, lurtotecan, orathecin (Supergen), BN-80915, mitoxantrone, pirarbucin, pixantrone, rubitecan, sobuzoxane, SN-38, tafluposide and topotecan.

(71) Examples of antibodies include, but are not limited to, Rituximab, Cetuximab, Bevacizumab, Trastuzumab, specific CD40 antibodies and specific IGFIR antibodies,

(72) Examples of hormonal therapies include, but are not limited to, exemestane (Aromasin), leuprolide acetate, anastrozole (Arimidex), fosrelin (Zoladex), goserelin, doxercalciferol, fadrozole, formestane, tamoxifen citrate (tamoxifen), Casodex, Abarelix, Trelstar, finasteride, fulvestrant, toremifene, raloxifene, lasofoxifene, letrozole, flutamide, bicalutamide, megesterol, mifepristone, nilutamide, dexamethasone, predisone and other glucocorticoids.

(73) Examples of retinoids/deltoids include, but are not limited to, seocalcitol (EB 1089, CB 1093), lexacalcitrol (KH 1060), fenretinide, Aliretinoin, Bexarotene and LGD-1550.

(74) Examples of plant alkaloids include, but are not limited to, vincristine, vinblastine, vindesine and vinorelbine.

(75) Examples of proteasome inhibitors include, but are not limited to, bortezomib (Velcade), MGI 32, NPI-0052 and PR-171.

(76) Examples of immunologicals include, but are not limited to, interferons and numerous other immune enhancing agents. Interferons include interferon alpha, interferon alpha-2a, interferon, alpha-2b, interferon beta, interferon gamma-1a, interferon gamma-1b (Actimmune), or interferon gamma-nl and combinations thereof. Other agents include filgrastim, lentinan, sizofilan, TheraCys, ubenimex, WF-10, aldesleukin, alemtuzumab, BAM-002, decarbazine, daclizumab, denileukin, gemtuzumab ozogamicin, ibritumomab, imiquimod, lenograstim, lentinan, melanoma vaccine (Corixa), molgramostim, OncoVAC-CL, sargaramostim, tasonermin, tecleukin, thymalasin, tositumomab, Virulizin, Z-100, epratuzumab, mitumomab, oregovomab, pemtumomab (Y-muHMFGI), Provenge (Dendreon), CTLA4 (cytotoxic lymphocyte antigen 4) antibodies and agents capable of blocking CTLA4 such as MDX-010.

(77) Examples of biological response modifiers are agents that modify defense mechanisms of living organisms or biological responses, such as survival, growth, or differentiation of tissue cells to direct them to have anti-tumor activity. Such agents include krestin, lentinan, sizofrran, picibanil and ubenimex.

(78) Examples of pyrimidine analogs include, but are not limited to, 5-Fluorouracil, Floxuridine, Doxifluridine, Ratitrexed, cytarabine (ara C), Cytosine arabinoside, Fludarabine, and Gemcitabine.

(79) Examples of purine analogs include but are not limited to, Mercaptopurine and thioguanine.

(80) Examples of antimitotic agents include, but are not limited to, ABT-751, paclitaxel, docetaxel, epothilone D (KOS-862) and ZK-EPO.

(81) The antibodies or antigen binding fragments thereof of the present invention are also intended to be used as a radiosensitizer that enhances the efficacy of radiotherapy. Examples of radiotherapy include but are not limited to, external beam radiotherapy (XBRT), or teletherapy, brachtherapy or sealed source radiotherapy, unsealed source radiotherapy.

(82) The antibodies or antigen binding fragments thereof of the present invention can also be used in combination with a different class of Bcl-2 inhibitors, such as ABT263 or ABT737.

(83) According to some embodiments, the cytotoxic agent may be at least one of gemcitabine and abraxane.

(84) According to yet another embodiment, the additional antibody or therapeutically fragment thereof may be oregovomab antibody B43.13, AR9.6 antibody, or combinations thereof.

(85) According to an embodiment, the chemotherapy regimen may be Folfirinox.

(86) In embodiments of the present invention, the tumor may be chosen from a pancreatic tumor, a gall bladder tumor, a gastric tumor, a colon tumor, an ovarian tumor, a breast tumor, and a liver tumor, and the method may be for the treatment of a cancer.

(87) In another embodiment, there is disclosed a use of an antibody or an antigen binding fragment thereof that targets O-glycan mucin-type glycoprotein MUC16, according to the present invention, or of a composition according to the present invention, for inhibiting tumor growth of a tumor expressing O-glycan mucin-type glycoprotein MUC16 in a subject in need thereof.

(88) In another embodiment, there is disclosed an antibody or an antigen binding fragment thereof that targets O-glycan mucin-type glycoprotein MUC16, according to the present invention for use in inhibiting tumor growth of a tumor expressing O-glycan mucin-type glycoprotein MUC16 in a subject in need thereof.

(89) In another embodiment, there is disclosed an antibody or an antigen binding fragment thereof that targets O-glycan mucin-type glycoprotein MUC16, according to the present invention for use in a method of inhibiting tumor growth of a tumor expressing O-glycan mucin-type glycoprotein MUC16 in a subject in need thereof.

(90) In another embodiment, there is disclosed a method of detection of a tumor expressing O-glycan mucin-type glycoprotein MUC16 in a subject in need thereof, comprising administering to the subject an antibody or an antigen binding fragment thereof specific to O-glycan mucin-type glycoprotein MUC16 according to the present invention and detecting the antibody or antigen binding fragment. According to an embodiment, the antibody or antigen binding fragment thereof may further comprise a detectable label, for example a fluorescent marker, a radioactive marker, an MRI contrast agent, or combinations thereof, as is known in the art.

(91) The invention also encompasses nucleic acid vector comprising a nucleotide sequence encoding a the antibody or antigen binding fragment thereof of the present invention, as well as cells comprising the nucleic acid vector, for expressing the the antibody or antigen binding fragment thereof of the present invention, and cells for expressing the the antibody or antigen binding fragment thereof of the present invention.

(92) The present invention will be more readily understood by referring to the following examples which are given to illustrate the invention rather than to limit its scope.

EXAMPLE 1

Expression of MUC16 Fragment

(93) An expression vector encoding a fragment of MUC16 (the TR 1.2 construct) which comprises MUC16 tandem repeat (TR) SEA domain 5 and 6 (SEQ ID NO:17). This fragment contains SEA domain of TR 5, along with the PST rich sequences of TR 4 on one side and TR6 on the other side. The TR1.2 MUC16 fragment was expressed in CHO cells and purified according to standard techniques.

EXAMPLE 2

Anti-MUC16 Monoclonal Antibody Generation

(94) Animal immunization. Four six-week old female A/J mice (The Jackson Laboratory, Bar Harbor, Me.) were bled (pre-immune serum) and injected intraperitoneally and subcutaneously with 100 μg of the TR1.2 MUC16 antigen emulsified in Titermax adjuvant at day 0 and at day 21. Blood was collected in microvette CB 300Z at day 31 or 38, and serum was stored at −20° C. until further use.

(95) ELISA (serum titer determination). Pre- and post-immune sera titers of animals were assessed by ELISA. Unless otherwise stated, all incubations were performed at room temperature. Briefly, half-area 96-well were coated with 25 μl per well of immunogen at 20 μg/ml in PBS and incubated overnight at 4° C. Microplates were washed three times in PBS and blocked for 30 min with PBS containing 1% bovine serum albumin (BSA). Blocking buffer was removed and 25 μl of serial dilutions of sera samples were added. After a 2-h incubation, microplates were washed 4 times with PBS-Tween 20 0.05% and 25 μl of a 1/5,000 dilution of alkaline phosphatase conjugated goat anti-mouse IgG (H+L) in blocking buffer was added. After a 1-h incubation, microplates were washed 4 times and 25 μl of p-nitrophenyl phosphate (pNPP) substrate at 1 mg/ml in carbonate buffer at pH 9.6 was added and further incubated for 30 min. Absorbance was read at 405 nm using a plate reader. All pre-immune bleeds were negative and all post-immune bleeds were very strong (above 1/12800) on recombinant protein. A final intraperitoneal booster injection using 100 μg of recombinant protein in PBS was done 3 days prior to fusion experiment.

(96) Fusion of the harvested spleen cells. All manipulations were done under sterile conditions. Spleen cells were harvested in Iscove's Modified Dulbecco's medium (IMDM) and fused to NS0 myeloma cell line using polyethylene glycol. Spleen cells and myeloma cells were washed in IMDM, counted in RBC lysing buffer and mixed together at a 5:1 ratio. Pelleted cells were fused together by adding 1 ml of a 50% solution of PEG 4000 in PBS preheated at 37° C. drop-wise over one minute, and incubated at 37° C. for an additional 90 sec. The reaction was stopped by addition of 30 ml of IMDM at 22° C. over 2 min. After a 10 min incubation, freshly fused cells were spun for 10 min. Cells were washed once in IMDM supplemented with 10% heat inactivated FBS and suspended at a concentration of 2×10.sup.5 input myeloma cells per ml in HAT selection medium (IMDM containing 20% heat inactivated FBS, penicillin-streptomycin, 1 ng/ml mouse IL-6, HAT media supplement and L-glutamine and incubated at 37° C., 5% CO.sub.2. The next day, hybridoma cells were washed and suspended at a concentration of 2×10.sup.5 input myeloma cells per ml in semi-solid medium D (StemCell Technologies®) supplemented with 5% heat inactivated FBS, 1 ng/ml mouse IL-6 and 10 μg/ml FITC-F(ab′)2 Goat anti-mouse IgG. The cell mixture was plated in Omnitray® dish and further incubated for 6-7 days at 37° C., 5% CO.sub.2. Fluorescent secretor clones were then transferred using a mammalian cell clone picker into sterile 96-w plates containing 200 μl of IMDM supplemented with 20% heat inactivated FBS, penicillin-streptomycin, 1 ng/ml mouse IL-6, HT media supplement (Sigma® Cat# H0137) and L-glutamine and incubated for 2-3 days at 37° C., 5% CO2.

(97) Screening. Hybridoma supernatant were screened by ELISA to detect specific binders. To this end, 96-wells half-area plates were coated with 25 μl of TR1.2 MUC16 at 20 μg/ml or an irrelevant control protein at 5 μg/ml in PBS and incubated overnight at 4° C. Microplates were washed 3 times with PBS, blocked with PBS-BSA 1%, and 25 μl of hybridoma supernatant were added and incubated at 37° C., 5% CO.sub.2 for 2 hours. Plates were washed 4 times with PBS-Tween 20 0.05% and incubated for one hour at 37° C., 5% CO.sub.2 with 25 μl of secondary antibody alkaline phosphatase conjugated F(ab′)2 goat anti-mouse IgG diluted 1/5000 in blocking buffer. After 4 washes with PBS-Tween 20 0.05%, 25 μl of a 1 mg/ml pNPP substrate solution was added and further incubated for one hour at 37° C. OD405 nm measurements were done using a microplate reader. Hits were confirmed using alkaline phosphatase conjugated F(ab′)2 goat anti-mouse IgG Fc gamma specific and 50 mAbs were selected for further characterization.

(98) Recloning of hybridomas. Selected hybridoma were recloned by limiting dilution to ensure their monoclonality.

EXAMPLE 3

Making of Recombinant Anti-MUC16

(99) The V.sub.H and V.sub.L regions of the candidate antibody against MUC16 TR1.2A were sequenced, synthesized and cloned into the pTT5 vector in-frame with a constant domain of a human IgG1 heavy chain (comprising CH1, CH2 and CH3 regions) or in-frame with a constant domain of a human kappa light chain -, and recombinant mAbs were produced in CHO-3E7 cells by transient transfection according to Delafosse et al. J Biotechnol, 227 (2016). This antibody was named POCmAb.

(100) TABLE-US-00016 TABLE 1 Amino acid sequence of V.sub.H and V.sub.L regions of antibody POCmAb Region Sequence SEQ ID NO V.sub.H EVQLVESGGGLVQPGGSRKLSCAASGFTFSTFGMHWVRQAPEKG SEQ ID NO: 15 LEWVAYISSGSSTIYYGDTLOGRFIISRDNPKNTLFLQMTSLRS EDTAMYYCARSGYDYDPIYYALDYWGQGTSVTVSS V.sub.L DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQKP SEQ ID NO: 16 GHPPKLLIYGASNQGSGVPARFSGSGSGTDFSLNIHPMEEDDAA MYFCQQTKEVPWTFGGGTKVEIKR

(101) TABLE-US-00017 TABLE 2 Chothia numbering of the V.sub.H sequence =scheme number. sequence position. amino acid H1 1 E H2 2 V H3 3 Q H4 4 L H5 5 V H6 6 E H7 7 S H8 8 G H9 9 G H10 10 G H11 11 L H12 12 V H13 13 Q H14 14 P H15 15 G H16 16 G H17 17 S H18 18 R H19 19 K H20 20 L H21 21 S H22 22 C H23 23 A H24 24 A H25 25 S H26 26 G H27 27 F H28 28 T H29 29 F H30 30 S H31 31 T H32 32 F H33 33 G H34 34 M H35 35 H H36 36 W H37 37 V H38 38 R H39 39 Q H40 40 A H41 41 P H42 42 E H43 43 K H44 44 G H45 45 L H46 46 E H47 47 W H48 48 V H49 49 A H50 50 Y H51 51 I H52 52 S H52A 53 S H53 54 G H54 55 S H55 56 S H56 57 T H57 58 I H58 59 Y H59 60 Y H60 61 G H61 62 D H62 63 T H63 64 L H64 65 Q H65 66 G H66 67 R H67 68 F H68 69 I H69 70 I H70 71 S H71 72 R H72 73 D H73 74 N H74 75 P H75 76 K H76 77 N H77 78 T H78 79 L H79 80 F H80 81 L H81 82 Q H82 83 M H82A 84 T H82B 85 S H82C 86 L H83 87 R H84 88 S H85 89 E H86 90 D H87 91 T H88 92 A H89 93 M H90 94 Y H91 95 Y H92 96 C H93 97 A H94 98 R H95 99 S H96 100 G H97 101 Y H98 102 D H99 103 Y H100 104 D H100A 105 P H100B 106 I H100C 107 Y H100D 108 Y H100E 109 A H100F 110 L H101 111 D H102 112 Y H103 113 W H104 114 G H105 115 Q H106 116 G H107 117 T H108 118 S H109 119 V H110 120 T H111 121 V H112 122 S H113 123 S

(102) TABLE-US-00018 TABLE 3 CDR Sequences (Chothia), and CDR Canonical Class Region Sequence Residues Length SEQ ID NO HFR1 EVQLVESGGGLVQPGGSRKLSCAAS  1-25 25 SEQ ID NO: 7 CDR H1 GFTFSTF 26-32  7 SEQ ID NO: 1 HFR2 GMHWVRQAPEKGLEWVAYI 33-51 19 SEQ ID NO: 8 CDR H2 SSGSST 52-57  6 SEQ ID NO: 2 HFR3 IYYGDTLQGRFIISRDNPKNTLFLQMTSLR 58-98 41 SEQ ID NO: 9 SEDTAMYYCAR CDR H3 SGYDYDPIYYALDY  99-112 14 SEQ ID NO: 3 HFR4 WGQGTSVTVSS 113-123 11 SEQ ID NO: 10 CDR H1 is predicted to be canonical class 1 (1/10A) CDR H2 is predicted to be canonical class 3 (3/10B)

(103) TABLE-US-00019 TABLE 4 Chothia numbering of the V.sub.L sequence =scheme number. sequence position. amino acid L1 1 D L2 2 I L3 3 V L4 4 L L5 5 T L6 6 Q L7 7 S L8 8 P L9 9 A L10 10 S L11 11 L L12 12 A L13 13 V L14 14 S L15 15 L L16 16 G L17 17 Q L18 18 R L19 19 A L20 20 T L21 21 I L22 22 S L23 23 C L24 24 R L25 25 A L26 26 S L27 27 E L28 28 S L29 29 V L30 30 D L30A 31 N L30B 32 Y L30C 33 G L30D 34 I L31 35 S L32 36 F L33 37 M L34 38 N L35 39 W L36 40 F L37 41 Q L38 42 Q L39 43 K L40 44 P L41 45 G L42 46 H L43 47 P L44 48 P L45 49 K L46 50 L L47 51 L L48 52 I L49 53 Y L50 54 G L51 55 A L52 56 S L53 57 N L54 58 Q L55 59 G L56 60 S L57 61 G L58 62 V L59 63 P L60 64 A L61 65 R L62 66 F L63 67 S L64 68 G L65 69 S L66 70 G L67 71 S L68 72 G L69 73 T L70 74 D L71 75 F L72 76 S L73 77 L L74 78 N L75 79 I L76 80 H L77 81 P L78 82 M L79 83 E L80 84 E L81 85 D L82 86 D L83 87 A L84 88 A L85 89 M L86 90 Y T87 91 F L88 92 C L89 93 Q L90 94 Q L91 95 T L92 96 K L93 97 E L94 98 V L95 99 P L96 100 W L97 101 T L98 102 F L99 103 G L100 104 G L101 105 G L102 106 T L103 107 K L104 108 V L105 109 E L106 110 I L107 111 K L108 112 R

(104) TABLE-US-00020 TABLE 5 Sequences (Chothia), and CDR Canonical Class Region Sequence Residues Length SEQ ID NO LFR1 DIVLTQSPASLAVSLGQRATISC  1-23 23 SEQ ID NO: 11 CDR L1 RASESVDNYGISFMN 24-38 15 SEQ ID NO: 4 LFR2 WFQQKPGHPPKLLIY 39-53 15 SEQ ID NO: 12 CDR L2 GASNQGS 54-60  7 SEQ ID NO: 5 LFR3 GVPARFSGSGSGTDFSLNIHPMEEDDAAMYFC 61-92 32 SEQ ID NO: 13 CDR L3 QQTKEVPWT  93-101  9 SEQ ID NO: 6 LFR4 FGGGTKVEIKR 102-112 11 SEQ ID NO: 14 CDR L1 has no canonical class match CDR L2-Class 1 CDR L3-Class 1

EXAMPLE 4

Binding Specificity of Anti-MUC16 TR1.2A

(105) Now referring to FIG. 2. The binding specificity of humanized version of the anti-MUC16 TR1.2A, namely (POCmAb) against various pancreatic cancer cells is tested. FIG. 2A shows that POCmAb recognizes various isoforms of MUC16 in different pancreatic cancer cells as compared to another anti-MUC16 antibody, mouse anti-MUC16 mAb AR9.6 (also referred to as mAR9.6; FIG. 2B). Next, the binding specificity of murine mAR9.6 and humanized POCmAb anti-MUC16 antibodies against human pancreatic cancer cells (T3M4) that are treated with Sialidase, O-glycanase and N-glycanase enzymes is tested. FIGS. 3A and 3B shows that samples treated with N-glycanase have reduced reactivity with either antibodies (lanes 2 and 5). However, samples treated with O-glycanase and sialidase either alone or in combination shows increased reactivity with either antibodies (lanes 3, 4 and 6). Next, the binding specificity of murine mAR9.6 and humanized POCmAb anti-MUC16 antibodies against MUC16 TR1.2 purified from CHO wild-type cells, which was treated with different glycosidases such as sialidase, O-glycanase and N-glycanase was tested. FIG. 4 shows that samples treated with N-glycanase have reduced reactivity with either antibodies (lanes 2 and 5). However, samples treated with O-glycanase and sialidase either alone or in combination show that increased reactivity with either antibodies (lanes 3, 4 and 6). Taken together, these results suggest that N-glycans on the MUC16 glycoprotein is essential for antibody binding. However, O-glycans and sialic acid groups on the MUC16 either blocks or mask the epitopes for anti-MUC16 antibody reactivity. FIG. 5A shows that POCmAb recognizes various isoforms of MUC16 in Pancreatic Ductal Adenocarcinoma (PDAC) patients ascites fluids (37.5%; 6/16) than compared to mouse anti-MUC16 mAb AR9.6 (FIG. 5B).

EXAMPLE 4

Live/Dead Cell Cytotoxicity Assay

(106) Live/Dead cytotoxicity assay is performed to compare the effect of mAR9.6 and POCmAb antibodies in inducing cell death in PDAC cells. Mouse AR9.6 antibody has affinity and specific reactivity towards MUC16, which enables it to inhibit in vivo pancreatic tumor growth and metastasis. mAb AR9.6 significantly induced cell death of PDAC cells and selectively inhibited the activation of oncogenic signaling.

(107) Materials and Methods. T3M4 wildtype (WT) and COSMC deleted (SimpleCells, SC) were treated with equal amounts of mAR 9.6 (5 μg/ml) and POCmAb (5 μg/ml) or with isotype matched (either mouse or human) control IgG antibody for 24 h. For the comparison of effect of antibodies in inducing cell death, T3M4 WT cells were treated with Sapitinib (an ErbB receptor tyrosine kinase inhibitor, 5.4 μM) and LY294002 (PI3K/Akt inhibitor, 11.3 μM) alone or in combination with mAR9.6 (5 μg/ml) and POCmAb (5 μg/ml) for 24 h. The cells were washed well with cell-culture grade PBS. 20 μl ethidium homodimer-1 (EthD-1, 2 mM) was dissolved in 10 ml PBS. To this solution, 5 μl of calcein acetoxymethyl ester (calcein-AM, 4 mM) was added. 150 μl of this combined reagent was added to the cells grown on coverslip and incubated for 30-45 minutes. The numbers of live and dead cells were detected with Zeiss LSM 710™ confocal laser scanning microscope (Carl Zeiss, Inc., Thornwood, NY, USA) at Confocal Laser Scanning Fluorescence Microscope Core Facility, UNMC. The ratio of dead cells to total cells was calculated for quantitative comparisons. Unpaired Student's t-test was performed to calculate the statistical significance between the antibodies treated T3M4 WT and T3M4 SC cells (n=4) (p<0.05 considered statistically significant). Two way analysis of variance (ANOVA) was performed to calculate the statistical significance between the inhibitors and antibody treated T3M4 cells (n=4) (p<0.05 considered statistically significant).

(108) Results—Monoclonal antibodies mAR9.6 and POCmAb inducing cell death in PDAC cells. T3M4 wildtype (WT) and COSMC deleted (SimpleCells, SC) were treated with mAR 9.6 (5μg/ml), POCmAb (5 μg/ml), or an isotype matched control IgG antibody for 24 h. The effect of antibodies in inducing cell death in T3M4 WT and SC cells were analyzed by Live/Dead cytotoxicity assay. As shown in the FIGS. 6 and 7, the live cells were stained in green and the dead cells in red. Both antibodies mAR 9.6 (p<0.0001) and POCmAb (p<0.0001) were found to induce cell death significantly in T3M4 WT cells when compared to either mouse or human IgG control. While comparing the effect between antibodies in inducing cell death, POCmAb was found to be more effective than mAR9.6 (about 39% vs. 15%; p<0.0001). COSMC deleted T3M4 cells are highly tumorigenic cells as they express a number of truncated O-glycans on their surface. Interestingly, both the antibodies induced more cell death in T3M4 SC cells. POCmAb induced cell death was significantly higher in T3M4 SC cells when compared to mAR9.6 antibody induced cell death (about 55% vs. 22%; p<0.0001).

(109) As an additional comparison of the effect of POCmAb antibody versus mAR9.6 in inducing cell death, T3M4 cells treated with Sapitinib (an ErbB receptor tyrosine kinase inhibitor, 5.4 μM) and LY294002 (PI3K/Akt inhibitor, 11.3 μM) alone or in combination with mAR9.6 (5 μg/ml) and POCmAb (5 μg/ml), or an isotype matched control IgG antibody for 24 h. As shown in FIGS. 9-10, the combination therapy of mAR9.6 induced significant cell death in T3M4 cells as compared to inhibitor alone treated cells. mAR9.6 along with Sapitinib induced more cell death when compared to sapitinib and mouse IgG treated cells (about 17% vs. about 27%, p=0.0003). Similarly, mAR9.6 along with LY294002 induced more cell death when compared to LY294002 and mouse IgG treated cells (about 15% vs. about about 21%, p=0.0016). More interestingly, the combination of mAR9.6 and Sapitinib along with LY294002 further induced more cell death when compared to Sapitinib and LY294002 and mouse IgG treated cells (about 43% vs. about 59%, p=0.0141). The results of this study shown that mAR9.6 in combinations with Sapitinib and LY294002 is highly effective in inducing cell death in PDAC cells.

(110) Cells were also treated with POCmAb either alone or in combination with Sapitinib or LY294002. Now referring to FIGS. 10-11, it is shown that POCmAb along with Sapitinib induced significantly increased number of cell death when compared to sapitinib and human IgG treated cells (about 17% vs. about 55%, p<0.0001). Similarly, POCmAb along with LY294002 induced significantly increased number of cell death when compared to LY294002 and human IgG treated cells (about 15% vs. about 65%, p<0.0001). More interestingly, the combination of POCmAb with Sapitinib and LY294002 further induced significantly more cell death when compared to Sapitinib and LY294002 and human IgG treated cells (about 20% vs. about 70%, p<0.0001). Taken together, while comparing the effect of mAR9.6 vs. POCmAb antibodies in inducing cell death in PDAC cells, POCmAb antibody was found to be unexpectedly and surprisingly more effective (FIG. 12).

(111) While preferred embodiments have been described above and illustrated in the accompanying drawings, it will be evident to those skilled in the art that modifications may be made without departing from this disclosure. Such modifications are considered as possible variants comprised in the scope of the disclosure.

(112) TABLE-US-00021 SEQUENCES SEQ ID NO: Sequence Description SEQ ID NO: 1 GFTFSTF CDR H1 SEQ ID NO: 2 SSGSST CDR H2 SEQ ID NO: 3 SGYDYDPIYYALDY CDR H3 SEQ ID NO: 4 RASESVDNYGISFMN CDR L1 SEQ ID NO: 5 GASNQGS CDR L2 SEQ ID NO: 6 QQTKEVPWT CDR L3 SEQ ID NO: 7 EVQLVESGGGLVQPGGSRKLSCAAS HFR 1 SEQ ID NO: 8 GMHWVRQAPEKGLEWVAYI HFR 2 SEQ ID NO: 9 IYYGDTLQGRFIISRDNPKNTLFLQMTSLRSEDTAMYYCAR HFR 3 SEQ ID NO: 10 WGQGTSVTVSS HFR 4 SEQ ID NO: 11 DIVLTQSPASLAVSLGQRATISC LFR 1 SEQ ID NO: 12 WFQQKPGHPPKLLIY LFR 2 SEQ ID NO: 13 GVPARFSGSGSGTDFSLNIHPMEEDDAAMYFC LFR 3 SEQ ID NO: 14 FGGGTKVEIKR LFR 4 SEQ ID NO: 15 EVQLVESGGGLVQPGGSRKLSCAASGFTFSTFGMHWVRQAPEK variable heavy GLEWVAYISSGSSTIYYGDTLQGRFIISRDNPKNTLFLQMTSL domain (VH) RSEDTAMYYCARSGYDYDPIYYALDYWGQGTSVTVSS SEQ ID NO: 16 DIVLTQSPASLAVSLGQRATISCRASESVDNYGISFMNWFQQK variable light PGHPPKLLIYGASNQGSGVPARFSGSGSGTDFSLNIHPMEEDD domain (VL) AAMYFCQQTKEVPWTFGGGTKVEIKR SEQ ID NO: 17 IPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTI MUC16 1.2TR TNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSG CRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQ LTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLG TSGTPSSLPSPTSAGPLLVPFT

REFERENCES

(113) 1. Arbabi-Ghahroudi, M., Desmyter, A., Wyns, L., Hamers, R., Muyldermans, S. (1997) FEBS Lett 414:521-6. 2. Bell, A., Wang, Z. J., Arbabi-Ghahroudi, M., Chang, T. A., Durocher, Y., Trojahn, U., Baardsnes, J., Jaramillo, M. L., Li, S., Baral, T. N., O'Connor-McCourt, M., MacKenzie, R., Zhang, J. (2010) Cancer Lett 289:81-90. 3. Chothia, C., Lesk, A. M. (1987) J Mol Biol 196:901-17. 4. Davies, J., Riechmann, L. (1996) Immunotechnology 2:169-79. 5. de Kruif, J., Logtenberg, T. (1996) J Biol Chem 271:7630-4. 6. Dumoulin, M., Conrath, K., Van Meirhaeghe, A., Meersman, F., Heremans, K., Frenken, L. G., Muyldermans, S., Wyns, L., Matagne, A. (2002) Protein Sci 11:500-15. 7. Durocher, Y., Perret, S., Kamen, A. (2002Nucleic Acids Res 30:E9. 8. Hamers-Casterman, C., Atarhouch, T., Muyldermans, S., Robinson, G., Hamers, C. Songa, E. B., Bendahman, N., Hamers, R. (1993) Nature 363:446-8. 9. Hussack, G., Arbabi-Ghahroudi, M., van Faassen, H., Songer, J. G., Ng, K. K., MacKenzie, R., Tanha, J. (2011a) J Biol Chem 286:8961-76. PLoS One 6:e28218. 11. Jespers, L., Schon, O., James, L. C., Veprintsev, D., Winter G. (2004) J Mol Biol 337:893-903. 12. Kabat, E. A., Wu, T. T., (1991) J Immunol 147:1709-1719. 13. Kim, D. Y., Kandalaft, H., Ding, W., Ryan, S., van Faassen, H., Hirama, T., Foote, S. J., MacKenzie, R., Tanha, J. (2012) Protein Eng Des Sel 25:581-9. 14. Li, S., Zheng, W., Kuolee, R., Hirama, T., Henry, M., Makvandi-Nejad, S., Fjällman, T., Chen, W., Zhang, J. (2009) Mol Immunol 46:1718-26. 15. Merritt, E. A., Hol, W. G. (1995) Curr Opin Struct Biol 5:165-71. 16. Nicaise, M., Valerio-Lepiniec, M., Minard, P., Desmadril, M. (2004) Protein Sci 13:1882-91. 17. Nuttall, S. D., Krishnan, U. V., Doughty, L., Pearson, K., Ryan, M. T., Hoogenraad, N. J., Hattarki, M., Carmichael, J. A., Irving, R. A., Hudson, P. J. (2003) Eur J Biochem 270:3543-54. 18. Ridgway, J. B., Presta, L. G., Carter, P. (1996) Protein Eng 9:617-21. 19. To, R., Hirama, T., Arbabi-Ghahroudi, M., MacKenzie, R., Wang, P., Xu, P., Ni, F., Tanha, J. (2005) J Biol Chem 280:41395-403. 20. Zhang, J., Tanha, J., Hirama, T., Khieu, N. H., To, R., Tong-Sevinc, H., Stone, E., Brisson, J. R., MacKenzie, C. R. (2004a)J Mol Biol 335:49-56. 21. J Mol Biol 341:161-9. 22. Zhu, X., Wang, L., Liu, R., Flutter, B., Li, S., Ding, J., Tao, H., Liu, C., Sun, M., Gao, B. (2010) Immunol Cell Biol 88:667-75. 23. Marcos-Silva, L. et al. J. Proteome Res. 2014, 13, 3349-3359.