DEVELOPMENT OF A NEW ENGINEERED TOBACCO ETCH VIRUS (TEV) PROTEASE ACTIVABLE IN THE CYTOSOL OR SECRETORY PATHWAY
20230285520 · 2023-09-14
Assignee
- Università Cattolica del Sacro Cuore (Milano, IT)
- Fondazione Policlinico Universitario Agostino Gemelli IRCCS (Rome, IT)
Inventors
Cpc classification
C12N15/1031
CHEMISTRY; METALLURGY
C12Y304/22044
CHEMISTRY; METALLURGY
A61K38/4873
HUMAN NECESSITIES
International classification
C12N9/50
CHEMISTRY; METALLURGY
Abstract
The present invention relates to a protein having proteolytic activity inducible and activable by the experimenter in the cytosol or in the secretory pathway, and uses thereof for controlling the maturation in a vital cell of a protein subject to proteolytic cleavage, and in a purification process of recombinant proteins.
Claims
1. A protein with inducible proteolytic activity comprising the polypeptide sequence of a protease and the polypeptide sequence of an activator-binding domain, wherein said domain in the absence of said activator inhibits the proteolytic activity of said protease and in the presence of said activator restores the proteolytic activity of said protease, wherein said activator is rapamycin or an analogue thereof.
2. The protein according to claim 1, wherein said domain is a domain constituted by the fusion of the FRB and FKBP domain.
3. The protein according to claim 1, wherein said domain has the polypeptide sequence SEQ ID NO: 1.
4. The protein according to claim 1, wherein said protease belongs to the C4 peptidase family.
5. The protein according to claim 1, wherein said protease is TEV protease having SEQ ID NO: 3 or SEQ ID NO: 4.
6. The protein according to claim 1, wherein said domain is inserted between A and B domains of said protease, wherein said A and B domains correspond to two inactive fragments of said protease.
7. The protein according to claim 1, wherein said protein comprises one or more linker sequences for binding between said protease and said domain, wherein said linkers have one of the following sequences: Gly-Gly-Ser-Gly-Gly-Gly (SEQ ID NO: 2), Gly-Gly-Ser and Gly.
8. The protein according to claim 1, wherein said protease is TEV protease having SEQ ID NO: 3 SEQ ID NO: 4. and wherein said domain is inserted between 5120 and M121 residues of said protease.
9. The protein according to claim 1, wherein said protease is TEV protease having SEQ ID NO: 3 or SEQ ID NO: 4, wherein one or more of the following mutations N23Q, T173G, C130S, I138T, S153N and T180A are inserted in the sequence of said protease.
10. The protein according to claim 1, wherein said protein with inducible proteolytic activity has SEQ ID NO: 5 (unica-TEV).
11. The protein according to claim 1, wherein said protein with inducible proteolytic activity has SEQ ID NO: 6 (unica-sec-TEV).
12. A nucleotide sequence codifying a protein with inducible proteolytic activity, wherein said protein has SEQ ID NO: 5 (unica-TEV) or SEQ ID NO: 6 (unica-sec-TEV).
13. A method for controlling maturation of a protein subject to proteolytic cleavage in a cell comprising contacting the cell with the protein of claim 1.
14. The method according to claim 13 for control in the cytosol or in other secretory pathways.
15. The method according to claim 13, wherein said protein subject to proteolytic cleavage is BDNF.
16. A method of purifying recombinant proteins of interest comprising contacting the proteins of interest with the protein according to claim 1.
17. A method for controlling the maturation in a cell of a protein subject to proteolytic cleavage comprising the following steps of: a) co-expressing in a cell a protein with inducible proteolytic activity according to claim 1 and a protein subject to proteolytic cleavage b) incubating said cell with the activators of said protein with proteolytic activity in order to induce the maturation of said protein.
18. The method according to claim 17, wherein the maturation of BDNF protein is induced.
19. A method of treating a disease associated with uncontrolled maturation of a disease-associated protein, comprising administering a therapeutically effective amount of the protein of claim 1 to a subject in need thereof.
20. A method of treating a disease associated with uncontrolled maturation of a disease-associated protein, comprising administering a therapeutically effective amount of the nucleotide sequence of claim 12 to a subject in need thereof
Description
BRIEF DESCRIPTION OF FIGURES
[0044]
[0045]
[0046]
[0047]
[0048]
[0049] (A) Experimental scheme: transfection of HEK293 cells with the plasmids codifying unica-secTEV and pro-TEVcs-BDNF. After 24 h, the cells were lysed to extract the proteins which were subjected to immunoprecipitation (IP) and purification by means of chromatographic columns. B) the proteins after IP were detected by means of Western blot, the production of mature BDNF around 40 kDa (BDNF+tag) in presence of rapamycin is noted. C) the immunoprecipitation with antibody binding BDNF demonstrates the capability of kit ELISA to detect the presence of proBDNF (3) and mature BDNF (4) whereas from the lysate of not transfected cells (1) or cells transfected only with unica-sec-TEV (2) neither proBDNF nor BDNF immunoprecipitates. The pro-TEVcs-BDNF is split in mature BDNF in presence of unica-sec-TEV in the transfected cells after addition of 1-4 μM rapamycin for 6 h. D) mature BNDF purified from mammal heterologous cells applied to hippocampal organotypic sections of rat induces a phosphorylation of ERK protein as shown by Western blot experiments, demonstrating that is has a biological effect.
[0050]
[0051] A) Representation of the plasmids used to transfect the brain sections containing hippocampus. B) Images of the activation effect of unica-secTEV and of the consequent BDNF maturation on the number of dendritic spines in neurons of CA1 region of organotypic sections of murine hippocampi. Graphs showing % increases in the number of dendritic spines (C) and the volume increases (D) induced by the control of BDNF maturation.
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
DETAILED DESCRIPTION OF THE INVENTION
Glossary
[0061] All scientific and technical terms used in the present document have the same meaning commonly meant by a person skilled in the art, except where differently indicated.
[0062] Nucleotides and amino acids are designated according to IUPAC-IUB nomenclature and/or by means of one-letter and/or three-letter code (37 C.F.R. § 1.822). The nucleotide sequences are shown only per single filament, in the direction from 5′ to 3′, from left to right.
[0063] Standard methods can be used to clone genes, to amplify and detect nucleic acids, and such techniques are known to the persons skilled in the art. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual 2.sup.nd Ed. (Cold Spring Harbor, N.Y., 1989); Ausubel et al., Current protocols in Molecular Biology (Green Publishing Associates, Inc. and John Wiley & Sons, Inc., New York), herein incorporated by reference.
[0064] Under the term “protease”, even known as “proteinase”, “peptidase” or “proteolytic enzyme”, one refers to an enzyme which is capable of catalyzing the rupture of the peptide bond between the amino group and the carboxylic group of proteins. The bond rupture mechanism provides for the use of water molecule, for this the proteases are even classified as hydrolases. The proteases can be divided based upon the structural properties of the substrate subjected to attack: the exopeptidases catalyze the removal of an amino acid on the carboxy terminal side (carboxypeptidase) or on the N-terminal end (aminopeptidase); endopeptidases catalyze the rupture of an amino acidic residue existing within the polypeptide chain and not at the ends.
[0065] Proteases can even be classified based upon the catalytic amino acidic residue used in the activation process of water molecule used to perform hydrolysis: these include serine protease, a threonine protease, cysteine protease, aspartate protease (aspartic acid), glutamate acid (glutamic acid) protease, or metalloprotease.
[0066] Proteases can be further classified based upon optimum pH for their activation: therefore, they divide into alkaline, neutral or acid proteases.
[0067] In the present description, the acronym “TEV” is used to identify, depending upon the context, “Tobacco Etch Virus” and/or “Tobacco Etch Virus nuclear-inclusion-a” endopeptidase enzyme deriving from Tobacco Etch Virus. Tobacco Etch Virus is a pathogen virus for plants belonging to the family of Potyviridae, codified by a filament of positive-polarity RNA surrounded by a capsid consisting of one single viral protein.
[0068] TEV genome is expressed entirely in one single polyprotein weighing 350 kDa, which is then cleaved by 3 endoprotease, thereamong the above-mentioned Nuclear-inclusion-A endopeptidase (NIa), better known as “TEV protease” (49 kDa). According to MEROPS classification, this protease belongs to “PA” family of C4 peptidase with structure consisting of two antiparallel β sheets (Nunn et al., 2005; Phan et al., 2002). Although homologous of serine protease, TEV protease uses a cysteine as nucleophile catalytic site.
[0069] The cleavage region recognized by TEV (TEVcs) is a specific sequence of seven amino acids: ENLYFQ-S/G, wherein proteolysis takes place between Q and S or G (Dougherty et al., 1989). TEV further includes a sequence of self-proteolysis (GHKVFM-S) in the C-terminal portion among the residues 213-219, causing a cleavage at level of M218 (Kapust et al., 2001; Parks et al., 1995). After self-proteolysis an activity loss is noted since the cleft peptide portion (219-242) inhibits the enzyme catalytic site by preventing the substrate from accessing (Nunn et al., 2005). For this reason, often a point-like mutation is introduced, truncating protease at level of V219.
[0070] The term “proteolytic activity” according to the present invention has the meaning commonly recognized in the art, that is it refers to the capability of a protein to catalyze hydrolysis of peptide bond within an amino acid sequence. Techniques aimed at assaying the proteolytic activity of a protein are known to the person skilled in the art. Such techniques include assays of enzymatic activity, for example by means of using constructs characterized by a pair of fluorophores bound therebetween by means of the specific cleavage sequence of protease under examination.
[0071] “Signal leader peptide” has the meaning commonly known in the art and it relates to short peptides (leader sequences) existing at the N-terminal end of most proteins of new synthesis which are intended towards the secretory pathway.
[0072] With the acronym “BDNF”, in the present description the brain-derived neurotrophic factor is meant, polypeptide existing at brain level in the mammals belonging to the family of neurotrophins, molecules which regulate the operation of nervous cells. The mature BDNF is active both in the central nervous system and in the peripheral system, and through TrkB receptor contributes to synaptic plasticity, to survival and to differentiation of neurons. BDNF can be found in high concentrations even in some peripheral tissues, after activation of the platelets which determines a significant increase in BDNF blood concentration. Generally, BDNF brain concentration varies depending upon the different physiological conditions (hormones, stress, food habits, physical activity, inflammatory processes), and thus it can show the presence of neurodegenerative pathologies. On the contrary, BDNF precursor, called “proBDNF”, can bind to NGF/TNFRSF16 receptor by inducing long-term synaptic depression and cell apoptosis.
[0073] As previously mentioned, the goal of the present invention is to provide an engineered protease characterized by chemically inducible proteolytic activity and controllable by the experimenter in an effective way. The strategy proposed in the present invention to provide a protease with an inducible proteolytic activity in a controlled way provides for the insertion within the polypeptide sequence of the protein of interest of an artificial domain capable of binding an activating agent. The bond with such activating agent translates into a conformational modification or change in the artificial domain which allows to restore the proteolytic activity of the protease of interest. The main advantage offered by this strategy is represented by the possibility of obtaining a protease with inducible activity characterized by one single polypeptide chain, thus overcoming the limits deriving from the use of several inactive separated constructs and/or fragments, as in case of split-TEV. Such limits include, for example, a slower catalytic activity of protease, a residual activity of background independent from induction, as well as a heterogeneous proteolytic response deriving from a variable and not controllable stoichiometry. The protein with inducible proteolytic activity according to the invention can advantageously be expressed both in the cytosol and in the secretory pathway of a cell of interest, in a way which can be controlled the experimenter, and then it can be used to control the maturation of proteins of interest which are subjected to a proteolytic cleavage within any wished cell compartment.
[0074] Then, the invention relates to a protein with inducible proteolytic activity comprising the polypeptide sequence of a protease and the polypeptide sequence of an activator-binding domain, wherein said domain in the absence of said activator inhibits the proteolytic activity of said protease and in the presence of said activator restores the proteolytic activity of said protease.
[0075] Preferably, according to an aspect of the invention, the polypeptide sequence of said activator-binding domain, could be integrated within the polypeptide sequence of the protease of interest, for example at an insertion site existing within the protease polypeptide sequence, as described hereinafter, so as to form one continuous polypeptide chain. This allows to obtain a protease with inducible proteolytic activity characterized by one single construct, or by one single polypeptide chain, by overcoming the previously mentioned limits.
[0076] According to an aspect of the invention, the integration of the peptide sequence of the activator-binding domain within the protease polypeptide sequence can take place at an internal insertion site of said protein sequence, then also determining an interruption of the protease sequence itself, provided that such insertion does not compromise to restore the protease activity after addition of an activating compound.
[0077] According to an aspect of the invention, said insertion of the polypeptide sequence del activator-binding domain can take place between a domain A and a domain B of the protease peptide sequence, wherein said domini A and B correspond to two inactive fragments of protease which can be reunited to restore the protease enzymatic activity. For example, after addition of an activating compound, the domain binding said activator be subjected to a conformational modification capable of favouring the dimerization of the two inactive domains A and B, by restoring the protease enzymatic activity.
[0078] According to an aspect of the invention, an activator-binding domain suitable to be used in the present invention then is any peptide sequence the thermal stability and/or conformation and/or distance between its N-terminal and C-terminal residues thereof depends specifically upon the bond with and/or recognition by an activating agent.
[0079] According to an aspect of the invention, said activator-binding domain is a domain constituted by the fusion of the FRB and FKBP domain. In other terms, the peptide sequence of the activator-binding domain according to the present invention can be obtained by fusing the sequences of the two FRB and FKBP peptide domains.
[0080] With the terms “FRB domain” and “FKBP domain”, the present description respectively relates to the fusion peptides known as “FKBP-rapamycin binding” and “FK506-binding protein” capable of dimerizing with high affinity after addition of rapamycin. In an embodiment of the invention, FRB and FKBP domains can be used as described in the article with title “Rational design of a ligand-controlled protein conformational switch” by O. Dagliyan et al. PNAS 2013, vol. 110, Nr. 17, herein incorporated as reference.
[0081] After interaction with the activating agent, the domain obtained by the fusion of sequences of FRB and FKBP domains is subjected to a conformational modification which allows to restore the protease enzymatic activity.
[0082] According to an embodiment, said activator-binding domain is the artificial regulating domain known with the abbreviation “uniRapR”. In a preferred embodiment of the invention, said activator-binding domain has the polypeptide sequence SEQ ID Nr. 1.
[0083] Examples of activating agents according to the present invention include compounds which are capable of recognizing and/or binding the acid sequence of said domain existing in the sequence of the protein having inducible proteolytic activity, and of causing a conformational alteration and/or modification of said domain capable of restoring the proteolytic activity of said protein. The recognition of the activating agent by the corresponding domain could take place by formation of a covalent bond or by interaction of not covalent nature, provided that it is capable of causing a moderate conformational of the peptide structure of said domain aimed at restoring the protein proteolytic activity.
[0084] According to an aspect of the invention, said activator and/or activating agent is rapamycin or an analogue thereof. Rapamycin is a macrolide antibiotic discovered as product of a bacterium (Streptomyces hygroscopicus) in a sample of ground coming from Rapa Nui. Rapamycin is also known under the name of “Sirolimus”, an immunosuppressive drug having as target in mammals a kinase threonine serine (mTOR, da mammalian Target of Rapamycin) capable of regulating growth, proliferation, motility and cell survival.
[0085] Rapamycin analogues which can be used for activating the protease, the present invention, include, for example, not immunosuppressive analogues such as for example C-16-(S)-3-methylindolerapamycin (iRap), but even DL001, AP23573, RAD001, 001-779.
[0086] According to an aspect of the present invention, the protein with inducible proteolytic activity comprises the polypeptide sequence of a protease belonging to the family of C4 peptidase. According to the MEROPS classification system of proteases, with the code “C4” one refers in particular to a family of protease with endopeptidase activity, having the cysteine as nucleophile catalytic site. From a structural point of view, the proteases belonging to the family of peptidases C4 share a central motif consisting of two antiparallel β sheets, and a histidine-aspartic acid-cysteine (His/Asp/Cys) motif, known as catalytic triad, comprised between the β sheets, wherein a histidine residue is used to activate the cysteine catalytic site by making it nucleophile.
[0087] As previously mentioned, an example of protease belonging to the family of peptidase C4 is represented by TEV protease, or Nuclear-inclusion-a endopeptidase (NIa).
[0088] In a preferred embodiment, the protein with inducible proteolytic activity according to any one of the herein described variants, comprises the polypeptide sequence of TEV protease having SEQ ID Nr. 3 or SEQ ID Nr. 4.
[0089] Depending upon if one wants to address the protease expression inside the cytosol or inside the secretory pathway, for example in the lumen of the endoplasmic reticulum (ER) of a cell, the polypeptide sequence of the protein with inducible proteolytic activity could comprise the sequence of a signal leader peptide known in the art, capable of transporting the protein attached thereto in the secretory pathway. Several signal leader sequences are known in the art and they could be selected by an expert skilled in the art depending upon protease and the target cell of interest.
[0090] In an embodiment of the invention, the protein with inducible proteolytic activity comprises the polypeptide sequence of TEV protease comprising the sequence of a signal leader peptide (sec) at the N-terminal end, having sequence MGWSLILLFLVAVATGVHS (SEQ ID Nr.: 11).
[0091] According to an aspect of the invention, the protein according to any one of the herein described embodiments can comprise one or more linker sequences for the bond between said protease and said activator-binding domain. Examples of linker sequences which can be used for the bond between the activator-binding domain and protease, include amino acid sequences having different length, for example comprising 1, 2, 3, 4, 5, or 6 amino acid residues. The most suitable linker length could be selected after experiments such as those reported in
[0092] According to an aspect of the invention, two identical linker molecules having a sequence selected among Gly-Gly-Ser-Gly-Gly-Gly (SEQ ID Nr.2), Gly-Gly-Ser or Gly can be bound at the two ends of the sequence of the activator-binding domain; the so-obtained sequence could be inserted within the peptide sequence of the protease of interest.
[0093] By means of this engineering, the protease could keep an effective and constant activity in presence of an activating agent, by offering, compared to the constitutively active counterpart, the possibility of controlling the processing of the substrate over time.
[0094] An additional aspect of the invention relates to a protein according to any one of the herein described embodiments, wherein said protease is TEV protease having SEQ ID Nr. 3 or SEQ ID Nr. 4. and wherein said domain is inserted between S120 and M121 residues with respect to SEQ ID Nr. 3 of said protease.
[0095] The protein with inducible activity according to any one of the previously described embodiments could include the polypeptide sequence of a protease characterized by the replacement and/or mutation of one or more amino acids with respect to the native acid sequence. Suitable replacements and/or mutations in the amino acid sequence of a protease are those aiming at: (1) incrementing the protease proteolytic activity, for example by speeding up the kinetics of proteolytic cleavage and/or (2) limiting the possibility of inactivating protease, for example due to N-glycosylation which typically takes place in ER lumen in mammal cells.
[0096] In a preferred embodiment, said protein having inducible proteolytic activity comprises the polypeptide sequence of a protease, wherein said protease is TEV protease having SEQ ID Nr. 3 or SEQ ID Nr. 4., and wherein in the sequence of said protease one or more of the following mutations: N23Q, T173G, C130S, 1138T, S153N and T180A with respect to the sequence of wild-type TEV protease (SEQ ID Nr. 3) are inserted. N23 and N171 glycosylation sites inactivate the enzyme, therefore N23Q and T173G mutations can be inserted at such sites to prevent N-glycosylation thereof. C130S mutation can be inserted to increase the proteolytic activity of TEV protease in ER lumen, as described in Casaratto et al. 2015 article.
[0097] The point-like mutations 1138T, S153N and T180A can be inserted in order to increase kinetics (k.sub.cat/K.sub.m) of engineered TEV proteolytic cleavage (unica-TEV/.sub.wtTEV=2.81) (Sanchez, M. I., & Ting, A. Y., 2019). These mutations are capable of making engineered TEV protease, the invention relates to, faster than the split-TEV or TEV wild type counterpart.
[0098] In a preferred embodiment of the present invention, said protein with inducible proteolytic activity has SEQ ID Nr. 5, and it is called “unimolecular chemical-activatable TEV”, abbreviated as “unica-TEV”.
[0099] As already mentioned, in order to address TEV protease expression in the secretory pathway, or in the lumen of endoplasmic reticulum (ER) of cells of interest, it is possible to insert the sequence of a signal leader peptide (sec) at the N-terminal end of the protein, for example a signal peptide having the sequence: MGWSLILLFLVAVATGVHS (SEQ ID Nr.: 11).
[0100] The invention also relates to a protein with inducible proteolytic activity according to any one of the preceding claims, having SEQ ID Nr. 6 and called “unica-sec-TEV”.
[0101] An additional aspect of the present invention relates to a nucleotide sequence codifying a protein with inducible proteolytic activity according to any one of the previously described embodiments. According to a preferred embodiment, said nucleotide sequence codifies a protein with inducible proteolytic activity having SEQ ID Nr. 5 (unica-TEV) or SEQ ID Nr. 6 (unica-sec-TEV). In an embodiment, said nucleotide sequence has SEQ ID Nr. 9 or SEQ ID Nr. 10.
[0102] The present invention further relates to a vector for the expression of a protein with inducible proteolytic activity comprising a nucleotide sequence according to any one of the herein described embodiments. Such vector could also include a nucleotide sequence according to any one of the previously described embodiments, operatively bound to one or more regulatory sequences (for example a promoter and/or a termination sequence), allowing to control the expression, or the transcription and translation, of a protein according to any one of the embodiments of the invention in a host cell.
[0103] According to an aspect of the invention, said vector could include una nucleotide sequence according to any one of the previously described embodiments, operatively bound to (i) one or more regulatory sequences as defined above and optionally (ii) one or more nucleotide sequences and/or gene constructs such as leader sequences, selection markers, expression markers or genes and/or elements which could increase or ease the vector transformation or integration in the host cell or organism.
[0104] Examples of vectors according to the invention include DNA or RNA molecules, preferably double-stranded DNA. Vectors suitable to be used according to the present invention include vectors in a form suitable to the transformation of the host cell or organism of interest, vectors in a form suitable for the integration within the genome DNA of the host cell or the organism of interest, or still in a form suitable for the autonomous replication inside the cell or organism of interest. In particular, such vector can be a plasmid, a cosmid, YAC, a viral or transposon vector. Examples of viral vectors suitable to be used in the present description include retrovirus, adenovirus, herpes simplex, vaccine virus, and adeno-associated viruses.
[0105] A person skilled in the art, depending upon the cells and the organism of interest, will have sufficient information in the art to select the optimum vector for the wished application.
[0106] The present invention further relates to the proteins, genes and vectors described herein according to any one of the embodiments for use in a treatment method, in particular for use in a treatment method by controlling the maturation of a disease-associated protein.
[0107] The present invention further relates to the use of a protein with inducible proteolytic activity according to any one of the herein described embodiments for controlling the maturation in a cell of a protein subject to proteolytic cleavage.
[0108] According to an aspect of the invention, said protein with inducible proteolytic activity can be used for controlling the maturation of a protein subject to proteolytic cleavage in the cytosol or in other secretory pathways within a cell, for example in ER lumen of a cell.
[0109] Examples of proteins subjected to a proteolytic cleavage according to the invention, include any protein inside thereof the cleavage sequence by endogenous proteases has been changed and/or replaced by a cleavage sequence which could be recognized specifically by the protease with inducible proteolytic activity the invention relates to.
[0110] According to an embodiment, said protein subject to proteolytic cleavage is BDNF, and in particular its pro-BDNF precursor. In a preferred embodiment, said protein subject to proteolytic cleavage is pro-BDNF inside thereof the sequence of recognition by furin/serin has been replaced with the cleavage sequence of TEV protease (TEVcs, ENLYFQ, SEQ ID Nr.: 12). By way of example, said protein subject to proteolytic cleavage can be proBDNF protein codified by a mRNA having a sequence identifiable in Genback data bank by means of the following codes: M61175, M61176 or X55573, wherein the residues of recognition by furin and plasmin (MRVRRH) have been changed with TEV cleavage sequence (ENLYFQ, SEQ ID Nr.: 12). As it is clear from the results of the Western Blot and immunofluorescence experiments shown in
[0111] Other not limiting example of proteins subjected to proteolytic cleavage include proteins which are subjected to proteolytic maturation, such as ADAM10, pro-insulin, pro-interleukin-1β, pro-orexin or many proenzymes, come for example pro-caspase, angiotensinogen, trypsinogen or plasminogen.
[0112] The invention further relates to the use of a protein with inducible proteolytic activity according to any one of the herein described embodiments in a purification process of recombinant proteins.
[0113] According to an aspect of the invention, such recombinant proteins include proteins subjected to proteolytic cleavage selected among those mentioned previously, inside thereof, for example, the cleavage sequence by endogenous proteases has been changed and/or replaced with a cleavage sequence specific for the recognition by the protease inducible the present invention relates to. The sequence of such recombinant proteins could preferably comprise a marker element, for example an affinity tag such as FLAG-tag, His-tag, strep-tag, tag-epitope or the like which allows the purification thereof by using an affinity technique. In this way, consequently to the maturation of the protein of interest thanks to the addition of an activating agent of protease with inducible proteolytic activity (for example, rapamycin), it will be possible to purify the protein of interest by affinity technique, for example by immunoprecipitation, by using a reagent capable of recognizing and/or binding said affinity tag.
[0114] An additional aspect of the invention relates to a method for controlling the maturation in a cell of a protein subject to proteolytic cleavage comprising the following steps of: [0115] a) Co-expressing in a cell a protein with inducible proteolytic activity according to any one of the previously described embodiments and a protein subject to proteolytic cleavage; [0116] b) Incubating said cell with the activator of said protein with proteolytic activity in order to induce the maturation of said protein.
[0117] According to an aspect of the invention, said protein subject to proteolytic cleavage is a protein inside thereof the original cleavage sequence by endogenous protease is changed and/or replaced by a specific cleavage sequence which can be recognized by the protein with inducible proteolytic activity the invention relates to.
[0118] According to a preferred embodiment, in said method, said protein subject to proteolytic cleavage is BDNF, and in particular proBDNF wherein the residues of recognition by furin and plasmin (MRVRRH) have been changed with TEV cleavage sequence (ENLYFQ, SEQ ID Nr.: 12). By way of example, in said method, said protein subject to proteolytic cleavage can be proBDNF protein codified by a mRNA having a sequence identifiable in data bank Genback by means of the following codes: M61175, M61176 o X55573, wherein the residues of recognition by furin and plasmin (MRVRRH) have been changed with TEV cleavage sequence (ENLYFQ, SEQ ID Nr.: 12).
[0119] According to an aspect of the invention, such step a) can be performed by using any technique comprised in the state of art in the field of cell biology, cell culture, gene engineering, or the like, as well as by using any of the previously described nucleotide sequences or vectors. Preferably, according to an aspect of the invention, in said method, said cell is a mammal cell.
[0120] As the features of the protein with used inducible proteolytic activity are known, the person skilled in the art could use in step b) of the herein described method an adequate activating compound selected among the previously described compounds.
[0121] According to an additional aspect of the invention, said method comprises an additional step c) of detecting the mature shape of said protein obtainable with step b). Such detection can be performed by using any technique known in the art, for example by means of electrophoretic assay, immuno-enzymatic assay, colorimetric assay.
[0122] According to a preferred embodiment, such step c) of detecting the mature protein can be performed by means of electrophoretic analysis on gel of SDS-polyacrylamide.
[0123] The invention also relates to a protein o nucleotide sequence or vector according to any one of the herein described embodiments for use in a treatment method, in particular for use in a treatment method for controlling the maturation of a disease-associated protein.
EXAMPLES
[0124] Materials and Methods
[0125] The methods for obtaining engineered TEV as well as its functional validation comprise: [0126] Use of specific sets of primers described in the section “List of sequences”; [0127] Cloning plasmids and mutagenesis by “QuikChange site-directed mutagenesis kit” of Agilent Technologies, Inc; [0128] Polymerase chain reaction (PCR); [0129] Transformation of competent cells; [0130] DNA sequencing; [0131] Transfection of heterologous cells; [0132] Enzymatic reaction; [0133] Western blot.
[0134] In the specific case, for each mutagenesis the following protocol was used: [0135] 1) Add 35.5 μl of bi-distilled H.sub.2O 5 μl of 10× reaction buffer (Agilent Technologies); 5 μl dNTP mix (stock 10 mM); 1.25 μl primer forward (stock 20 μM); 1.25 μl primer reverse (stock 20 μM); 1 μl of plasmid 0.1 μg/μl; 1 μl of PfuTurbo DNA polymerase (Agilent Technologies); [0136] 2) PCR: [0137] a) 95° C. for 30 s; [0138] b) 95° C. for 30 s; [0139] c) 55° C. for 60 s; [0140] d) 72° C. for 1 min/kb of plasmid; [0141] Repeat b, c, d for 16 cycles; [0142] 3) Add 1 μl of Dpnl restriction endonuclease (Agilent Technologies) and incubate at 37° C. for 1 h; [0143] 4) Use 2 μl of final solution to transform the competent cells; [0144] 5) Select some colonies, extract the plasmid and sequencing.
[0145] In order to engineer each one of the two TEVs and insert “UniRapR” construct, Gibson Assembly was performed. At first 2 distinct PCRs were performed: [0146] 6) In the first PCR the solution 1) was used, with specific primers, with TEV template DNA and following reaction conditions: [0147] a) 95° C. for 30 s; [0148] b) 95° C. for 30 s; [0149] c) 66° C. for 60 s; [0150] d) 72° C. for 1 min/kb of plasmid; [0151] Repeat b, c, d for 25 cycles; [0152] 7) In the second PCR the solution 1) was used, with specific primers, with UniRapR template DNA with the following reaction conditions: [0153] e) 95° C. for 30 s; [0154] f) 95° C. for 30 s; [0155] g) 72° C. for 60 s; [0156] h) 72° C. for 1 min/kb of plasmid; [0157] Repeat b, c, d for 25 cycles; [0158] 8) Load part of PCR product with 0.7% agarose gel and separate DNA by electrophoresis with the purpose of evaluating the amplification quality; [0159] PCR products are 6783 bp for open TEV plasmid, 6213 bp for open sec-TEV plasmid and ˜600 for UniRapR fragment to be inserted. [0160] 9) Add 1 μl of Dpnl restriction endonuclease (Agilent Technologies) and incubate at 37° C. for 1 h; [0161] 10) Prepare Gibson Assembly reaction; add 6 μl of bi-distilled H.sub.2O 2 μl of PCR amplification coming from TEV plasmid and 2 μl of PCR amplification coming from the amplified UniRap fragment. Add the so-obtained 10 μl to Master Mix Gibson Assembly (Gibson Assembly® Cloning Kit, NEB). Incubate 1 h at 50° C. [0162] 11) Use 2 μl of the final solution to transform the competent cells; [0163] 12) Select some colonies, extract the plasmid and sequencing;
[0164] Enzymatic Activity of Unica-TEV in Vital Cells [0165] 13) Use CFP-TEVcs-YFP synthetic recombinant protein as substrate;
[0166] This artificial construct has two fluorophores conjugated by the cleavage sequence recognized by TEV (TEVcs). AntiGFP (Biolegend) antibody was used to verify cleavage of CFP-TEVcs-YFP by unica-TEV.
[0167] In order to do it, HEK293T cells were transfected (PEI MAX—Polysciences, Inc.) with the plasmids codifying constitutively active wild-type TEV (pcDNA-TEV), and engineered TEV with UniRapR (pcDNA-unica-TEV) and left to grow for 24-48 h at 37° C., 5% CO.sub.2.
[0168] For both of them, CFP-TEVcs-YFP was co-transfected.
[0169] After 24h the cells were treated for 1-3 h with rapamycin (1 μM) or DMSO as control. The cells were washed with cold PBS and lysed with lysis buffer containing rapamycin (1 μM) or DMSO. 10% of the volume of samples was prepared (addition of 2× Laemmli protein sample buffer+boiling for 5 min) for the electrophoretic analysis on gel of SDS-polyacrylamide.
[0170] Enzymatic activity of unica-secTEV in vital cells Use pro-TEVcs-BDNF human recombinant as substrate;
[0171] ProBDNF was mutagenized with the purpose of having, instead of canon cleavage sequence (MRVRRH) the cleavage sequence (TEVcs) recognized by TEV (ENLYFQ). AntiHA (Biolegend) antibody was used to verify pro-TEVcs-BDNF cleavage in mature BDNF by unica-TEV.
[0172] In order to do it, HEK293T cells were transfected (PEI MAX—Polysciences, Inc.) with the plasmids which codify for constitutively active wild type TEV (pcDNA-secTEV-SV5), and engineered unica-TEV (pcDNA-unica-secTEV-SV5) and left to grow for 24-48 h at 37° C., 5% CO.sub.2.
[0173] For both of them pro-TEVcs-BDNF (HA-pro-TEVcs-BDNF-Flag-SEP) was co-transfected.
[0174] After 24h the cells were then treated for 1-3 h with rapamycin (1 μM) or DMSO as control. The cells were washed with cold PBS and lysed with lysis buffer containing rapamycin (1 μM) or DMSO. 10% of volume of samples was prepared (addition of 2× Laemmli protein sample buffer+boiling for 5 min) for the electrophoretic analysis on gel of SDS-polyacrylamide.
[0175] Production of Purified BDNF
[0176] HEK293T cells were transfected (PEI MAX—Polysciences, Inc.) with the plasmids codifying for unica-secTEV (pcDNA-unica-secTEV-SV5) and pro-TEVcs-BDNF (HA-pro-TEVcs-BDNF-Flag-SEP) and left for 24 h at 37° C., 5% CO.sub.2.
[0177] After 24 h the cells were treated for 1-3 h with rapamycin (1 μM) or DMSO as control. The cells were washed with cold PBS and lysed with lysis buffer containing rapamycin (1 μM) or DMSO. The lysate was immunoprecipitated with FLAG-M2-beads for 1 h and subsequently FLAG peptide (sigma F3290-4 mg) was added. After 1 h the beads were removed by Micro bio-spin Colums®—Bio-Rad. The eluted protein was kept at −20° C. Once quantified by commercially available ELISA kits its biological effect was tested as described in
Example 1—Determination of Activity of Unica-TEV in HEK293T Cells
[0178] A system was used based upon the expression of a fluorophore after nuclear translocation of a transactivator sequestered on the plasmatic membrane by a TEV recognition site (TEVcs).
[0179] In particular, the inventors made to express in HEK293T cells a “tetracycline operator EGFP conjugated” (tetO-EGFP) and a synthetic protein consisting of a transactivator controlled by tetracycline (tTA), bound to a transmembrane domain (TMD) through a TEV recognition site (TEVcs) (TMD-TEVcs-tTA) (
[0180] The activation of uniRapR (also called: unica-TEV) mediated by rapamycin split tTA which translocated into the nucleus and started the EGFP expression. Twenty-four hours later a robust increase in the EGFP expression was noted in HEK293T cells treated with rapamycin and transfected with all unica-TEV constructs (
[0181] As already mentioned, the background activity of the system based upon split TEV is a known problem in literature, so much so that in order to mitigate the background activity of fragmented TEV it was necessary, for example, to mask TEV recognition sequence (TEVcs) with AsLOV2 (Jα-helix of Avena sativa phototropin 1 light-oxygen-voltage 2 domains) which is released only after exposition to blue light. Lee and colleagues evaluated the operation of the system based upon C-TEV/N-TEV/AsLov2 on EGFP gene expression (
[0182] In case of the present invention, the only application of permeable molecules (rapamycin) allows to obtain the transactivator cleavage, whereas in case of NL construct (no linker), in absence of activator, EGFP expression is almost wholly absent by confirming that the new single-peptide chain engineered TEV exceeds the limits of background activity of the system based upon C-TEV/N-TEV.
Example 2—Application of Engineered TEV System for Inducible BDNF Maturation
[0183] The secreted proteolytic splitting products, as pre-proproteins, are synthetized on the rough endoplasmic reticulum (ER). The pre-sequence peptide directs the synthesis of pro-proteins towards ER wherein the peptide pre- is split immediately. Then the pro-proteins translocate from Golgi apparatus to trans-Golgi network (TGN) wherein the pro-domain is separated to provide the mature products. From TGN, the mature products can be released continuously in absence of any triggering stimulus or released in response to extra-cell triggering events raising the Ca2+ intracellular concentration. For example, BDNF is released continuously by TGN with small vesicle granules in Ca2+-independent mode, but it can even be released by bigger vesicles on inflow of Ca2+ induced by neuronal depolarization. The mature BDNF is produced by proBDNF proteolytic splitting, catalyzed along the secretory route by protease Furin/proprotein convertasi 1/3 (PC1/3), and at extracellular level through the tissue activator of plasminogen (tPA)/cascade of plasminogen. By activating the tropomyosin kinase-B (TrkB) receptors, BDNF plays a key role in the formation and maturation of synapses, in synaptic plasticity, in survival and differentiation of neural staminal cells. In order to make BDNF maturation inducible, TEVcs was inserted in proBDNF sequence by replacing Furin/Plasmin splitting site (
[0184] The expression levels of this proBDNF inserted with TEVcs (pro-TEVcs-BDNF) were similar to those of wild-type (wt) proBDNF, by suggesting that this replacement of small sequences does not influence on the protein production and degradation (
[0185] Then, unica-TEV capability of splitting pro-TEVcs-BDNF in rapamycin-dependent mode was evaluated. As provided, nor unica-TEV in presence of rapamycin, nor an active mutating form of TEV, split pro-TEVcs-BDNF in the living cells (that is HEK293T) due to the cytosolic localization of TEV protease (
[0186] However, by performing an in vitro protease test after immunoprecipitation of pro-TEVcs-BDNF and of unica-TEV in presence of rapamycin, SDS-PAGE migration of pro-peptide was noted (
[0187] These data showed unica-TEV capability of cleaving pro-TEVcs-BDNF, by confirming that the splitting in the living cells depends upon the different localization of pro-TEVcs-BDNF and upon the engineered protease.
[0188] In order to make unica-TEV functionally active along the secretion route of the mammal cells (unica-secTEV), the secretion signal was added to the N-terminal and three mutations were introduced as described in the preceding experimental sections. When HEK293T cells expressing unica-secTEV and pro-TEVcs-BDNF were treated with rapamycin, a 41-kDa band was noted designating BDNF maturation in the living cells (
[0189] In order to evaluate if mature BDNF obtained after activation of unica-secTEV was able to bind and activate its TrkB endogenous target receptor, pro-TEVcs-BDNF was expressed, unica-secTEV with TrkB-mGFP. The chemogenetic activation of unica-secTEV led to a clear increase in the kinase phosphorylation regulated by the endogenous extracellular signal (ERK) (
[0190] In order to test the biological activity of mature BDNF obtained with the chemogenetic strategy in neurons, BDNF was immunoprecipitated and purified by HEK293T cells co-transfected with unica-secTEV and treated with rapamycin. The hippocampus organo-typical sections treated for 30 minutes with this purified mature BDNF showed a significant increase in ERK phosphorylation signals (
[0191] These data showed that BDNF spontaneous release induced an autocrine trophic effect in CA1 pyramidal neurons independently from the induction of synaptic plasticity. A new strategy was then generated allowing a complete splitting of the proteins of interest in the subcellular compartments, which allowed us to create and test in an inducible way proteolytical splitting products.
Example 3—Application of Engineered TEV System for ADAM10 Activation
[0192] The previously illustrated strategy was applied by the authors of the present invention even to other target proteins. Thereamong, ADAM10 disintegrin-metalloproteinase which stands out as particularly critical neuronal protein since it catalyses the non-amyloidogenic splitting of the amyloid precursor protein (APP) by α-secretase critically involved in the pathogenesis of Alzheimer's disease. In line with the previously illustrated strategy, the inventors devised ADAM10 by replacing its endogenous protease sequence with TEV recognition site (TEVcs). This change led to ADAM10 activation mediated by engineered TEV of the invention in the living cells without influencing ADAM10 expression. The capability of the so-obtained mutating ADAM 10 to be controlled space-temporally by using betacellulin (ADAM10 substrate) bound to an alkaline phosphatase (AP) was demonstrated. The activation of single-chain engineered TEV protease according to the present invention, in the secretory pathway, induced the selective cleavage of betacellulin and AP release from HEK293T cells which reflects the capability of the herein proposed strategy of controlling ADAM10 activity (
LIST OF SEQUENCES IN THE DESCRIPTION
[0193]
TABLE-US-00001 SEQ ID Nr.: 1 Peptide sequence of activator-binding domain TCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGA TGHGSGSGSGVKDLLQAWDLYYHVFRRISGPPGPGSGLWHEMWHEGLEEASRLYFGERNVKG MFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGSSGGSGSGIIPPHATLVF DVELLKLE SEQ ID Nr.: 2 Peptide sequence of a linker molecule GGSGGG SEQ ID Nr.: 3 Peptide sequence of wild-type TEV protease GESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVK NTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPS SDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWW SGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMN SEQ ID Nr.: 4 Peptide sequence of sec-TEV protease MGWSLILLFLVAVATGVHSQGESLFKGPRDYNPISSTICHLTQESDGHTTSLYGIGFGPFIITNKHLF RRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTN FQTKSMSSMVSDTSSTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFGNTNNYFT SVPKNFMELLTNQEAQQWSGWRLNADSVLWGGHKVFMSKPEEPFQPVKEATQLMNEGGLE SEQ ID Nr.: 5 Peptide sequence of unica-TEV engineered protease GESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVK NTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSGGSTCVVHYTGML EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHGSGSGS GVKDLLQAWDLYYHVFRRISGPPGPGSGLWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHA MMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGSSGGSGSGIIPPHATLVFDVELLKLEGG SMSSMVSDTSCTFPSSDGTFWKHWIQTKDGQCGNPLVSTRDGFIVGIHSASNFTNTNNYFASVP KNFMELLTNQEAQQWWSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMN SEQ ID Nr.: 6 Peptide sequence of unica-sec-TEV engineered protease MGWSLILLFLVAVATGVHSQGAQGESLFKGPRDYNPISSTICHLTQESDGHTTSLYGIGFGPFIITN KHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICL VTTNFQTKSGGSTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQR AKLTISPDYAYGATGHGSGSGSGVKDLLQAWDLYYHVFRRISGPPGPGSGLWHEMWHEGLEEA SRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGSSGG SGSGIIPPHATLVFDVELLKLEGGSMSSMVSDTSSTFPSSDGTFWKHWIQTKDGQCGNPLVSTRD GFIVGIHSASNFGNTNNYFASVPKNFMELLTNQEAQQWWSGWRLNADSVLWGGHKVFMSKPEE PFQPVKEATQLMNEGGLE SEQ ID Nr.: 7 Nucleotide sequence of wild-type TEV protease ATGGGAGAAAGCTTGTTTAAGGGGCCGCGTGATTACAACCCGATATCGAGCACCATTTGTCAT TTGACGAATGAATCTGATGGGCACACAACATCGTTGTATGGTATTGGATTTGGTCCCTTCATC ATTACAAACAAGCACTTGTTTAGAAGAAATAATGGAACACTGTTGGTCCAATCACTACATGGTG TATTCAAGGTCAAGAACACCACGACTTTGCAACAACACCTCATTGATGGGAGGGACATGATAA TTATTCGCATGCCTAAGGATTTCCCACCATTTCCTCAAAAGCTGAAATTTAGAGAGCCACAAAG GGAAGAGCGCATATGTCTTGTGACAACCAACTTCCAAACTAAGAGCATGTCTAGCATGGTGTC AGACACTAGTTGCACATTCCCTTCATCTGATGGTATATTCTGGAAGCATTGGATTCAAACCAAG GATGGGCAGTGTGGCAGTCCATTAGTATCAACTAGAGATGGGTTCATTGTTGGTATACACTCA GCATCGAATTTCACCAACACAAACAATTATTTCACAAGCGTGCCGAAAAACTTCATGGAATTGT TGACAAATCAGGAGGCGCAGCAGTGGGTTAGTGGTTGGCGATTAAACGCTGACTCAGTATTG TGGGGGGGCCATAAAGTTTTCATGGTGAAACCTGAAGAACCTTTTCAGCCAGTTAAGGAAGC GACTCAACTCATGAAT SEQ ID Nr.: 8 Nucleotide sequence of sec-TEV protease ATGGGCTGGAGCCTGATCCTCCTGTTCCTCGTCGCTGTGGCTACAGGTGTGCACTCTCAGatg GGGGAAAGCCTGTTCAAGGGACCAAGGGACTACAATCCAATCTCCTCAACTATCTGCCACCT GACTcAgGAAAGCGACGGACATACCACATCTCTGTACGGAATTGGCTTCGGGCCCTTCATCAT TACTAACAAGCACCTGTTTCGGAGAAACAATGGCACCCTGCTGGTGCAGAGTCTGCACGGGG TGTTCAAGGTCAAAAATACTACCACACTGCAGCAGCATCTGATTGACGGACGAGATATGATCA TTATCCGGATGCCAAAGGACTTCCCCCCTTTTCCCCAGAAGCTGAAGTTCCGGGAGCCCCAG AGGGAGGAACGCATCTGCCTGGTGACTACCAACTTCCAGACCAAATCCATGAGCTCCATGGT CTCCGACACCTCTTcTACATTCCCTTCTAGTGATGGCATCTTCTGGAAGCACTGGATCCAGAC AAAAGACGGACAGTGCGGCAGTCCACTGGTGTCAACCAGAGATGGGTTTATTGTCGGAATCC ATTCAGCCAGCAACTTCggAAATACTAACAATTACTTCACCTCTGTGCCCAAAAACTTCATGGA GCTGCTGACTAATCAGGAAGCACAGCAGTGGGTGAGCGGATGGCGCCTGAATGCTGATTCC GTGCTGTGGGGCGGGCATAAGGTCTTCATGAGCAAACCTGAAGAGCCATTTCAGCCCGTCAA GGAAGCCACCCAGCTGATGAaCGAAggGGgCctggaA SEQ ID Nr.: 9 Nucleotide sequence of unica-TEV engineered protease ATGGGAGAAAGCTTGTTTAAGGGGCCGCGTGATTACAACCCGATATCGAGCACCATTTGTCAT TTGACGAATGAATCTGATGGGCACACAACATCGTTGTATGGTATTGGATTTGGTCCCTTCATC ATTACAAACAAGCACTTGTTTAGAAGAAATAATGGAACACTGTTGGTCCAATCACTACATGGTG TATTCAAGGTCAAGAACACCACGACTTTGCAACAACACCTCATTGATGGGAGGGACATGATAA TTATTCGCATGCCTAAGGATTTCCCACCATTTCCTCAAAAGCTGAAATTTAGAGAGCCACAAAG GGAAGAGCGCATATGTCTTGTGACAACCAACTTCCAAACTAAGAGCggtggatcaacctgcgtggtgcac tacaccgggatgcttgaagatggaaagaaatttgattcctcccgggacagaaacaagccctttaagtttatgctaggcaagcaggaggtg atccgaggctgggaagaaggggttgcccagatgagtgtgggtcagagagccaaactgactatatctccagattatgcctatggtgccact gggcacggttcgggctccggatcaggcgtcaaggacctcctccaagcctgggacctctattatcatgtgttccgacgaatctcaggtcctcc aggacctggatcaggtctctggcatgagatgtggcatgaaggcctggaagaggcatctcgtttgtactttggggaaaggaacgtgaaagg catgtttgaggtgctggagcccttgcatgctatgatggaacggggcccccagactctgaaggaaacatcctttaatcaggcctatggtcga gatttaatggaggcccaagagtggtgcaggaagtacatgaaatcagggtcatcagggggctccggatcaggcatcatcccaccacatg ccactctcgtcttcgatgtggagcttctaaaactggaaggtggatcaATGTCTAGCATGGTGTCAGACACTAGTTGCA CATTCCCTTCATCTGATGGTACGTTCTGGAAGCATTGGATTCAAACCAAGGATGGGCAGTGTG GCAATCCATTAGTATCAACTAGAGATGGGTTCATTGTTGGTATACACTCAGCATCGAATTTCAC CAACACAAACAATTATTTCGCAAGCGTGCCGAAAAACTTCATGGAATTGTTGACAAATCAGGA GGCGCAGCAGTGGGTTAGTGGTTGGCGATTAAACGCTGACTCAGTATTGTGGGGGGGCCAT AAAGTTTTCATGGTGAAACCTGAAGAACCTTTTCAGCCAGTTAAGGAAGCGACTCAACTCATG AAT SEQ ID Nr.: 10 Nucleotide sequence of unica-sec-TEV engineered protease ATGGGCTGGAGCCTGATCCTCCTGTTCCTCGTCGCTGTGGCTACAGGTGTGCACTCTCAGGG CGCGCAAGGGGAAAGCCTGTTCAAGGGACCAAGGGACTACAATCCAATCTCCTCAACTATCT GCCACCTGACTcAgGAAAGCGACGGACATACCACATCTCTGTACGGAATTGGCTTCGGGCCCT TCATCATTACTAACAAGCACCTGTTTCGGAGAAACAATGGCACCCTGCTGGTGCAGAGTCTGC ACGGGGTGTTCAAGGTCAAAAATACTACCACACTGCAGCAGCATCTGATTGACGGACGAGAT ATGATCATTATCCGGATGCCAAAGGACTTCCCCCCTTTTCCCCAGAAGCTGAAGTTCCGGGAG CCCCAGAGGGAGGAACGCATCTGCCTGGTGACTACCAACTTCCAGACCAAATCCggtggatcaac ctgcgtggtgcactacaccgggatgcttgaagatggaaagaaatttgattcctcccgggacagaaacaagccctttaagtttatgctaggc aagcaggaggtgatccgaggctgggaagaaggggttgcccagatgagtgtgggtcagagagccaaactgactatatctccagattatg cctatggtgccactgggcacggttcgggctccggatcaggcgtcaaggacctcctccaagcctgggacctctattatcatgtgttccgacga atctcaggtcctccaggacctggatcaggtctctggcatgagatgtggcatgaaggcctggaagaggcatctcgtttgtactttggggaaag gaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacggggcccccagactctgaaggaaacatcctttaatca ggcctatggtcgagatttaatggaggcccaagagtggtgcaggaagtacatgaaatcagggtcatcagggggctccggatcaggcatc atcccaccacatgccactctcgtcttcgatgtggagcttctaaaactggaaggtggatcaATGAGCTCCATGGTCTCCGACA CCTCTTcTACATTCCCTTCTAGTGATGGCAcCTTCTGGAAGCACTGGATCCAGACAAAAGACG GACAGTGCGGCAaTCCACTGGTGTCAACCAGAGATGGGTTTATTGTCGGAATCCATTCAGCCA GCAACTTCggAAATACTAACAATTACTTCgCCTCTGTGCCCAAAAACTTCATGGAGCTGCTGAC TAATCAGGAAGCACAGCAGTGGGTGAGCGGATGGCGCCTGAATGCTGATTCCGTGCTGTGG GGCGGGCATAAGGTCTTCATGAGCAAACCTGAAGAGCCATTTCAGCCCGTCAAGGAAGCCAC CCAGCTGATGAaCGAAggGGgCctggaA SEQ ID Nr.: 11 Peptide sequence of the signal leader peptide MGWSLILLFLVAVATGVHS SEQ ID Nr.: 12 Cleavage peptide sequence of TEV protease ENLYFQ
[0194] List of Primers Used to Implement Mutageneses
TABLE-US-00002 SEQ ID Nr.: 13 Nucleotide sequence of primer RV TEV_I138T CCAATGCTTCCAGAACGTACCATCAGATGAAGGGAATGTGCAA SEQ ID Nr.: 14 Nucleotide sequence of primer FW TEV_I138T TTGCACATTCCCTTCATCTGATGGTACGTTCTGGAAGCATTGG SEQ ID Nr.: 15 Nucleotide sequence of primer RV TEV_S153N TTGATACTAATGGATTGCCACACTGCCCATCCTTG SEQ ID Nr.: 16 Nucleotide sequence of primer FW TEV_S153N CAAGGATGGGCAGTGTGGCAATCCATTAGTATCAA SEQ ID Nr.: 17 Nucleotide sequence of primer RV TEV_T180A GTTTTTCGGCACGCTTGCGAAATAATTGTTTGTGTTGGTGAA SEQ ID Nr.: 18 Nucleotide sequence of primer FW TEV_T180A TTCACCAACACAAACAATTATTTCGCAAGCGTGCCGAAAAAC SEQ ID Nr.: 19 Nucleotide sequence of primer RV secTEV_I138T CCAGTGCTTCCAGAAGGTGCCATCACTAGAAGG SEQ ID Nr.: 20 Nucleotide sequence of primer FW secTEV_I138T CCTTCTAGTGATGGCACCTTCTGGAAGCACTGG SEQ ID Nr.: 21 Nucleotide sequence of primer RV secTEV_S153N GACACCAGTGGATTGCCGCACTGTCCGTC SEQ ID Nr.: 22 Nucleotide sequence of primer FW secTEV_S153N GACGGACAGTGCGGCAATCCACTGGTGTC SEQ ID Nr.: 23 Nucleotide sequence of primer RV secTEV_T180A GTTTTTGGGCACAGAGGCGAAGTAATTGTTAGTATTTCCGA SEQ ID Nr.: 24 Nucleotide sequence of primer FW secTEV_T180A TCGGAAATACTAACAATTACTTCGCCTCTGTGCCCAAAAAC SEQ ID Nr.: 25 Nucleotide sequence of primer FW pro-TEVcs-BDNF (MRV.fwdarw.ENL) gggtcagagtggcgccggagattctcggacatgtttgcagcatct SEQ ID Nr.: 26 Nucleotide sequence of primer RV pro-TEVcs-BDNF (MRV.fwdarw.ENL) agatgctgcaaacatgtccgagaatctccggcgccactctgaccc SEQ ID Nr.: 27 Nucleotide sequence of primer FW pro-TEVcs-BDNF (RRH.fwdarw.YFQ) ccctcggcgggcagggtcagactggaaatagagattctcggacatgtttgc SEQ ID Nr.: 28 Nucleotide sequence of primer RV pro-TEVcs-BDNF (RRH.fwdarw.YFQ) gcaaacatgtccgagaatctctatttccagtctgaccctgcccgccgaggg
[0195] Primers Used for Gibson Assembly Reaction
TABLE-US-00003 SEQ ID Nr.: 29 Nucleotide sequence of primer FW Inserto_TEV-UniRap CAACTTCCAAACTAAGAGCGGTGGATCAACCTGCGTGG SEQ ID Nr.: 30 Nucleotide sequence of primer RV Inserto_TEV-UniRap TGACACCATGCTAGACATTGATCCACCTTCCAGTTTTAGAAGCT SEQ ID Nr.: 31 Nucleotide sequence of primer FW Open_TEV120/121 ATGTCTAGCATGGTGTCAGACACTAG SEQ ID N.: 32 Nucleotide sequence of primer RV Open_TEV120/121 GCTCTTAGTTTGGAAGTTGGTTGT SEQ ID Nr.: 33 Nucleotide sequence of primer FW Inserto_SecTEV-UniRap CCAACTTCCAGACCAAATCCGGTGGATCAACCTGCGTGGTGCACTACACCGG SEQ ID Nr.: 34 Nucleotide sequence of primer RV Inserto_SecTEV-UniRap TGACACCATGCTAGACATTGATCCACCTTCCAGTTTTAGAAGCT SEQ ID Nr.: 35 Nucleotide sequence of primer FW Open_SecTEV120/121 ATGAGCTCCATGGTCTCCGACAC SEQ ID Nr.: 36 Nucleotide sequence of primer RV Open_SecTEV120/121 GGATTTGGTCTGGAAGTTGGTAG