A MOLECULAR STRATEGY TO PROTECT AGAINST DESICCATION
20230287059 · 2023-09-14
Inventors
Cpc classification
C07K14/212
CHEMISTRY; METALLURGY
C12N15/8201
CHEMISTRY; METALLURGY
International classification
Abstract
A composition, transgenic organism, and method of protecting against desiccation or heat are provided. The composition includes a DtpA protein or complement thereof and a heterologous biologic. The transgenic organism includes the nucleic acid sequence according to SEQ ID NO: 1. The method includes contacting a heterologous biologic or organism with a DtpA protein and/ or a complement thereof.
Claims
1. A composition, comprising: a DtpA protein or complement thereof; and a heterologous biologic.
2. The composition of claim 1, wherein the DtpA protein is encoded by the sequence according to SEQ ID NO: 1.
3. The composition of claim 2, wherein the complement comprises at least 80% sequence identity to SEQ ID NO: 1.
4. The composition of claim 2, wherein the complement includes one or more mutations in a disordered part of the protein.
5. The composition of claim 4, wherein the disordered part of the protein includes amino acids 26-411.
6. The composition of claim 1, wherein the composition is solid.
7. The composition of claim 1, wherein the composition is liquid.
8. The composition of claim 1, wherein the heterologous biologic is selected from the group consisting of enzymes, food, vaccines, heterologous polypeptides, heterologous proteins, and combinations thereof.
9. The composition of claim 1, wherein the DtpA protein or complement thereof is recombinantly added to the heterologous biologic.
10. The composition of claim 1, wherein the DtpA protein or complement thereof is exogenously added to the heterologous biologic.
11. A transgenic organism comprising the nucleic acid sequence according to SEQ ID NO: 1.
12. The transgenic organism of claim 11, wherein the organism is a heterologous cell.
13. The transgenic organism of claim 12, wherein the heterologous cell is a plant cell.
14. The transgenic organism of claim 12, wherein the heterologous cell is an animal cell.
15. The transgenic organism of claim 11, wherein the organism is a heterologous organism.
16. The transgenic organism of claim 11, wherein the heterologous organism is a bacterium.
17. The transgenic organism of claim 11, wherein the heterologous organism is a tissue or organ.
18. The transgenic organism of claim 11, wherein the heterologous organism is a plant.
19. A method of protecting against desiccation or heat, the method comprising contacting a heterologous biologic or organism with a DtpA protein and/or a complement thereof.
20. The method of claim 19, wherein the DtpA protein is encoded by the sequence according to SEQ ID NO: 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014] The presently-disclosed subject matter will be better understood, and features, aspects and advantages other than those set forth above will become apparent when consideration is given to the following detailed description thereof. Such detailed description makes reference to the following drawings, wherein:
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039] While the disclosure is susceptible to various modifications and alternative forms, specific embodiments thereof have been shown by way of example in the drawings and are herein described below in detail. It should be understood, however, that the description of specific embodiments is not intended to limit the disclosure to cover all modifications, equivalents and alternatives falling within the spirit and scope of the disclosure as defined by the appended claims.
BRIEF DESCRIPTION OF THE SEQUENCES
[0040] TABLE-US-00001 SEQ ID NO: 1 is an amino acid sequence for DtpA -M ANTRYEDDNNSSGTSNRGFASMDPERVREIASKGGRAAHASGNAHEFTSE EAREAGRAAHASGNAHEFTSEEAREAGALSHKNDDRNGRGRSRYDDDEDD DRGRSSGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRDDDDEDDDRGRSGG RGRGRSRDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGRGRSR RDDDDEDDDRGRSGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDE DDERGRSGGRGRGRSRRDDDDEDDERGRSGGRGRGRSRYDDDDEDDDRGR SGGRGRGRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDEDDDRGRSGGRGR GRSRYDDDDEDDDRGRSGGRGRGRSRRDDDDDDDDRRGRSDGRGQNSRNQ KRDAYGRFTS.
Definitions
[0041] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure belongs. Any methods and materials similar to or equivalent to those described herein can be used in the practice or testing of the present disclosure, including the methods and materials are described below.
[0042] Following long-standing patent law convention, the terms “a,” “an,” and “the” refer to “one or more” when used in this application, including the claims. Thus, for example, reference to “a cell” includes a plurality of cells, and so forth.
[0043] The terms “comprising,” “including,” and “having” are intended to be inclusive and mean that there may be additional elements other than the listed elements.
[0044] Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless indicated to the contrary, the numerical parameters set forth in this specification and claims are approximations that can vary depending upon the desired properties sought to be obtained by the presently-disclosed subject matter.
[0045] As used herein, the term “about,” when referring to a value or to an amount of mass, weight, time, volume, concentration, percentage, or the like is meant to encompass variations of in some embodiments ±50%, in some embodiments ±40%, in some embodiments ±30%, in some embodiments ±20%, in some embodiments ±10%, in some embodiments ±5%, in some embodiments ±1%, in some embodiments ±0.5%, and in some embodiments ±0.1% from the specified amount, as such variations are appropriate to perform the disclosed method.
[0046] As used herein, ranges can be expressed as from “about” one particular value, and/or to “about” another particular value. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as “about” that particular value in addition to the value itself. For example, if the value “10” is disclosed, then “about 10” is also disclosed. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.
[0047] As used herein, the term “biologic” refers to any diagnostic, preventive, or therapeutic preparation derived from animal products or other biological sources.
[0048] All combinations of method or process steps as used herein can be performed in any order, unless otherwise specified or clearly implied to the contrary by the context in which the referenced combination is made.
DETAILED DESCRIPTION
[0049] The details of one or more embodiments of the presently-disclosed subject matter are set forth in this document. Modifications to embodiments described in this document, and other embodiments, will be evident to those of ordinary skill in the art after a study of the information provided in this document. The information provided in this document, and particularly the specific details of the described exemplary embodiments, is provided primarily for clearness of understanding and no unnecessary limitations are to be understood therefrom. In case of conflict, the specification of this document, including definitions, will control.
[0050] The presently-disclosed subject matter relates to articles and methods for protection against desiccation. In some embodiments, the article includes a recombinant nucleic acid construct. In some embodiments, the recombinant nucleic acid construct includes the nucleotide sequence encoding accession number ACX60_11190 (SEQ ID NO: 1) or a complement thereof. In one embodiment, the complement nucleotide sequence includes at least 80% identity to the nucleotide sequence encoding SEQ ID NO: 1. For example, in some embodiments, the complement nucleotide sequence includes one or more mutations in the disordered part of the protein, such as, but not limited to, amino acids 26-411. In some embodiments, the article includes the amino acid sequence of SEQ ID NO: 1 or a complement thereof. In one embodiment, the complement amino acid sequence includes at least 80% identity to SEQ ID NO: 1. In some embodiments, the article includes a protein according to the amino acid sequence of SEQ ID NO: 1, referred to herein as DtpA, or a complement thereof. In one embodiment, the complement protein includes a protein having an amino acid sequence with at least 80% identity to SEQ ID NO: 1. In some embodiments, DtpA and the complements thereof are intrinsically disordered proteins.
[0051] Without wishing to be bound by theory, it is believed that the protein, which is also referred to herein as DtpA, and complements thereof provide resistance to desiccation (drying out) of any suitable biologic for which drying out is a concern. Accordingly, also provided herein, in some embodiments, is a method of protecting one or more biologics from desiccation, the method including exogenously and/or recombinantly adding the DtpA and/or complement thereof to the biologic. In some embodiments, the method includes forming a composition including at least one biologic and the DtpA and/or complement thereof. In one embodiment, the composition is a solid composition. In one embodiment, the composition is a liquid composition.
[0052] Suitable biologics include, but are not limited to, enzymes, food, vaccines, heterologous polypeptides, heterologous proteins, or combinations thereof. As used herein, the terms “heterologous polypeptides” and “heterologous proteins” refers to polypeptides and/or proteins expressed in an organism that is not Acinetobacter baumannii. For example, in one embodiment, the method includes recombinantly and/or exogenously adding the DtpA and/or complement thereof to purified enzymes, the DtpA and/or complement thereof protecting the enzymes from drying out. In one embodiment, the method includes recombinantly and/or exogenously adding the DtpA and/or complement thereof to at least one heterologous polypeptide or protein of interest. In another embodiment, the DtpA and/or complement thereof stabilizes the at least one heterologous polypeptide or protein of interest. As used herein, stabilizing a heterologous polypeptide or protein means maintaining the structure under aqueous and dry conditions, or after being frozen and or dried and then rehydrated.
[0053] Additionally or alternatively, in some embodiments, when the DtpA and/or complement thereof is expressed in organisms other than Acinetobacter baumannii it confers resistance to desiccation upon those organisms. Without wishing to be bound by theory, it is believed that the DtpA and/or complement thereof protects against protein misfolding/aggregation, which is a common consequence of desiccation in different organisms/cell types. Accordingly, further provided herein, in some embodiments, is a method of stabilizing a heterologous organism, such as, but not limited to, a plant or animal cell, bacteria, probiotic, tissue, organ, and/or plant. In some embodiments, the method includes contacting the heterologous organism with a formulation comprising DtpA. In one embodiment, the formulation includes the DtpA and/or complement thereof. In another embodiment, the formulation includes a composition including the DtpA and/or complement thereof. In some embodiments, the method includes endogenously expressing the DtpA and/or complement thereof in the heterologous organism. In one embodiment, the method includes producing a transgenic cell or organism by introducing the nucleotide sequence encoding SEQ ID NO: 1 or a complement thereof into the heterologous cell or organism. For example, in another embodiment, dtpA is cloned into the eukaryotic expression vector pCMV6 and introduced into Cos-7 fibroblast cells or other suitable cells through transient transfection. In another embodiment, the method includes introducing dtpA into bacteria strains belonging to the gut microbiota that are frequently included in commercial probiotic supplements using plasmid expression constructs.
[0054] In some embodiments, the exogenous addition and/or endogenous expression of DtpA and/or a complement thereof stabilizes the heterologous plant or animal cell, bacteria, probiotic, tissue, organ, and/or plant. As used herein, stabilizing a cell, bacteria, probiotic, tissue, organ, and/or plant, means maintaining the structure and function thereof a under aqueous or dry conditions, or after being frozen and dried and then rehydrated. In some embodiments, the exogenous addition and/or endogenous expression of DtpA and/or a complement thereof provides an organism with increased tolerance to desiccation. An increased tolerance to desiccation refers to the ability of a protein, cell, tissue, organ, or organism that has either had contact with DtpA, or has been transformed with the heterologous nucleotide sequence encoding DtpA, to tolerate water loss, drought, or being frozen and dried and then rehydrated, better than a control protein, cell, tissue, organ, or organism. An isolated cell refers to either 1) a single-celled organism such as a bacterium or yeast, or 2) a cell that is separated from other components with which it is normally associated in its natural state. An organ or tissue may include, but is not limited to, lungs, lymph nodes, pharynx, larynx, heart, liver, gallbladder, kidneys, bone, large intestines, small intestines, urinary bladder, pancreas, stomach, spleen, skin, nervous tissue, epithelial tissue, connective tissue, muscle tissue, stem, leaf, petal, stamen, pistil, root, seed, pollen, flower, fruit, ovule, sepal, bud, anther, filament, ovary, stigma, pedicle.
[0055] Additionally or alternatively, in some embodiments, when the DtpA and/or complement thereof is expressed in organisms other than Acinetobacter baumannii it confers resistance to heat upon those organisms. Accordingly, also provided herein, in some embodiments, is a method of protecting a heterologous organism (e.g., a plant or animal cell, bacteria, probiotic, tissue, organ, and/or plant) from heat. As used herein, protecting a cell, bacteria, probiotic, tissue, organ, and/or plant from heat means maintaining the structure and function thereof under elevated temperature conditions, such as, but not limited to, temperatures of up to 65° C. (150° F.). Without wishing to be bound by theory, it is believed that the DtpA and/or complement thereof protects against protein misfolding/aggregation resulting from exposure of different organisms/cell types to high temperatures. For example, in one embodiment, the exogenous addition and/or endogenous expression of DtpA and/or a complement thereof protects crops from elevated heat. In another embodiment, the exogenous addition and/or endogenous expression of DtpA and/or a complement thereof facilitates the delivery of vaccines and medicines by protecting the vaccine/medicine from elevated heat during transportation and/or storage.
[0056] In some embodiments, the method of protecting a heterologous organism from heat includes contacting the heterologous organism with a formulation comprising DtpA. In one embodiment, the formulation includes the DtpA and/or complement thereof. In another embodiment, the formulation includes a composition including the DtpA and/or complement thereof. In some embodiments, the method includes endogenously expressing the DtpA and/or complement thereof in the heterologous organism. In one embodiment, the method includes producing a transgenic cell or organism by introducing the nucleotide sequence encoding SEQ ID NO: 1 or a complement thereof into the heterologous cell or organism. For example, in another embodiment, dtpA is cloned into the eukaryotic expression vector pCMV6 and introduced into Cos-7 fibroblast cells or other suitable cells through transient transfection. In another embodiment, the method includes introducing dtpA into bacteria strains belonging to the gut microbiota that are frequently included in commercial probiotic supplements using plasmid expression constructs.
[0057] The articles and methods disclosed herein overcome the current shortcomings in the shelf-stabilization of protein- and live-bacterial based therapeutics by providing new protein-based compositions and methods for stabilizing proteins and other biological material.
[0058] The presently-disclosed subject matter is further illustrated by the following specific but non-limiting examples. The following examples may include compilations of data that are representative of data gathered at various times during the course of development and experimentation related to the presently-disclosed subject matter.
EXAMPLES
[0059] This Example discusses the identification and verification of gene products that influence desiccation tolerance.
[0060] Referring to
[0061] The ATP-dependent AAA+ lon proteases degrade aggregated/misfolded proteins. They were first identified in E. coli, but are conserved in a large variety of prokaryotes as well as in eukaryotes (in mitochondria). The lon proteases contain 3 domains: substrate recognition, ATP binding, and proteolytic, and degrade naturally unstable proteins that are involved in a great variety of biological processes. In other bacterial organisms, loss of lon is usually associated with stress sensitivity (heat shock and starvation). However, the Δlon mutant exhibits increased desiccation tolerance and oxidative stress resistance (
[0062] ACX60 11190 is predicted to encode an intrinsically disordered protein (IDP) (
[0063] As illustrated in
[0064] To determine how the production of DtpA is regulated in response to desiccation, phenotypic variants of Δlon mutant were isolated on LB agar. As shown in
[0065] Based upon the data above, the present inventors developed the model shown in
[0066] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.
[0067] It will be understood that various details of the presently disclosed subject matter can be changed without departing from the scope of the subject matter disclosed herein. Furthermore, the foregoing description is for the purpose of illustration only, and not for the purpose of limitation.