Humanized anti-MUC1* antibodies

11746159 · 2023-09-05

Assignee

Inventors

Cpc classification

International classification

Abstract

The present application discloses humanized antibodies and antibody like proteins and fragments thereof.

Claims

1. A chimeric antigen receptor (CAR) comprising a scFv or humanized scFv of an MN-E6 scFv set forth as consisting of SEQ ID NOS: 233, 235, or 237, MN-C2 scFv set forth as consisting of SEQ ID NOS:239, 241, or 243, MN-C3 scFv set forth as consisting of SEQ ID NOS: 245, 247, or 249 or MN-C8 scFv set forth as consisting of SEQ ID NOS:251, 253, or 255.

2. The CAR as in claim 1, further comprising a cytoplasmic tail comprising one or more of signaling sequence motifs selected from the group consisting of: CD3-zeta, CD27, CD28, 4-1BB, 0X40, CD30, CD40, PD-1, ICAm-1, LFA-1, ICOS, CD2, CDS, and CD7.

3. The CAR as in claim 1, wherein its sequence is CARIVIN-E6 CD3z (SEQ ID NO:295), CARIVIN-E6 CD28/CD3z (SEQ ID NO :298); CARMN-E6 4-1BB/CD3z (SEQ ID NO :301); CARMN-E6 0X40/CD3z (SEQ ID NO :617); CARMN-E6 CD28/4-1BB/CD3z (SEQ ID NO :304); CARMN-E6 CD28/0X40/CD3z (SEQ ID N0:619); CAR MN-C2 CD3z (SEQ ID NO :607); CAR MN-C2 CD28/CD3z (SEQ ID N0:609); CAR MN-C2 4-1BB/CD3z (SEQ ID NO :611); CAR MN-C2 0X40/CD3z (SEQ ID NO :613); CAR MN-C2 CD28/4-1BB/CD3z (SEQ ID NO :307); or CAR MN-C2 CD28/0X40/CD3z (SEQ ID NO :615).

4. A cell comprising the CAR of claim 1.

5. The cell according to claim 4, wherein the cell comprising the CAR is an immune system cell.

6. The cell according to claim 5, wherein the immune system cell comprising the CAR is T cell.

7. The cell according to claim 5, wherein the immune system cell comprising the CAR is dendritic cell.

8. The cell according to claim 5, wherein the immune system cell comprising the CAR is mast cell.

9. The CAR as in claim 1, wherein the scFv or humanized scFv is of the MN-C2 scFv set forth as consisting of SEQ ID NOS:239, 241, or 243.

10. The CAR as in claim 1, wherein the scFv or humanized scFv is of the MN-E6 scFv set forth as consisting of SEQ ID NOS: 233, 235, or 237.

11. The CAR as in claim 1, wherein the scFv or humanized scFv is of the MN-C3 scFv set forth as consisting of SEQ ID NOS: 245, 247, or 249.

12. The CAR as in claim 1, wherein the scFv or humanized scFv is of the MN-C8 scFv set forth as consisting of SEQ ID NOS:251, 253, or 255.

13. The CAR of claim 3, wherein its sequence is CAR MN-C2 4-1BB/CD3z (SEQ ID NO :611).

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

(2) The present invention will become more fully understood from the detailed description given herein below, and the accompanying drawings which are given by way of illustration only, and thus are not limitative of the present invention, and wherein;

(3) FIG. 1A-D show cell growth assay graphs of MUC1* positive cells treated with either bivalent ‘by’ anti-MUC1* antibody, monovalent ‘my’ or Fab, NM23-H1 dimers or NME7-AB. Bivalent anti-MUC1* antibodies stimulate growth of cancer cells whereas the monovalent Fab inhibits growth (A, B). Classic bell-shaped curve indicates ligand induced dimerization stimulates growth. Dimeric NM23-H1, aka NME1, stimulates growth of MUC1* positive cancer cells but siRNA to suppress MUC1 expression eliminate its effect (C). NME7-AB also stimulates the growth of MUC1* positive cells (D).

(4) FIG. 2A-F show results of ELISA assays. MUC1* peptides PSMGFR, PSMGFR minus 10 amino acids from the N-terminus aka N-10, or PSMGFR minus 10 amino acids from the C-terminus, aka C-10 are immobilized on the plate and the following are assayed for binding: NME7-AB (A), MN-C2 monoclonal antibody (B), MN-E6 monoclonal antibody (C), or dimeric NME1 (D). These assays show that NME1, NME7-AB and monoclonal antibodies MN-C2 and MN-E6 all require the first membrane proximal 10 amino acids of the MUC1* extracellular domain to bind. MUC1* peptides PSMGFR minus 10 amino acids from the N-terminus aka N-10, or PSMGFR minus 10 amino acids from the C-terminus, aka C-10, are immobilized on the plate and the following are assayed for binding: MN-C3 (E) and MN-C8 (F).

(5) FIG. 3A-C show results of competitive ELISA assays. The PSMGFR MUC1* peptide is immobilized on the plate and dimeric NM23-H1, aka NME1, is added either alone or after the MN-E6 antibody has been added (A). The same experiment was performed wherein NM23-H7, NME7-AB, is added alone or after MN-E6 has been added (B). Results show that MN-E6 competitively inhibits the binding of MUC1* activating ligands NME1 and NME7. In a similar experiment (C), PSMGFR or PSMGFR minus 10 amino acids from the N-terminus, aka N-10, is immobilized on the plate. Dimeric NM23-H1 is then added. Anti-MUC1* antibodies MN-E6, MN-C2, MN-C3 or MN-C8 are then tested for their ability to compete off the NM23-H1. Results show that although all three antibodies bind to the PSMGFR peptides, MN-E6 and MN-C2 competitively inhibit binding of the MUC1* activating ligands.

(6) FIG. 4A-F shows FACS scans of anti-MUC1* antibodies binding specifically to MUC1* positive cancer cells and MUC1* transfected cells but not MUC1* or MUC1 negative cells. ZR-75-1, aka 1500, MUC1* positive breast cancer cells were stained with 1:2 or 1:10 dilutions of the 1.5 ug/ml humanized MN-C2. After two washes, cells were stained with secondary antibody, Anti-Penta-His antibody at conjugated to Alexa 488 (Qiagen) dilutions of 1:200 (A), 1:50 (B), or 1:10 (C) to detect the 6x His tag on the huMN-C2 scFv. Flow cytometric analysis revealed a concentration-dependent shift of a subset of cells, indicating specific binding, which is unseen in the absence of the MN-C2 scFv (A-C). In another case, MN-E6 was used to stain MUC1 negative HCT-116 colon cancer cells transfected with the empty vector, single cell clone #8 (D), HCT-116 colon cancer cells transfected with MUC1* single cell clone #10 (E), or ZR-75-1, aka 1500, MUC1* positive breast cancer cells. As the FACS scans show, both MN-C2 and MN-E6 only stain MUC1* positive cells and not MUC1 or MUC1* negative cells.

(7) FIG. 5 shows a graph of an ELISA in which surface is coated with either the MUC1* PSMGFR peptide or a control peptide. Humanized MN-C2 scFv is then incubated with the surface, washed and detected according to standard methods. The ELISA shows that the huMN-C2 scFv binds to the MUC1* peptide with an EC-50 of about 333 nM.

(8) FIG. 6A-B shows graphs of cancer cell growth inhibition by MUC1* antibody variable region fragment humanized MN-C2 scFv. hMN-C2 scFv potently inhibited the growth of ZR-75-1, aka 1500, MUC1* positive breast cancer cells (A) and T47D MUC1* positive breast cancer cells (B) with approximately the same EC-50 as the in vitro ELISAs.

(9) FIG. 7A-B shows graphs of tumor growth in immune compromised mice that have been implanted with human tumors then treated with anti-MUC1* antibody MN-E6 Fab or mock treatment. Female nu/nu mice implanted with 90-day estrogen pellets were implanted with 6 million T47D human breast cancer cells that had been mixed 50/50 with Matrigel. Mice bearing tumors that were at least 150 mm.sup.3 and had three successive increases in tumor volume were selected for treatment. Animals were injected sub cutaneously twice per week with 80 mg/kg MN-E6 Fab and an equal number of mice fitting the same selection criteria were injected with vehicle alone (A). Male NOD/SCID mice were implanted with 6 million DU-145 human prostate cancer cells that had been mixed 50/50 with Matrigel. Mice bearing tumors that were at least 150 mm.sup.3 and had three successive increases in tumor volume were selected for treatment. Animals were injected sub-cutaneously every 48 hours with 160 mg/kg MN-E6 Fab and an equal number of mice fitting the same selection criteria were injected with vehicle alone (B). Tumors were measured independently by two researchers twice per week and recorded. Statistics were blindly calculated by independent statistician, giving a P value of 0.0001 for each. Anti-MUC1* Fab inhibited breast cancer growth and prostate cancer growth. Treatment had no effect on weight, bone marrow cell type or number.

(10) FIG. 8 is a graph of an ELISA assay showing differing levels of expression of humanizedMN-E6 anti-MUC1* antibody depending on whether the light chain was kappa or lambda and whether the variable portion was fused to a human IgG1 or IgG2.

(11) FIG. 9 is a graph of an ELISA assay comparing the binding of the parent mouseMN-E6 antibody to the humanized versions of theMN-E6 antibody to a surface presenting the PSMGFR peptide derived from the MUC1* extracellular domain.

(12) FIG. 10 is a graph of an ELISA assay showing differing levels of expression of humanized MN-C2 anti-MUC1* antibody depending on whether the light chain was kappa or lambda and whether the variable portion was fused to a human IgG1 or IgG2.

(13) FIG. 11 is a graph of an ELISA assay comparing the binding of the parent mouse MN-C2 antibody to the humanized versions of the MN-C2 antibody to a surface presenting the PSMGFR peptide derived from the MUC1* extracellular domain.

(14) FIG. 12 is a graph of an ELISA assay showing binding of humanized single chain (scFv) MN-C2 andMN-E6 antibodies binding to a surface presenting the PSMGFR peptide derived from the MUC1* extracellular domain.

(15) FIG. 13A-C shows FPLC traces of the purification of MN-E6 scFv-Fc fusion protein that was grown in low IgG FBS over a Protein A affinity column. A) is the trace of the flow through. B) is the trace of the elution. C) shows the purified protein on a reducing or non-reducing gel.

(16) FIG. 14A-B shows photographs of SDS-PAGE characterization of purified MN-E6 scFv-Fc fusion proteins on a non-reducing gels, wherein the Fc portion that was fused to the MN-E6 was either wild type (wt) or mutated as follows: A) F405Q, Y407R, T394D; B) T366W/L368W, T364R/L368R, T366W/L368W or T364R/L368R. Fc mutants F405Q, Y407R, T366W/L368W, T364R/L368R, T366W/L368W and T364R/L368R all favored monomer over dimer formation. The reference construct amino acid sequence for the indicated mutations is SEQ ID NO:273.

(17) FIG. 15A-B shows FPLC traces of the purification of MN-E6 scFv-Fc Y407Q fusion protein that was grown in low IgG FBS over a Protein A affinity column. A) is the trace of the flow through. B) is the trace of the elution. The protein was further purified by size exclusion over an S200 column (C). (D) is a photograph of an SDS-PAGE gel showing which fractions had a predominance of monomer. The reference construct amino acid sequence for the indicated mutations is SEQ ID NO:273.

(18) FIG. 16 shows a photograph of SDS-PAGE characterization of purified MN-E6 scFv-Fc-mutant fusion proteins on a non-reducing gel, wherein the Fc portion that was fused to the MN-E6 scFv was either wild type (wt) or mutated by elimination of the hinge region, ‘DHinge’, of the Fc or elimination of the hinge region of the Fc and also bearing the Y407R mutation. All the Fc mutants favored monomer over dimer formation. The reference construct amino acid sequence for the indicated mutations is SEQ ID NO:273.

(19) FIG. 17A-C. A and B show photograph of non-reducing SDS-PAGE characterization of large scale expression and purification of MN-E6 scFv-Fc hingeless mutant, showing that it is a monomer. FPLC characterization and purification of MN-E6 scFv-Fc hingeless mutant is shown (C).

(20) FIG. 18A-C shows photographs of the SDS-PAGE characterization of the purified MN-C3 scFv-Fc fusion protein on a non-reducing gel (A) or a reducing gel (B). The protein was purified by size exclusion. The FPLC trace is shown (C).

(21) FIG. 19A-B shows photographs of Native gels of MN-C3 or MN-E6 Fabs, scFv, scFv-Fc, wherein the Fc portion is wild type or mutants that prefer or are exclusively monomers. Native gels show that the Y407R Fc mutation (A) and the double mutant Y407R and a deleted hinge (B) favor monomer over dimer the best. Note that proteins are loaded onto a gel at much higher concentrations than typical use concentrations. The dimer formation of other Fc mutants may only reflect the fact that loading concentration is very high.

(22) FIG. 20 shows a graph of an ELISA wherein the surface was immobilized with either PSMGFR peptide, PSMGFR minus 10 amino acids from the N-terminus or minus 10 amino acids from the C-terminus. The hu MN-E6 scFv-Fc bound to the PSMGFR peptide and to the PSMGFR N-10 peptide but not to the PSMGFR C-10 peptide. The parent MN-E6 antibody and the humanized MN-E6 require the C-terminal 10 amino acids of PSMGFR for binding.

(23) FIG. 21A-B shows an ELISA graph of several anti-MUC1* scFv-Fc fusion proteins wherein the Fc region has been eliminated or mutated. Shown are hu MN-E6 scFv-Fc-wt, hu MN-E6 scFv-Fc-Y407R, hu MN-E6 scFv-Fc-hingeless, and hu MN-E6 scFv-Fc-Y407R-hingeless. All mutants bind to the PSMGFR peptide of the MUC1* extracellular domain (A). An ELISA graph of several anti-MUC1* scFv-Fc fusion proteins wherein the Fc region is either wild type or mutated. Shown are hu MN-E6 scFv-Fc-wt, hu MN-E6 scFv-Fc-hingeless, and hu MN-C3 scFv-Fc is shown (B). All bind to the PSMGFR peptide of the MUC1* extracellular domain.

(24) FIG. 22A-C shows graphs of ELISAs wherein the assay plate surface was immobilized with either PSMGFR peptide, PSMGFR minus 10 amino acids from the N-terminus or minus 10 amino acids from the C-terminus. The MN-C3 antibody variants were then assayed for binding to the various MUC1* peptides. A) Purified mouse monoclonal MN-C3 antibody; B) Impure humanized MN-C3 antibody; and C) the humanized MN-C3 scFv-Fc. ELISAs show binding to the PSMGFR peptide as well as to certain deletion peptides.

(25) FIG. 23 shows a graph of an ELISA assay that quantifies the binding of humanized MN-E6 scFv-Fc-delta hinge, aka Dhinge or hingeless, and humanized MN-E6 scFv to the MUC1* peptide PSMGFR.

(26) FIG. 24 shows photographs of immunofluorescence experiments in which humanized MN-C2 scFv or MN-E6 scFv specifically binds to MUC1* positive breast cancer cells in an identical concentration dependent manner. A-G: hu MN-C2 scFv binding to T47D breast cancer cells at concentrations indicated. H-N shows the fluorescently labeled scFv and DAPI. O-U: hu MN-E6 scFv binding to T47D breast cancer cells at concentrations indicated. V-B′ shows the fluorescently labeled scFv and DAPI. C′ is the secondary antibody control.

(27) FIG. 25A-L shows photographs of 1500 MUC1* positive breast cancer cells that have been cultured in normal medium or in the presence of humanized MN-E6 scFv. A-D are bright field images taken at 4× magnification. E-H are calcein fluorescent images taken at 4× magnification. I-L are calcein fluorescent images taken at 10× magnification. A,E, I show control cells cultured in normal RPMI medium. B,F, J show control cells cultured in normal RPMI medium plus a volume of PBS equal to the volume of MN-E6 scFv in PBS that is added to experimental wells. C, G, K show cells cultured in normal RPMI medium plus 500 ug/mL MN-E6 scFv. D, H, L show cells cultured in normal RPMI medium plus 5 ug/mL MN-E6 scFv. The photographs show killing and/or growth inhibition of MUC1* positive cells by MN-E6 scFv at 5 ug/mL and an even greater effect at 500 ug/mL. Images were taken at 96 hours post addition of test molecule.

(28) FIG. 26A-L shows photographs of 1500 MUC1* positive breast cancer cells that have been cultured in normal medium or in the presence of humanized MN-E6 scFv-Fc Dhinge, which is a hingeless or delta hinge mutant. A-F are bright field images taken at 20× magnification. G-L are calcein fluorescent images taken at 4× magnification. A, G show control cells cultured in normal RPMI medium. B, H show cells cultured in normal RPMI medium plus 100 ug/mL hMN-E6 scFv-Fc Dhinge. C, I show cells cultured in normal RPMI medium plus 50 ug/mL hMN-E6 scFv-Fc Dhinge. D, J show cells cultured in normal RPMI medium plus 5 ug/mL hMN-E6 scFv-Fc Dhinge. E, K show cells cultured in normal RPMI medium plus 0.5 ug/mL hMN-E6 scFv-Fc Dhinge. F, L show cells cultured in normal RPMI medium plus 500 ug/mL of MN-E6 Fab. The photographs show killing and/or growth inhibition of MUC1* positive cells by hMN-E6 scFv-Fc Dhinge 5 ug/mL, an even greater effect at 50 ug/mL and yet an even greater effect at 100 ug/mL. Comparing cell morphology to the control cells, cancer cells grown in MN-E6 Fab or in an effective amount of hMN-E6 scFv-Fc Dhinge, show rounding up of the cells which morphology change occurs before cell death. Images were taken at 96 hours post addition of test molecule.

(29) FIG. 27 shows a graph of the image analysis of the fluorescent images of FIGS. 25 and 26. Image J was used to quantify the number of cells remaining after 96 hours treatment in humanized MN-E6scFv or MN-E6 scFv-Fc-delta hinge, aka Dhinge. The analysis software uses pixel counting and pixel fluorescence intensity to quantify the number of cells in each photograph. Analysis was performed over the entire image 512×512 pixels, 8-bit image. For comparison, the inhibition of mouse monoclonal MN-E6 Fab is also analyzed.

(30) FIG. 28 shows schematics of CAR sequence components.

(31) FIG. 29 is a graph of an experiment measuring IL-2 cytokine secretion by Jurkat T cells that were transduced with a panel of CARs, including MN-E6-CD8-3z, MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z, MN-E6-CD4-CD28-3z and MN-E6-CD4-CD28-41BB-3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*.

(32) FIG. 30 is a graph of an experiment measuring IL-2 cytokine secretion by Jurkat T cells that were transduced with a panel of CARs, including MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z, MN-E6-CD4-CD28-3z and MN-E6-CD4-41BB-3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*.

(33) FIG. 31 is a graph of an experiment measuring IL-2 cytokine secretion by primary human T cells, isolated from a blood sample, that were transduced with a panel of CARs, including MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD4-41BB-3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*.

(34) FIG. 32 is a graph of an experiment measuring interferon-gamma (IFN-g) cytokine secretion by primary human T cells, isolated from a blood sample, that were transduced with a panel of CARs, including MN-E6-CD8-CD28-3z and MN-E6-CD4-41BB-3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*.

(35) FIG. 33 is a graph of an experiment measuring interferon-gamma (IFN-g) cytokine secretion by primary human T cells, isolated from a blood sample, that were transduced with a panel of CARs, including MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD8-CD28-41BB-3z, when the CAR T cells were exposed to K562-wt cells, K562 cells that had been transfected with MUC1*, or MUC1* positive cancer cells of prostate cancer, breast cancer or pancreatic cancer.

(36) FIG. 34 is a graph of an experiment measuring target cell death when primary human T cells, isolated from a blood sample, that were transduced with a panel of CARs, including MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD4-41BB-3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*. The ratio of T cells to target cells was 1:1 and the cells were co-cultured for 24 hours.

(37) FIG. 35 is a graph of FACS measuring a time course of target cell survival from Day 1 to Day 3. Primary human T cells, isolated from a blood sample, were transduced with a panel of CARs, including humanized MN-E6-CD8-3z, MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were then exposed to K562-wt cells that naturally express low levels of MUC1*, or K562 cells that had been transfected with MUC1* high. The ratio of MUC1* targeting CART cells to target cells was either 1:1, 10:1, or 20:1. Surviving cells were detected and measured at Day 1 or Day 3 (B).

(38) FIG. 36 is a graph of FACS measurements of target cell survival at Day 3 of co-culture experiment. Primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-3z, MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD8-CD28-41BB-3z.

(39) The CAR T cells were then exposed to MUC1* positive T47D breast cancer cells or MUC1* positive 1500 aka ZR-75-1 breast cancer cells. The ratio of MUC1* targeting CAR T cells to target cells was either 1:1 or 10:1. As can be seen from the graph, T cells transduced with a MUC1* targeting CAR have a much greater killing effect on MUC1* cancer cells than the untransduced control T cells. In addition, the killing effect is much greater when the ratio of T cells: target cells is increased.

(40) FIG. 37 is a graph of FACS measurements of target cell survival at Day 1 of co-culture experiment. Primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-41BB-3z, MN-E6-CD4-41BB-3z, and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were then exposed to the following MUC1* positive cancer cells: T47D breast cancer; capan2 pancreatic cancer; or DU-145 prostate cancer. The ratio of MUC1* targeting CAR T cells to target cells was 5:1. As can be seen from the graph, T cells transduced with a MUC1* targeting CAR have a much greater killing effect on MUC1* cancer cells than the untransduced control T cells. Note that the measurements were taken after 24 hours with only a 5:1 T cell to target cell ratio. Also note that MUC1* targeting CARs that have a CD4 extracellular domain-transmembrane-cytoplasmic tail work equally well as CD8 constructs.

(41) FIG. 38 is a graph of FACS measurements of target cell survival at Day 3 of co-culture experiment. Primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-41BB-3z, MN-E6-CD4-41BB-3z, and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were then exposed to the following MUC1* positive cancer cells: K562 leukemia cells transfected with MUC1*; T47D breast cancer; 1500 aka ZR-75-1 breast cancer cells; or CAPAN-2 pancreatic cancer cells. In addition to the untransduced T cell controls, the assay was performed on PC3 MUC1* negative prostate cancer cells. The ratio of MUC1* targeting CAR T cells to target cells was 1:1. As can be seen from the graph, T cells transduced with a MUC1* targeting CAR have a much greater killing effect on MUC1* cancer cells than the untransduced control T cells. In addition, the killing effect is specific for MUC1* positive cells. Note that MUC1* targeting CARs that have a CD4 extracellular domain-transmembrane-cytoplasmic tail work equally well as CD8 constructs.

(42) FIG. 39 is a graph of FACS measurements of CAR T cell expansion over 24 hours in co-culture with target cells at a ratio of 5:1 CAR T cells to target cells. The primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-41BB-3z, MN-E6-CD4-41BB-3z, and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were co-cultured with MUC1* positive T47D breast cancer cells, MUC1* positive Capan pancreatic cancer cells, and MUC1-negative cells HCT-116 colon cancer cells and HEK-293 human embryonic kidney cells. As can be seen from the graph, the CAR T population is increased in the presence of MUC1* positive cells.

(43) FIG. 40 shows a photograph of a Western blot of MUC1* targeting CARs. From 1 to 9 are:

(44) 1.E6scFv-Fc-8-41BB-CD3z (Human Fc as hinge region with CD8 TM);

(45) 2: E6scFv-FcH-8-41BB-CD3z (Human Fc hingeless as hinge region with CD8 TM)

(46) 3: E6scFv-Fc-4-41BB-CD3z (Human Fc as hinge region with CD4 TM)

(47) 4: E6scFv-FcH-4-41BB-CD3z (Human Fc as hingeless hinge region with CD4 TM)

(48) 5: E6scFv-IgD-8-41BB-CD3z (hinge region from human IgD with CD8 TM)

(49) 6: E6scFv-IgD-4-41BB-CD3z (hinge region from human IgD with CD4 TM)

(50) 7: E6scFv-X4-8-41BB-CD3z (Long flexible linker as hinge region with CD8 TM)

(51) 8: E6scFv-X4-4-41BB-CD3z (Long flexible linker as hinge region with CD4 TM)

(52) 9: E6scFv-8-4-41BB-CD3z (Hinge region from CD8 and CD4 a with CD4 TM).

(53) FIG. 41 shows graphs of FACS scans of T47D breast cancer cells co-cultured with human T cells that were transduced with MN-E6scFv-Fc-8-41BB-CD3z, MN-E6scFv-FcH-8-41BB-CD3z, MN-E6scFv-Fc-4-41BB-CD3z, MN-E6scFv-IgD-8-41BB-CD3z, MN-E6scFv-X4-8-41BB-CD3z and MN-E6scFv-X4-4-41BB-CD3z. T cells and cancer cells were co-cultured at a 1:1 ratio for 48 hours. T cell counts were normalized to an average of all untransduced T cells and target cells were normalized to each specific cell type when co-cultured with untransduced T cells. The graph shows that when the CAR T cells are co-cultured with MUC1* positive cancer cells, the T cell population expands and the targeted cancer cell population decreases.

(54) FIG. 42 shows graphs of FACS scans of T47D breast cancer cells, Capan-2 pancreatic cancer cells, K562-MUC1* transfected cells, and K562-wt cells that were co-cultured with human T cells that were transduced with MN-E6scFv-Fc-8-41BB-CD3z, MN-E6scFv-FcH-8-41BB-CD3z, MN-E6scFv-Fc-4-41BB-CD3 z, MN-E6scFv-IgD-8-41BB-CD3 z, MN-E6scFv-X4-8-41BB-CD3 z and MN-E6scFv-X4-4-41BB-CD3z. T cells and cancer cells were co-cultured at a 1:1 ratio for 48 hours. T cell counts were normalized to an average of all untransduced T cells and target cells were normalized to each specific cell type when co-cultured with untransduced T cells. The graph shows that when the CAR T cells are co-cultured with MUC1* positive cancer cells, the T cell population expands and the targeted cancer cell population decreases.

(55) FIG. 43A,B are photographs of breast cancer tissue arrays. A) was stained with VU4H5 which recognizes MUC1-FL (full length); B) was stained with mouse monoclonal antibody MN-C2 which recognizes cancerous MUC1*. Following automated staining (Clarient Diagnostics), the tissue staining was scored using Allred scoring method which combines an intensity score and a distribution score. C,D,E,F are color coded graphs showing the score calculated for MUC1 full-length staining for each patient's tissue. G,H,I,J are color coded graphs showing the score calculated for MUC1* staining for each patient's tissue.

(56) FIG. 44A,B are photographs of breast cancer tissue arrays. A) was stained with VU4H5 which recognizes MUC1-FL (full length); B) was stained with mouse monoclonal antibody MN-C2 which recognizes cancerous MUC1*. Following automated staining (Clarient Diagnostics), the tissue staining was scored using Allred scoring method which combines an intensity score and a distribution score. C,D,E,F are color coded graphs showing the score calculated for MUC1 full-length staining for each patient's tissue. G,H,I,J are color coded graphs showing the score calculated for MUC1* staining for each patient's tissue.

(57) FIG. 45 shows photographs of normal breast and breast cancer tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 2.5 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal breast tissue. B-D are breast cancer tissues from patients as denoted in the figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(58) FIG. 46 shows photographs of normal breast and breast cancer tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 2.5 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal breast tissue. B-C are breast cancer tissues from patients as denoted in the figure. D-F are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(59) FIG. 47 shows photographs of breast cancer tissues stained with MN-E6 anti-MUC1* antibody at 10 ug/mL, then stained with a rabbit anti mouse secondary HRP antibody. A-D are breast cancer tissues from patient #300. E-H are breast cancer tissues from metastatic patient #291.

(60) FIG. 48 shows photographs of normal lung and lung cancer tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 2.5 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal lung tissue. B,C are lung cancer tissues from patients as denoted in the figure. D-F are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(61) FIG. 49 shows photographs of normal lung and lung cancer tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 2.5 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal lung tissue. B,C are lung cancer tissues from patients as denoted in the figure. D-F are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(62) FIG. 50 shows photographs of normal lung and lung cancer tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 25 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal lung tissue. B,C are lung cancer tissues from patients as denoted in the figure. D-F are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(63) FIG. 51 shows photographs of normal lung and lung cancer tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 25 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal lung tissue. B,C are lung cancer tissues from patients as denoted in the figure. D-F are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(64) FIG. 52 shows photographs of normal small intestine and cancerous small intestine tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 5 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal small intestine tissue. B) is small intestine cancer from patient as denoted in the figure. C,D are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(65) FIG. 53 shows photographs of normal small intestine tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are normal small intestine tissue. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(66) FIG. 54 shows photographs of cancerous small intestine tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are cancerous small intestine tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(67) FIG. 55 shows photographs of cancerous small intestine tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are cancerous small intestine tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(68) FIG. 56 shows photographs of normal colon tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are normal colon. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(69) FIG. 57 shows photographs of colon cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are colon cancer tissue from a metastatic patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(70) FIG. 58 shows photographs of colon cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are colon cancer tissue from a Grade 2 patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(71) FIG. 59 shows photographs of colon cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are colon cancer tissue from a metastatic patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(72) FIG. 60 shows photographs of prostate cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are prostate cancer tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(73) FIG. 61 shows photographs of prostate cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are prostate cancer tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(74) FIG. 62 shows photographs of prostate cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are prostate cancer tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

(75) In the present application, “a” and “an” are used to refer to both single and a plurality of objects.

(76) As used herein, “h” or “hu” placed before an antibody construct is short-hand for humanized.

(77) As used herein, the term “antibody-like” means a molecule that may be engineered such that it contains portions of antibodies but is not an antibody that would naturally occur in nature. Examples include but are not limited to CAR (chimeric antigen receptor) T cell technology and the Ylanthia® technology. The CAR technology uses an antibody epitope fused to a portion of a T cell so that the body's immune system is directed to attack a specific target protein or cell. The Ylanthia® technology consists of an “antibody-like” library that is a collection of synthetic human Fabs that are then screened for binding to peptide epitopes from target proteins. The selected Fab regions can then be engineered into a scaffold or framework so that they resemble antibodies.

(78) As used herein, the antibodies MN-C2, MN-E6, MN-C3 and MN-C8, may also be referred to as C2, E6, C3 and C8, respectively.

(79) As used herein, “PSMGFR” is abbreviation for Primary Sequence of the MUC1 Growth Factor Receptor which is identified by SEQ ID NO:2, and thus is not to be confused with a six amino acid sequence. “PSMGFR peptide” or “PSMGFR region” refers to a peptide or region that incorporates the Primary Sequence of the MUC1 Growth Factor Receptor (SEQ ID NO:2).

(80) As used herein, the “MUC1*” extra cellular domain is defined primarily by the PSMGFR sequence (GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:2)).

(81) Because the exact site of MUC1 cleavage depends on the enzyme that clips it, and that the cleavage enzyme varies depending on cell type, tissue type or the time in the evolution of the cell, the exact sequence of the MUC1* extra cellular domain may vary at the N-terminus.

(82) Other clipped amino acid sequences may include SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620); or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621).

(83) As used herein, the term “PSMGFR” is an acronym for Primary Sequence of MUC1 Growth Factor Receptor as set forth as GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA (SEQ ID NO:2). In this regard, the “N-number” as in “N-10 PSMGFR”, “N-15 PSMGFR”, or “N-20 PSMGFR” refers to the number of amino acid residues that have been deleted at the N-terminal end of PSMGFR. Likewise “C-number” as in “C-10 PSMGFR”, “C-15 PSMGFR”, or “C-20 PSMGFR” refers to the number of amino acid residues that have been deleted at the C-terminal end of PSMGFR.

(84) As used herein, the “extracellular domain of MUC1*” refers to the extracellular portion of a MUC1 protein that is devoid of the tandem repeat domain. In most cases, MUC1* is a cleavage product wherein the MUC1* portion consists of a short extracellular domain devoid of tandem repeats, a transmembrane domain and a cytoplasmic tail. The precise location of cleavage of MUC1 is not known perhaps because it appears that it can be cleaved by more than one enzyme. The extracellular domain of MUC1* will include most of the PSMGFR sequence but may have an additional 10-20 N-terminal amino acids.

(85) As used herein “sequence identity” means homology in sequence of a particular polypeptide or nucleic acid to a reference sequence of nucleic acid or amino acid such that the function of the homologous peptide is the same as the reference peptide or nucleic acid. Such homology can be so close with the reference peptide such that at times the two sequences may be 90%, 95% or 98% identical yet possess the same function in binding or other biological activities.

(86) MUC1* antibodies (anti-PSMGFR) for treatment or prevention of cancers

(87) We discovered that a cleaved form of the MUC1 (SEQ ID NO:1) transmembrane protein is a growth factor receptor that drives the growth of over 75% of all human cancers. The cleaved form of MUC1, which we called MUC1* (pronounced muk 1 star), is a powerful growth factor receptor. Enzymatic cleavage releases the bulk of the MUC1 extracellular domain. It is the remaining portion comprising a truncated extracellular domain, transmembrane and cytoplasmic tail that is called MUC1*. Cleavage and release of the bulk of the extracellular domain of MUC1 unmasks a binding site for activating ligands dimeric NME1, NME6, NME8, NME7-AB or NME7. Cell growth assays show that it is ligand-induced dimerization of the MUC1* extracellular domain that promotes growth (FIG. 1A-D). MUC1* positive cells treated with either bivalent ‘by’ anti-MUC1* antibody, monovalent ‘my’ or Fab, NM23-H1 dimers or NME7-AB. Bivalent anti-MUC1* antibodies stimulate growth of cancer cells whereas the monovalent Fab inhibits growth. Classic bell-shaped curve indicates ligand induced dimerization stimulates growth. Dimeric NM23-H1, aka NME1, stimulates growth of MUC1* positive cancer cells but siRNA to suppress MUC1 expression eliminate its effect (C). NME7-AB also stimulates the growth of MUC1* positive cells (D).

(88) MUC1* is an ideal target for cancer drugs as it is aberrantly expressed on over 75% of all cancers and is likely overexpressed on an even higher percentage of metastatic cancers (Fessler S P, Wotkowicz M T, Mahanta S K and Bamdad C. (2009). MUC1* is a determinant of trastuzumab (Herceptin) resistance in breast cancer cells. Breast Cancer Res Treat. 118(1):113-124). After MUC1 cleavage most of its extracellular domain is shed from the cell surface. The remaining portion has a truncated extracellular domain that at least comprises the primary growth factor receptor sequence, PSMGFR (SEQ ID NO:2). Antibodies that bind to the PSMGFR sequence and especially those that competitively inhibit the binding of activating ligands such as NME proteins, including NME1, NME6, NME8 and NME7, are ideal therapeutics and can be used to treat or prevent MUC1 positive or MUC1* positive cancers, as stand-alone antibodies, antibody fragments or variable region fragments thereof incorporated into bispecific antibodies, or chimeric antigen receptors also called CARs. Therapeutics anti-MUC1* antibodies can be monoclonal, polyclonal, antibody mimics, engineered antibody-like molecules, full antibodies or antibody fragments. Examples of antibody fragments include but are not limited to Fabs, scFv, and scFv-Fc. Human or humanized antibodies are preferred for use in the treatment or prevention of cancers. In any of these antibody-like molecules, mutations can be introduced to prevent or minimize dimer formation. Anti-MUC1* antibodies that are monovalent or bispecific are preferred because MUC1* function is activated by ligand induced dimerization. Typical binding assays show that NME1 and NME7 bind to the PSMGFR peptide portion of MUC1* (FIG. 2A, D). Further, they show that these activating growth factors bind to the membrane proximal portion of MUC1*, as they do not bind to the PSMGFR peptide if the 10 C-terminal amino acids are missing. Similarly, anti-MUC1* antibodies MN-C2 and MN-E6 bind to the PSMGFR peptide if an only if the 10 C-terminal amino acids are present (FIG. 2 B, C). Antibodies MN-C3 and MN-C8 bind to epitopes that are different from MN-C2 and MN-E6, as they do not depend on the presence of the 10 C-terminal amino acids of the PSMGFR peptide (FIG. 2 E, F). Antibodies MN-C2, MN-E6, MN-C3 or MN-C8, or fragments derived from them, as stand-alone antibodies or incorporated into bispecific antibodies, BiTEs or chimeric antigen receptors also called CARs expressed by immune cells are all potent anti-cancer therapeutics.

(89) Therapeutic anti-MUC1* antibodies for use as a stand alone antibody therapeutic or for integration into a BiTE or a CAR can be selected based on specific criteria. The parent antibody can be generated using typical methods for generating monoclonal antibodies in animals. Alternatively, they can be selected by screening antibody and antibody fragment libraries for their ability to bind to a MUC1* peptide, which can be the PSMGFR peptide (SEQ ID NO:2), SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620); or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621).

(90) Resultant antibodies or antibody fragments generated or selected in this way can then be further selected by passing additional screens. For example, antibodies or antibody fragments become more preferred based on their ability to bind to MUC1* positive cancer cells or tissues but not to MUC1 negative cancer cells or tissues. Further, anti-MUC1* antibodies or antibody fragments may be de-selected as anti-cancer therapeutics if they bind to stem or progenitor cells. Anti-MUC1* antibodies or antibody fragments become more preferred if they have the ability to competitively inhibit the binding of activating ligands to MUC1*. FIG. 3A-C shows that MN-E6 and MN-C2 competitively inhibit the binding of activating ligands NME1 and NME7 to MUC1*. A process for selecting anti-MUC1* antibodies for use in treating a patient diagnosed with a MUC1 positive cancer, at risk of developing a MUC1 positive cancer or suspected of having a MUC1 positive cancer comprises one or more of the following steps of selecting antibodies or antibody fragments that 1) bind to the PSMGFR peptide; 2) bind to the N-10 PSMGFR peptide; 3) bind to cancer cells; 4) do not bind to stem or progenitor cells; and 5) competitively inhibited the binding of dimeric NME1 or NME7-AB to the PSMGFR peptide. For example, FIG. 3A-C show that monoclonals MN-E6 and MN-C2 satisfy all five criteria, while monoclonals MN-C3 and MN-C8 do not competitively inhibit the binding of activating ligands NME1 and NME7 (Figure M3 C). However, antibodies or antibody fragments derived from MN-C3 and MN-C8 are equally potent as anti-cancer agents when integrated into a BiTE or a CAR as in these methods, the killing effect of the immune cells is more important than the ability to inhibit the binding of activating ligands. In addition, toxic agents conjugated to MN-E6, MN-C2, MN-C3 or MN-C8 are potent anti-cancer therapeutics. Recall that the MUC1* growth factor receptor is activated by ligand-induced dimerization of its extracellular domain. Therefore the ideal antibody therapeutic should not dimerize the MUC1* extracellular domain. Preferably, suitable antibodies in this regard include monovalent antibodies such as those generated in lamas and camels, Fabs, scFv's, single domain antibodies (sdAb), scFv-Fc as long as the Fc portion is constructed such that it does not homo-dimerize.

(91) FACS scans show that anti-MUC1* antibodies MN-C2, MN-E6, MN-C3 and MN-C8 specifically bind to MUC1* positive cancer cells and MUC1* transfected cells but not MUC1* or MUC1 negative cells. In one example, a humanized MN-C2 scFv is shown to bind to ZR-75-1, aka 1500, MUC1* positive breast cancer cells (FIG. 4A-C). MN-E6 was shown to bind to MUC1 negative HCT-116 colon cancer cells if an only if they were transfected with MUC1*. MN-E6 also bound to MUC1* positive cancer cells such as ZR-75-1, aka 1500, MUC1* positive breast cancer cells (FIG. 4 D-F). Binding assays such as ELISAs, immunofluorescence, and the like all confirm that MN-C2 and MN-E6 bind to the PSMGFR peptide and to live MUC1 positive cancer cells. Humanized anti-MUC1* antibodies are selected based on their ability to also bind to the PSMGFR peptide or to MUC1 positive cancer cells. FIG. 5 shows that humanized MN-C2 scFv binds with high affinity to the MUC1* peptide PSMGFR with an EC-50 of about 333 nM. Humanized MN-C2 scFv, like Fabs, potently inhibits the growth of MUC1* positive cancer cells as is shown in one example in FIG. 6A, B.

(92) The Fabs of MN-E6 and MN-C2 or the comparable single chain variable regions derived from them potently inhibit the growth of MUC1* positive cancers in vitro and in vivo. In several examples, the Fabs of Anti-MUC1* antibodies inhibited the growth of human MUC1* positive cancers in vivo. In one case, immune-compromised mice were implanted with human breast tumors then treated with MN-E6 Fab after tumor engraftment. FIG. 7A shows that MN-E6 Fab potently inhibited the growth of MUC1* positive breast cancers. Female nu/nu mice implanted with 90-day estrogen pellets were implanted with 6 million T47D human breast cancer cells that had been mixed 50/50 with Matrigel. Mice bearing tumors that were at least 150 mm{circumflex over ( )}3 and had three successive increases in tumor volume were selected for treatment. Animals were injected sub cutaneously twice per week with 80 mg/kg MN-E6 Fab and an equal number of mice fitting the same selection criteria were injected with vehicle alone (A). In another aspect, MN E6 was shown to halt the growth of prostate cancer. FIG. 7B shows that MN-E6 Fab potently inhibited the growth of MUC1* positive prostate cancers. Male NOD/SCID mice were implanted with 6 million DU-145 human prostate cancer cells that had been mixed 50/50 with Matrigel. Mice bearing tumors that were at least 150 mm{circumflex over ( )}3 and had three successive increases in tumor volume were selected for treatment. Animals were injected sub-cutaneously every 48 hours with 160 mg/kg MN-E6 Fab and an equal number of mice fitting the same selection criteria were injected with vehicle alone (B). Tumors were measured independently by two researchers twice per week and recorded. Statistics were blindly calculated by independent statistician, giving a P value of 0.0001 for each. Anti-MUC1* Fab inhibited breast cancer growth and prostate cancer growth. Treatment had no effect on weight, bone marrow cell type or number. The MN-E6 Fab effectively inhibited the growth of the tumors, while the control group's tumors continued to grow until sacrifice. No adverse effects of treatment were observed or detected.

(93) A recombinant MN-E6 was constructed that like the Fab is monomeric. In this case, MN-E6 was humanized. There are a number of methods known to those skilled in the art for humanizing antibodies. In addition to humanizing, libraries of human antibodies can be screened to identify other fully human antibodies that bind to the PSMGFR. A single chain of the humanized MN-E6 variable region, called an scFv, was genetically engineered such that it was connected to the Fc portion of the antibody (SEQ ID NO:256 and 257). Fc regions impart certain benefits to antibody fragments for use as therapeutics. The Fc portion of an antibody recruits complement, which in general means it can recruit other aspects of the immune system and thus amplify the anti-tumor response beyond just inhibiting the target. The addition of the Fc portion also increases the half-life of the antibody fragment (Czajkowsky D M, Hu J, Shao Z and Pleass R J. (2012) Fc-fusion proteins: new developments and future perspectives. EMBO Mol Med. 4(10):1015-1028). However, the Fc portion of an antibody homo-dimerizes, which in the case of anti-MUC1* antibody based therapeutics is not optimal since ligand-induced dimerization of the MUC1* receptor stimulates growth. As can be seen in FIG. 13 B, humanized MN-E6 scFv-Fc is a dimer, in part due to disulfide bonding. Therefore, mutations in the Fc region that resist dimer formation are preferred for anti-MUC1* anti-cancer therapeutics. Deletion of the hinge region (hingeless also called delta hinge or Dhinge in some figures and examples SEQ ID NO: 288 and 289) and other mutations in the Fc region that make the Fc-mutant resistant to dimerization were made. The following mutations were made in the CH3 domain to create a monomeric scFv-Fc fusion protein: Y407R (SEQ ID NO: 278 and 279), F405Q (SEQ ID NO: 280 and 281), T394D (SEQ ID NO: 282 and 283), T366W/L368W (SEQ ID NO: 284 and 285), T364R/L368R (SE ID NO: 286 and 287). FIG. 14 shows photographs of SDS-PAGE characterization of purified MN-E6 scFv-Fc fusion proteins on a non-reducing gels, wherein the Fc portion that was fused to the MN-E6 was either wild type (wt) or mutated as follows: A) F405Q, Y407R, T394D; B) T366W/L368W, T364R/L368R, T366W/L368W or T364R/L368R. Fc mutants F405Q, Y407R, T366W/L368W, T364R/L368R, T366W/L368W and T364R/L368R all favored monomer over dimer formation. FIG. 15 shows FPLC traces of the purification of MN-E6 scFv-Fc Y407Q fusion protein that was grown in low IgG FBS over a Protein A affinity column. A) is the trace of the flow through. B) is the trace of the elution. The protein was further purified by size exclusion over an 5200 column (C). (D) is a photograph of an SDS-PAGE gel showing which fractions had a predominance of monomer. FIG. 16 shows a photograph of SDS-PAGE characterization of purified MN-E6 scFv-Fc-mutant fusion proteins on a non-reducing gel, wherein the Fc portion that was fused to the MN-E6 scFv was either wild type (wt) or mutated by elimination of the hinge region, ‘DHinge’, of the Fc or elimination of the hinge region of the Fc and also bearing the Y407R mutation. All the Fc mutants favored monomer over dimer formation. The reference construct amino acid sequence for the indicated mutation is SEQ ID NO:273. Other relevant sequences are SEQ ID NOS:289 and 279. FIG. 17A-C. A and B show photograph of non-reducing SDS-PAGE characterization of large scale expression and purification of MN-E6 scFv-Fc hingeless mutant, showing that it is a monomer. FPLC characterization and purification of MN-E6 scFv-Fc hingeless mutant is shown (C). FIG. 18A-C shows photographs of the SDS-PAGE characterization of the purified MN-C3 scFv-Fc fusion protein on a non-reducing gel (A) or a reducing gel (B). The protein was purified by size exclusion. The FPLC trace is shown (C). FIG. 19 A-B shows photographs of Native gels of MN-C3 or MN-E6 Fabs, scFv, scFv-Fc, wherein the Fc portion is wild type or mutants that prefer or are exclusively monomers. Native gels show that the Y407R Fc mutation (A) and the double mutant Y407R and a deleted hinge (B) favor monomer over dimer the best. Note that proteins are loaded onto a gel at much higher concentrations than typical use concentrations. The dimer formation of other Fc mutants may only reflect the fact that loading concentration is very high.

(94) Some mutations or deletions were so effective that, even when loaded onto a gel at high concentrations, they resist dimer formation (FIG. 14A, B). The Y407R mutation results in a nearly pure population of dimeric scFv-Fc (FIG. 10). Similarly deletions of the hinge region of the Fc result in fusion proteins that are monomers rather than dimers. Combinations of mutations can result in even more effective resistance of dimer formation (FIGS. 16 and 17). These and other mutations and combinations thereof were introduced into CH2-CH3 (SEQ ID NO:274 and 275) and CH3 (SEQ ID NO:276 and 277) fusion proteins such as scFv or in the hingeless Fc-fusion proteins such as scFv and were shown to eliminate or minimize dimerization.

(95) Like the parent mouse monoclonal antibodies, human or humanized antibodies as well as single chain constructs, scFv's, scFv-Fc fusions or scFv-Fc-mutants specifically bind to the synthetic MUC1* peptides (FIGS. 20-22). Figure E23 shows a graph of an ELISA assay that quantifies the binding of humanized MN-E6 scFv-Fc-delta hinge, aka Dhinge or hingeless, and humanized MN-E6 scFv to the MUC1* peptide PSMGFR.

(96) The human or humanized anti-MUC1* antibody fragments described here specifically bind to MUC1 and MUC1* positive cancer cells. FIG. 24 shows photographs of immunofluorescence experiments in which humanized MN-C2 scFv or MN-E6 scFv specifically binds to MUC1* positive breast cancer cells in an identical concentration dependent manner. A-G: hu MN-C2 scFv binding to T47D breast cancer cells at concentrations indicated. H-N shows the fluorescently labeled scFv and DAPI. O-U: hu MN-E6 scFv binding to T47D breast cancer cells at concentrations indicated. V-B′ shows the fluorescently labeled scFv and DAPI. C′ is the secondary antibody control.

(97) In addition to binding to MUC1* positive cancer cells, the anti-MUC1* antibody variable region fragments, scFv's, scFv-Fc's and scFv-Fc-mutants inhibited growth of MUC1-positive cancer cells. FIG. 25A-L shows photographs of MUC1* positive breast cancer cells that have been cultured in normal medium or in the presence of humanized MN-E6 scFv. The photographs show killing and/or growth inhibition of MUC1* positive cells by MN-E6 scFv at 5 ug/mL and an even greater effect at 500 ug/mL. FIG. 26A-L shows photographs of MUC1* positive breast cancer cells that have been cultured in normal medium or in the presence of humanized MN-E6 scFv-Fc Dhinge, which is a hingeless or delta hinge mutant. The photographs show killing and/or growth inhibition of MUC1* positive cells by hMN-E6 scFv-Fc Dhinge 5 ug/mL, an even greater effect at 50 ug/mL and yet an even greater effect at 100 ug/mL. FIG. 27 shows a graph of the image analysis of the fluorescent images of FIGS. 25 and 26. Image J was used to quantify the number of cells remaining after 96 hours treatment in humanized MN-E6scFv or MN-E6 scFv-Fc-delta hinge, aka Dhinge. The analysis software uses pixel counting and pixel fluorescence intensity to quantify the number of cells in each photograph. Analysis was performed over the entire image 512×512 pixels, 8-bit image. For comparison, the inhibition of mouse monoclonal MN-E6 Fab is also analyzed.

(98) These data show that a human or humanized MN-E6 antibody or antibody fragment, Fab, MN-E6 scFv or hu MN-E6 scFv-Fc.sub.mut are effective anti-cancer agents that can be administered to a person diagnosed with a MUC1 or MUC1* positive cancer, suspected of having a MUC1 or MUC1* positive cancer or is at risk of developing a MUC1 or MUC1* positive cancer.

(99) In these specific examples, the dimer resistant Fc that was fused onto an antibody fragment or scFv is hu MN-E7 scFv. However, any of these Fc region mutations or combinations thereof that eliminate or minimize dimerization can be fused onto variable region fragments or single chain constructs of MN-E6, MN-C2, MN-C3 or MN-C8 or other antibodies identified that selectively bind to MUC1* as it exists on cancer cells or tissues. In addition, the Fabs of these antibodies can be used as an anti-cancer therapeutic. In one aspect of the invention, a person diagnosed with, suspected of having or is at risk of developing a MUC1* or MUC1 positive cancer is treated with an effective amount of human or humanized MN-E6 scFv, MN-C2 scFv, MN-C3 scFv, or MN-C8 scFv. In another aspect of the invention, a person diagnosed with, suspected of having or is at risk of developing a MUC1* or MUC1 positive cancer is treated with an effective amount of human or humanized MN-E6 scFv-Fc.sub.Y407R, MN-C2 scFv-Fc.sub.Y407R, MN-C3 scFv-Fc.sub.Y407R, or MN-C8 scFv-Fc.sub.Y407R. In another aspect of the invention, a person diagnosed with, suspected of having or is at risk of developing a MUC1* or MUC1 positive cancer is treated with an effective amount of human or humanized MN-E6 scFv-Fc mutant.sub.Dhinge, MN-C2 scFv-Fc mutant.sub.Dhinge, MN-C3 scFv-Fc mutant.sub.Dhinge, or MN-C8 scFv-Fc mutant.sub.Dhinge. In yet another aspect of the invention, a person diagnosed with, suspected of having or is at risk of developing a MUC1* or MUC1 positive cancer is treated with an effective amount of human or humanized MN-E6 scFv-Fc mutant.sub.Y407R-Dhinge, MN-C2 scFv-Fc mutant.sub.Y407R-Dhinge, MN-C3 scFv-Fc mutant.sub.Y407R-Dhinge, or MN-C8 scFv-Fc mutant.sub.Y407R-Dhinge. One aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein the patient is administered an effective amount of a monomeric MN-E6 scFv, MN-C2 scFv, MN-C3 scFv, MN-C8 scFv, or MN-E6 scFv-Fc, MN-C2 scFv-Fc, MN-C3 scFv-Fc, MN-C8 scFv-Fc, wherein the Fc portion of the antibody-like protein has been mutated such that it resists dimer formation.

(100) Humanizing

(101) Humanized antibodies or antibody fragments or fully human antibodies that bind to the extracellular domain of-MUC1* are preferred for therapeutic use. The techniques described herein for humanizing antibodies are but a few of a variety of methods known to those skilled in the art. The invention is not meant to be limited by the technique used to humanize the antibody.

(102) Humanization is the process of replacing the non-human regions of a therapeutic antibody (usually mouse monoclonal antibody) by human one without changing its binding specificity and affinity. The main goal of humanization is to reduce immunogenicity of the therapeutic monoclonal antibody when administered to human. Three distinct types of humanization are possible. First, a chimeric antibody is made by replacing the non-human constant region of the antibody by the human constant region. Such antibody will contain the mouse Fab region and will contain about 80-90% of human sequence. Second, a humanized antibody is made by grafting of the mouse CDR regions (responsible of the binding specificity) onto the variable region of a human antibody, replacing the human CDR (CDR-grafting method). Such antibody will contain about 90-95% of human sequence. Third and last, a full human antibody (100% human sequence) can be created by phage display, where a library of human antibodies is screened to select antigen specific human antibody or by immunizing transgenic mice expressing human antibody.

(103) A general technique for humanizing an antibody is practiced approximately as follows. Monoclonal antibodies are generated in a host animal, typically in mice. Monoclonal antibodies are then screened for affinity and specificity of binding to the target. Once a monoclonal antibody that has the desired effect and desired characteristics is identified, it is sequenced. The sequence of the animal-generated antibody is then aligned with the sequences of many human antibodies in order to find human antibodies with sequences that are the most homologous to the animal antibody. Biochemistry techniques are employed to paste together the human antibody sequences and the animal antibody sequences. Typically, the non-human CDRs are grafted into the human antibodies that have the highest homology to the non-human antibody. This process can generate many candidate humanized antibodies that need to be tested to identify which antibody or antibodies has the desired affinity and specificity.

(104) Once a human antibody or a humanized antibody has been generated it can be further modified for use as an Fab fragment, as a full antibody, or as an antibody-like entity such as a single chain molecule containing the variable regions, such as scFv or an scFv-Fc. In some cases it is desirable to have Fc region of the antibody or antibody-like molecule mutated such that it does not dimerize.

(105) In addition to methods that introduce human sequences into antibodies generated in non-human species, fully human antibodies can be obtained by screening human antibody libraries with a peptide fragment of an antigen. A fully human antibody that functions like MN-E6 or MN-C2 is generated by screening a human antibody library with a peptide having the sequence of the PSMGFR N-10 peptide. A fully human antibody that functions like MN-C3 or MN-C8 is generated by screening a human antibody library with a peptide having the sequence of the PSMGFR C-10 peptide.

(106) Humanized anti-MUC1* antibodies were generated based on the sequences of the mouse monoclonal antibodies MN-E6, MN-C2, MN-C3 and MN-C8. In one aspect of the invention, a patient diagnosed with a MUC1* positive cancer is treated with an effective amount of humanized MN-E6, MN-C2, MN-C3 or MN-C8. In a preferred embodiment, a patient diagnosed with a MUC1* positive cancer is treated with an effective amount of humanized MN-E6 or MN-C2. In another aspect of the invention, a patient diagnosed with a MUC1* positive cancer is treated with an effective amount of humanized monovalent MN-E6, MN-C2, MN-C3 or MN-C8, wherein monovalent means the corresponding Fab fragment, the corresponding scFv or the corresponding scFv-Fc fusion. In a preferred embodiment, a patient diagnosed with a MUC1* positive cancer is treated with an effective amount of a humanized scFv or monomeric humanized scFv-Fc of MN-E6 or MN-C2. Since the MUC1* growth factor receptor is activated by ligand induced dimerization of its extracellular domain, and because the Fc portion of an antibody homo-dimerizes, it is preferable that a construct that includes an Fc portion uses a mutated Fc region that prevents or minimizes dimerization.

(107) Antibodies that bind to PSMGFR (SEQ ID NO:2) peptide of the extracellular domain of the MUC1* receptor are potent anti-cancer therapeutics that are effective for the treatment or prevention of MUC1* positive cancers. They have been shown to inhibit the binding of activating ligands dimeric NME1 (SEQ ID NOS: 3 and 4) and NME7 (SEQ ID NOS: 5 and 6) to the extracellular domain of MUC1*. Anti-MUC1* antibodies that bind to the PSMGFR sequence inhibit the growth of MUC1*-positive cancer cells, specifically if they inhibit ligand-induced receptor dimerization. Fabs of anti-MUC1* antibodies have been demonstrated to block tumor growth in animals. Thus, antibodies or antibody fragments that bind to the extracellular domain of MUC1* would be beneficial for the treatment of cancers wherein the cancerous tissues express MUC1*.

(108) Antibodies that bind to PSMGFR region of MUC1* or bind to a synthetic PSMGFR peptide are preferred. We have identified several monoclonal antibodies that bind to the extracellular domain of MUC1*. Among this group are mouse monoclonal antibodies MN-E6, MN-C2, MN-C3 and MN-C8, the variable regions of which were sequenced and are given as for MN-E6 SEQ ID NOS: 12-13 and 65-66, for MN-C2 SEQ ID NOS: 118-119 and 168-169, for MN-C3 SEQ ID NOS: 413-414 and 458-459 and for MN-C8 SEQ ID NOS: 505-506 and 543-554. The CDRs of these antibodies make up the recognition units of the antibodies and are the most important parts of the mouse antibody that should be retained when grafting into a human antibody. The sequences of the CDRs for each mouse monoclonal are as follows, heavy chain sequence followed by light chain: MN-E6 CDR1 (SEQ ID NO:16-17 and 69-70) CDR2 (SEQ ID NO:20-21 and 73-74) CDR3 (SEQ ID NO: 24-25 and 77-78), MN-C2 CDR1 (SEQ ID NO:122-123 and 172-173) CDR2 (SEQ ID NO:126-127 and 176-177) CDR3 (SEQ ID NO:130-131 and 180-181), MN-C3 CDR1 (SEQ ID NO:417-418 and 462-463) CDR2 (SEQ ID NO:421-422 and 466-467) CDR3 (SEQ ID NO:425-426 and 470-471), MN-C8 CDR1 (SEQ ID NO:507-508 and 545-546) CDR2 (SEQ ID NO:509-510 and 547-548) CDR3 (SEQ ID NO:511-512 and 549-550). In some cases, portions of the framework regions that by modeling are thought to be important for the 3-dimensional structure of the CDRs, are also imported from the mouse sequence.

(109) Monoclonal antibodies MN-E6 and MN-C2 have greater affinity for MUC1* as it appears on cancer cells. Monoclonal antibodies MN-C3 and MN-C8 have greater affinity for MUC1* as it appears on stem cells. By sequence alignment the following human antibodies were chosen as being sufficiently homologous to the mouse antibody that substitution of the mouse CDRs would result in an antibody that retained ability to recognize the target. Mouse MN-E6 heavy chain variable region was homologous to human IGHV3-21*03 heavy chain variable region (SEQ ID NO: 26-27) and the light chain variable region was homologous to human IGKV3-11*02 light chain variable region (SEQ ID NO: 79-80). Mouse MN-C2 heavy chain variable region was homologous to human IGHV3-21*04 heavy chain variable region (SEQ ID NO: 132-133) and the light chain variable region was homologous to human IGKV7-3*01 light chain variable region (SEQ ID NO: 182-183). Mouse MN-C3 heavy chain variable region was homologous to human IGHV1-18*04 heavy chain variable region (SEQ ID NO: 427-428) and the light chain variable region was homologous to human IGKV2-29*03 light chain variable region (SEQ ID NO:472-473). Mouse MN-C8 heavy chain variable region was homologous to human IGHV3-21*04 heavy chain variable region (SEQ ID NO: 513-514) and the light chain variable region was homologous to human Z00023 light chain variable region (SEQ ID NO:551-552).

(110) All four antibodies have been humanized, which process has resulted in several humanized forms of each antibody. CDRs derived from the variable regions of the mouse antibodies were biochemically grafted into a homologous human antibody variable region sequence. Humanized variable regions of MN-E6 (SEQ ID NOS: 38-39 and 93-94), MN-C2 (SEQ ID NOS: 144-145 and 194-195), MN-C3 (SEQ ID NOS: 439-440 and 486-487) and MN-C8 (SEQ ID NOS: 525-526 and 543-544) were generated by grafting the mouse CDRs into the variable region of a homologous human antibody. The humanized heavy chain variable constructs were then fused into constant regions of either human IgG1 heavy chain constant region (SEQ ID NOS:58-59) or human IgG2 heavy chain constant region (SEQ ID NO:54-55), which are then paired with either humanized light chain variable constructs fused to a human kappa chain (SEQ ID NO: 109-110) or human lambda chain (SEQ ID NO: 113-114) constant region. Other IgG isotypes could be used as constant region including IgG3 or IgG4.

(111) Examples of humanized MN-E6 variable region into an IgG2 heavy chain (SEQ ID NOS:52-53) and into an IgG1 heavy chain (SEQ ID NOS:56-57), humanized MN-C2 variable into an IgG1 heavy chain (SEQ ID NOS: 158-159) or into an IgG2 heavy chain (SEQ ID NOS: 163-164) paired with either Lambda light chain (SEQ ID NO: 111-112 and 216-219) or Kappa chain (SEQ ID NO:107-108 and 210-213) and, humanized MN-C3 (SEQ ID NOS: 455-456, 453-454 and 500-501, 502-503) and MN-C8 (SEQ ID NOS: 541-542, 539-540 and 579-580, 581-582) antibodies were generated. Which IgG constant region is fused to the humanized variable region depends on the desired effect since each isotype has its own characteristic activity. The isotype of the human constant region is selected on the basis of things such as whether antibody dependent cell cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC) is desired but can also depend on the yield of antibody that is generated in cell-based protein expression systems. In a preferred embodiment, humanized anti-MUC1* antibodies or antibody fragments are administered to a person diagnosed with or at risk of developing a MUC1-positive cancer.

(112) One method for testing and selecting the humanized anti-MUC1* antibodies that would be most useful for the treatment of persons with cancer or at risk of developing cancers is to test them for their ability to inhibit the binding of activating ligands to the MUC1* extracellular domain. Dimeric NME1 can bind to and dimerize the MUC1* extracellular domain and in so doing stimulates cancer cell growth. Antibodies and antibody fragments that compete with NME1 for binding to the MUC1* extracellular domain are therefore anti-cancer agents. NME7 is another activating ligand of MUC1*. In some cases, it is preferable to identify antibodies that block the binding of NME7, or an NME7 truncation or cleavage product, to the MUC1* extracellular domain. Antibodies and antibody fragments that compete with NME7 and NME7 variants for binding to the MUC1* extracellular domain are effective as anti-cancer therapeutics. These antibodies include but are not limited to MN-E6, MN-C2, MN-C3, MN-C8 as well as single chain versions, such as scFv, of these antibodies and humanized version thereof. Other NME proteins also bind to MUC1 or MUC1* including NME6 and NME8. Antibodies that compete with these proteins for binding to MUC1* may also be useful as therapeutics. In a preferred embodiment, humanized anti-MUC1* antibodies or antibody fragments are administered to a person diagnosed with or at risk of developing a MUC1-positive cancer. In a more preferred embodiment, single chain antibody fragments, or monomeric scFv-Fc fusions, derived from humanized sequences of MN-E6 and MN-C2 are administered to a person diagnosed with or at risk of developing a MUC1-positive cancer.

(113) Single chain variable fragments, scFv, or other forms that result in a monovalent antibody or antibody-like protein are also useful. In some cases it is desired to prevent dimerization of the MUC1* extracellular domain. Single chain variable fragments, Fabs and other monovalent antibody-like proteins have been shown to be effective in binding to the extracellular domain of MUC1* and blocking MUC1* dimerization. These single chain variable fragments, Fabs and other monovalent antibody-like molecules effectively blocked cancer growth in vitro and in animals xenografted with human MUC1-positive cancer cells. Thus, humanized single chain variable fragments or monovalent anti-MUC1* antibodies or antibody-like molecules would be very effective as an anti-cancer therapeutic. Such humanized single chain antibodies, Fabs and other monovalent antibody-like molecules that bind to the MUC1* extracellular domain or to a PSMGFR peptide are therefore useful as anti-cancer therapeutics. Anti-MUC1* single chain variable fragments are generated by grafting non-human CDRs of antibodies, which bind to extracellular domain of MUC1* or bind to PSMGFR peptide, into a framework of a homologous variable region human antibody. The resultant humanized heavy and light chain variable regions are then connected to each other via a suitable linker, wherein the linker should be flexible and of length that it allows heavy chain binding to light chain but discourages heavy chain of one molecule binding to the light chain of another. For example a linker of about 10-15 residues. Preferably, the linker includes [(Glycine).sub.4 (Serine).sub.1].sub.3 (SEQ ID NOS: 401-402), but is not limited to this sequence as other sequences are possible.

(114) In one aspect, the humanized variable regions of MN-E6 (SEQ ID NOS: 38-39 and 93-94), MN-C2 (SEQ ID NOS: 144-145 and 194-195), MN-C3 (SEQ ID NOS: 439-440 and 486-487) and MN-C8 (SEQ ID NOS: 525-526 and 565-566) are biochemically grafted into a construct that connects heavy and light chains via a linker. Examples of humanized single chain anti-MUC1* antibodies comprising humanized sequences from the variable regions of MN-E6, MN-C2, MN-C3 and MN-C8 were generated. Several humanized MN-E6 single chain proteins were generated (SEQ ID NOS: 232-237). Several humanized MN-C2 single chain proteins were generated (SEQ ID NOS: 238-243). Several humanized MN-C3 single chain proteins were generated (SEQ ID NOS: 244-249). Several humanized MN-C8 single chain proteins were generated (SEQ ID NOS: 250-255). In a preferred embodiment, humanized anti-MUC1* antibody fragments, including variable fragments, scFv antibody fragments MN-E6 scFv, MN-C2 scFv, MN-C3 scFv, or MN-C8 scFv are administered to a person diagnosed with or at risk of developing a MUC1-positive cancer. In a more preferred embodiment, single chain antibody fragments, such as variable fragments derived from humanized sequences of MN-E6 and MN-C2, are administered to a person diagnosed with or at risk of developing a MUC1-positive cancer.

(115) In another aspect, the humanized variable regions of MN-E6 (SEQ ID NOS: 38-39 and 93-94), MN-C2 (SEQ ID NOS: 144-145 and 194-195), MN-C3 (SEQ ID NOS: 439-440 and 486-487) and MN-C8 (SEQ ID NOS: 525-526 and 565-566) are biochemically grafted into a single chain variable fragment, scFv, that also contains an Fc portion of an antibody. Examples of humanized single chain variable fragment of MN-E6, MN-C2, MN-C3 and MN-C8 fused to a Fc region of an antibody were generated (SEQ ID NOS: 256-257, 260-261, 264-265 and 268-269). Inclusion of an Fc region serves several purposes. It increases the molecular weight of the antibody fragment, which slows degradation and increases half-life. An Fc region also recruits immune system complement to the tumor site. Additionally, the addition of an antibody Fc region makes the scFv a convenient diagnostic tool, as the secondary antibodies detect and label the Fc portion. However, the Fc portion homo-dimerizes. Thus an scFv-Fc would be bivalent and could dimerize and activate the MUC1* growth factor receptor. In order to get the benefits of having an Fc attached to an anti-MUC1* scFv, without the drawback of inducing MUC1* dimerization, the Fc region was mutated to minimize or eliminate Fc homo-dimerization. The following mutations were made in the CH3 domain to create a monomeric scFv-Fc fusion protein: Y407R (SEQ ID NOS: 278 and 279), F405Q (SEQ ID NOS: 280 and 281), T394D (SEQ ID NOS: 282 and 283), T366W/L368W (SEQ ID NOD: 284 and 285), T364R/L368R (SEQ ID NOS: 286 and 285). Any combinations of those mutations can be tested and could be introduced into Fc (SEQ ID NOS: 272-273), CH2-CH3 (SEQ ID NOS: 274-275) or CH3 (SEQ ID NOS: 276-277) fusion proteins or in the hingeless Fc-fusion proteins (SEQ ID NOS: 288-289).

(116) One aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein the patient is administered an effective amount of a monomeric MN-E6 scFv, MN-C2 scFv, MN-C3 scFv, MN-C8 scFv, or MN-E6 scFv-Fc, MN-C2 scFv-Fc, MN-C3 scFv-Fc, MN-C8 scFv-Fc, wherein the antibody variable fragment portions are human or have been humanized and wherein the Fc portion of the antibody-like protein has been mutated such that it resists dimer formation.

(117) CAR T and Cancer Immuno Therapy Techniques

(118) In another aspect of the invention, some or all of the single chain portions of anti-MUC1* antibody fragments are biochemically fused onto immune system molecules, using several different chimeric antigen receptor, ‘CAR’ strategies. The idea is to fuse the recognition portion of an antibody, typically as a single chain variable fragment, to an immune system molecule that has a transmembrane domain and a cytoplasmic tail that is able to transmit signals that activate the immune system. The recognition unit can be an antibody fragment, a single chain variable fragment, scFv, or a peptide. In one aspect, the recognition portion of the extracellular domain of the CAR is comprised of sequences from the humanized variable region of MN-E6 (SEQ ID NOS: 38-39 and 93-94), MN-C2 (SEQ ID NOS: 144-145 and 194-195), MN-C3 (SEQ ID NOS: 439-440 and 486-487) and MN-C8 (SEQ ID NOS: 525-526 and 565-566). In another aspect, it is comprised of sequences from a single chain variable fragment. Examples of single chain constructs are given. Several humanized MN-E6 single chain proteins, scFv, were generated (SEQ ID NOS: 232-237). Several humanized MN-C2 single chain proteins, scFv, were generated (SEQ ID NOS: 238-243). Several humanized MN-C3 single chain proteins, scFv, were generated (SEQ ID NOS: 244-249). Several humanized MN-C8 single chain proteins, scFv, were generated (SEQ ID NOS: 250-255). The transmembrane region of the CAR can be derived from CD8, CD4, antibody domains or other transmembrane region, including the transmembrane region of the proximal cytoplasmic co-stimulatory domain. The cytoplasmic tail of the CAR can be comprised of one or more motifs that signal immune system activation. This group of cytoplasmic signaling motifs, sometimes referred to as, co-stimulatory cytoplasmic domains, includes but is not limited to CD3-zeta, CD27, CD28, 4-1BB, 0X40, CD30, CD40, PD-1, ICAm-1, LFA-1, ICOS, CD2, CD5, CD7 and Fc receptor gamma domain. A minimal CAR may have the CD3-zeta or an Fc receptor gamma domain then one or two of the above domains in tandem on the cytoplasmic tail. In one aspect, the cytoplasmic tail comprises CD3-zeta, CD28, 4-1BB and/or 0X40. Several examples of humanized MN-E6 CARs were generated: CAR MN-E6 CD3z (SEQ ID NOS: 294-295); CAR MN-E6 CD28/CD3z (SEQ ID NOS: 297-298); CAR MN-E6 4-1BB/CD3z (SEQ ID NOS: 300-301); CAR MN-E6 0X40/CD3z (SEQ ID NOS: 616-617); CAR MN-E6 CD28/0X40/CD3z (SEQ ID NOS: 618-619); CAR MN-E6 CD28/4-1BB/CD3z (SEQ ID NOS: 303-304). Several examples of humanized MN-C2 CARs were generated: CAR MN-C2 CD3z (SEQ ID NOS: 606-607); CAR MN-C2 CD28/CD3z (SEQ ID NOS: 608-609); CAR MN-C2 4-1BB/CD3z (SEQ ID NOS: 610-611); CAR MN-C2 0X40/CD3z (SEQ ID NOS: 612-613); CAR MN-C2 CD28/4-1BB/CD3z (SEQ ID NOS: 306-307); CAR MN-C2 CD28/0X40/CD3z (SEQ ID NOS: 614-615). Humanized MN-C3 CAR was generated: CAR MN-C3 4-1BB/CD3z (SEQ ID NOS: 600-601).

(119) Several examples of humanized MN-E6 CARs with different hinge regions (SEQ ID NOS:345-360) were generated: CAR MN-E6-Fc/8/41BB/CD3z (SEQ ID NOS:310-311); CAR MN-E6 FcH/8/41BB/CD3z (SEQ ID NOS:315-316); CAR MN-E6 Fc/4/41BB/CD3z (SEQ ID NOS:318-319); CAR MN-E6 FcH/4/41BB/CD3z (SEQ ID NOS:321-322);; CAR MN-E6 IgD/8/41BB/CD3z (SEQ ID NOS:323-324); CAR MN-E6 IgD/4/41BB/CD3z (SEQ ID NOS:327-328); CAR MN-E6 X4/8/41BB/CD3z (SEQ ID NOS:330-331); CAR MN-E6 X4/4/41BB/CD3z (SEQ ID NOS:333-334); CAR MN-E6 8+4/4/41BB/CD3z (SEQ ID NOS:336-337). In addition, several humanized MN-C3 single chain variable fragment and humanized MN-C8 single chain variable fragments were also generated.

(120) The extracellular domain recognition unit of a MUC1* targeting CAR can comprise the variable regions of humanized MN-E6, MN-C2, MN-C3 or MN-C8 or other antibody that binds to the PSMGFR portion of MUC1* or a PSMGFR peptide. In one aspect, the extracellular domain recognition unit of a CAR is comprised essentially of a humanized MN-E6, MN-C2, MN-C3 or MN-C8 single chain variable fragment scFv. The transmembrane region of the CAR can be derived from CD8 (SEQ ID NOS:363-364), or can be the transmembrane domain of CD3-zeta, CD28, 41bb, 0X40 or other transmembrane region (SEQ ID NOS:361-372) and the cytoplasmic domain of a CAR with antibody fragment targeting MUC1* extracellular domain can be comprised of one or more selected from the group comprising an immune system co-stimulatory cytoplasmic domain. The group of immune system co-stimulatory domains includes but is not limited to CD3-zeta, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICAm-1, LFA-1, ICOS, CD2, CD5, CD7 and Fc receptor gamma domain (SEQ ID NOS:373-382). Alternatively, the recognition unit portion of a CAR can comprise a peptide wherein the peptide binds to the target. NME7 binds to and activates MUC1*. In one aspect of the invention, the recognition unit of a CAR is a peptide derived from NME7 (SEQ ID NOS: 5-6) or a peptide derived from NME7, including but not limited to NME7 peptide A1 (SEQ ID NO: 7), NME7 peptide A2 (SEQ ID NO: 8), NME7 peptide B1 (SEQ ID NO: 9), NME7 peptide B2 (SEQ ID NO: 10) and NME7 peptide B3 (SEQ ID NO: 11).

(121) Some strategies for generating CARs include a portion of the molecule that dimerizes with itself. In some cases, dimerization of the target is not desirable. Therefore CARs can be constructed such that they heterodimerize. In one case the recognition unit of the first CAR binds to a first target while the recognition unit of the second CAR binds to a second target. Both recognition units can be antibody fragments, both can be peptides or one can be an antibody fragment and the other a peptide. A first target of the CAR can be the extracellular domain of MUC1*. The recognition unit of the CAR would be comprised of an antibody fragment that binds to MUC1* extracellular domain or to a PSMGFR peptide. Alternatively, the recognition unit of the CAR would be comprised of a peptide that binds to MUC1* extracellular domain, such peptides include peptides derived from an NME protein such as NME1 or NME7, more particularly NME7 derived peptides listed as SEQ ID NOS: 7-11. A second target of a heterodimeric CAR may be a peptide or antibody fragment that binds to NME7. Alternatively, a second target of a heterodimeric CAR may be a peptide or antibody fragment that binds to PD1 or other target on a MUC1*-presenting cell. A second target may be a peptide or antibody fragment that binds to NME1. Because it is desirable to prevent dimerization of MUC1 induced by a CAR, heterodimeric CARs can be constructed so that only the extracellular domain of one molecule has an extracellular recognition unit that binds to a target (SEQ ID NOS:584-587). The other molecule can have a truncated extracellular domain that is devoid of a target recognition unit or antibody fragment (SEQ ID NOS:588-599). The CARs described can be transfected or transduced into a cell of the immune system. In a preferred embodiment, a MUC1* targeting CAR is transfected or transduced into a T cell. In one aspect the T cell is a CD3+/CD28+T cell. In another case it is a dendritic cell. In another case it is a B cell. In another case it is a mast cell. The recipient cell can be from a patient or from a donor. If from a donor, it can be engineered to remove molecules that would trigger rejection. Cells transfected or transduced with a CAR of the invention can be expanded ex vivo or in vitro then administered to a patient. Administrative routes are chosen from a group containing but not limited to bone marrow transplant, intravenous injection, in situ injection or transplant. In a preferred embodiment, the MUC1* targeting CAR is administered to a person diagnosed with or at risk of developing a MUC1-positive cancer.

(122) There are many possible anti-MUC1* CAR constructs that can be transduced into T cells or other immune cells for the treatment or prevention of MUC1* positive cancers. CARs are made up of modules and the identity of some of the modules is relatively unimportant, while the identity of other modules is critically important.

(123) Our experiments demonstrate that the antibody recognition fragment at the outermost portion of the CAR is critically important because it targets the immune cell bearing the CAR to the tumor site. The intracellular signaling motifs are also very important but can be interchanged. FIG. 28 shows a schematic of the components of CAR and the various sequences that may be included in a CAR. Referring to FIG. 28,

(124) R1 is: nothing; or

(125) a ligand or a fragment of a ligand of a cancer associated antigen; or

(126) a ligand or a fragment of a ligand of MUC1 or MUC1*; or

(127) an antibody or antibody fragment wherein the antibody or antibody fragment binds to MUC1 or MUC1*; or an antibody or antibody fragment wherein the antibody or antibody fragment binds to PSMGFR*, wherein the antibody may be human or humanized; or an antibody or antibody fragment of MN-E6, MN-C2, MN-C3 or MN-C8 or humanized MN-E6, MN-C2, MN-C3 or MN-C8; or a single chain variable fragment of an antibody, scFv, that binds to a cleaved MUC1 or MUC1*; or a scFv of MN-E6, MN-C2, MN-C3 or MN-C8, which may be humanized; or a peptide that binds to MUC1* or PSMGFR peptide; or is an antibody fragment, a scFv, or a peptide that binds the PSMGFR portion of MUC1*; or is comprised of sequence from the humanized variable region of MN-E6 (SEQ ID NOS: 38-39 and 93-94), MN-C2 (SEQ ID NOS: 144-145 and 194-195), MN-C3 (SEQ ID NOS: 439-440 and 486-487) and MN-C8 (SEQ ID NOS: 525-526 and 565-566). In one aspect R1 is a scFv that binds the PSMGFR portion of MUC1* comprised of sequence from humanized MN-E6 scFv (SEQ ID NOS: 232-237), humanized MN-C2 scFv (SEQ ID NOS: 238-243), humanized MN-C3 scFv (SEQ ID NOS: 244-249) or humanized MN-C8 scFv (SEQ ID NOS: 250-255). In another aspect R1 is a scFv that binds the PSMGFR portion of MUC1* comprised of sequence from humanized MN-E6 scFv (SEQ ID NOS: 232-237) or humanized MN-C2 scFv (SEQ ID NOS: 238-243). In one example R1 is a scFv that binds the PSMGFR portion of MUC1* comprised of sequence from humanized MN-E6 scFv (SEQ ID NOS: 232-237)

(128) R2 is a polypeptide flexible linker that connects the recognition portion to the transmembrane domain of the CAR. In one aspect, R2 can be a polypeptide linker of different length from 5 to 250 amino acids. In another aspect, R2 is a polypeptide linker of human origin. In one aspect R2 can be made of or a modification of the Fc region of a human immunoglobulin (IgG, IgA, IgE, IgM or IgD). I another aspect, R2 can be the hinge region or a modification of the hinge region of a human immunoglobulin (IgG, IgA, IgE, IgM or IgD). In one aspect, R2 can be the hinge region or a modification of the hinge region of a T-cell receptor (CD8a, CD28 or CD4). In one example, R2 is the hinge region of CD8a, the hinge region of human IgD or the Fc domain of human IgG1.

(129) R3 is a transmembrane domain. In one aspect, R3 can be a transmembrane domain or a modification of a transmembrane domain of any transmembrane human proteins. In another aspect, R3 can be a transmembrane domain or a modification of a transmembrane domain from human cell receptor. In one aspect, R3 can be a transmembrane domain or a modification of a transmembrane domain of a T-cell receptor (CD8a, CD4, CD28, CD3z, OX40 or 41-BB). In another aspect, R3 is a transmembrane domain from the first cytoplasmic co-stimulatory domain of the CAR. In one aspect, R3 can be a transmembrane domain or a modification of a transmembrane domain of a T-cell receptor extended with 1,2,3,4 or 5 amino acids of the cytoplasmic domain associated to the transmembrane domain. In another aspect, R3 can be a transmembrane domain or a modification of a transmembrane domain of a T-cell receptor extended with 1,2,3,4 or five amino acids of the cytoplasmic domain associated to the transmembrane domain followed by a cystein for disulfide bond formation. In one example, R3 is the transmembrane domain of CD8a or CD4.

(130) R4 is a signaling domain from a T-cell receptor. In one aspect, R4 can be the cytoplasmic signaling domain of CD3-zeta, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICAm-1, LFA-1, ICOS, CD2, CDS, CD7 and Fc receptor gamma domain. In one example, R4 is the cytoplasmic domain of CD3-zeta. Several examples of humanized CAR with single signaling domain (CAR I) were regenerated: CAR MN-E6 CD3z (SEQ ID NOS: 294-295); CAR MN-C2 CD3z (SEQ ID NOS: 606-607)

(131) R5 is a co-stimulatory domain from a T-cell receptor. In one aspect, R5 can be the cytoplasmic signaling domain of CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICAm-1, LFA-1, ICOS, CD2, CDS, CD7 and Fc receptor gamma domain. R5 will be different from R4 and R6. In one example, R5 is the cytoplasmic domain of CD28, 4-1BB or OX40. Several examples of humanized CAR with two signaling domain (CAR II) were regenerated: CAR MN-E6 CD28/CD3z (SEQ ID NOS: 297-298); CAR MN-E6 4-1BB/CD3z (SEQ ID NOS: 300-301); CAR MN-E6 0X40/CD3z (SEQ ID NOS: 616-617); CAR MN-C2 CD28/CD3z (SEQ ID NOS: 608-609); CAR MN-C2 4-1BB/CD3z (SEQ ID NOS: 610-611); CAR MN-C2 0X40/CD3z (SEQ ID NOS: 612-613); MN-C3 4-1BB/CD3z (SEQ ID NOS: 600-601); CAR MN-E6-Fc/8/41BB/CD3z (SEQ ID NOS:310-311); CAR MN-E6 FcH/8/41BB/CD3z (SEQ ID NOS:315-316); CAR MN-E6 Fc/4/41BB/CD3z (SEQ ID NOS:318-319); CAR MN-E6 FcH/4/41BB/CD3z (SEQ ID NOS:321-322);; CAR MN-E6 IgD/8/41BB/CD3z (SEQ ID NOS:323-324); CAR MN-E6 IgD/4/41BB/CD3z (SEQ ID NOS:327-328); CAR MN-E6 X4/8/41BB/CD3z (SEQ ID NOS:330-331); CAR MN-E6 X4/4/41BB/CD3z (SEQ ID NOS:333-334); CAR MN-E6 8+4/4/41BB/CD3z (SEQ ID NOS:336-337).

(132) R6 is a co-stimulatory domain from a T-cell receptor. In one aspect, R6 can be the cytoplasmic signaling domain of CD27, CD28, 4-1BB, 0X40, CD30, CD40, PD-1, ICAm-1, LFA-1, ICOS, CD2, CD5, CD7 and Fc receptor gamma domain. R6 will be different from R4 and R5. In one example, R5 is the cytoplasmic domain of CD28. Several examples of humanized CAR with two signaling domain (CAR III) were regenerated: CAR MN-E6 CD28/0X40/CD3z (SEQ ID NOS: 618-619); CAR MN-E6 CD28/4-1BB/CD3z (SEQ ID NOS: 303-304); CAR MN-C2 CD28/4-1BB/CD3z (SEQ ID NOS: 306-307); CAR MN-C2 CD28/0X40/CD3z (SEQ ID NOS: 614-615)

(133) We and others (Pulé MA, Straathof KC, Dotti G, Heslop HE, Rooney CM and Brenner MK. (2005) A chimeric T cell antigen receptor that augments cytokine release and supports clonal expansion of primary human T cells. Mol Ther. 12(5):933-941; Hombach AA, Heiders J, Foppe M, Chmielewski M and Abken H. (2012) 0X40 costimulation by a chimeric antigen receptor abrogates CD28 and IL-2 induced IL-10 secretion by redirected CD4(+) T cells. Oncoimmunology. 1(4):458-466; Kowolik CM, Topp MS, Gonzalez S, Pfeiffer T, Olivares S, Gonzalez N, Smith DD, Forman SJ, Jensen MC and Cooper LJ. (2006) CD28 costimulation provided through a CD19-specific chimeric antigen receptor enhances in vivo persistence and antitumor efficacy of adoptively transferred T cells. Cancer Res. 66(22):10995-11004; Loskog A, Giandomenico V, Rossig C, Pule M, Dotti G and Brenner MK. (2006) Addition of the CD28 signaling domain to chimeric T-cell receptors enhances chimeric T-cell resistance to T regulatory cells. Leukemia. 20(10):1819-1828; Milone MC, Fish JD, Carpenito C, Carroll RG, Binder GK, Teachey D, Samanta M, Lakhal M, Gloss B, Danet-Desnoyers G, Campana D, Riley JL, Grupp SA and June CH. (2009) Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo. Mol Ther. 17(8):1453-1464; Song DG, Ye Q, Carpenito C, Poussin M, Wang LP, Ji C, Figini M, June CH, Coukos G, Powell DJ Jr. (2011) In vivo persistence, tumor localization, and antitumor activity of CAR-engineered T cells is enhanced by costimulatory signaling through CD137 (4-1BB). Cancer Res. 71(13):4617-4627) have shown that intracellular signaling modules, such as CD3-zeta (SEQ ID NOS: 373-376), CD28 (SEQ ID NOS: 377-378) and 41BB (SEQ ID NOS: 379-380), alone or in combinations stimulate immune cell expansion, cytokine secretion and immune cell mediated killing of the targeted tumor cells. Less important is the identity of the short extracellular piece that presents the antibody fragment, the transmembrane domain, and the short cytoplasmic tail that comes before the intracellular signaling motifs.

(134) The identity of the recognition antibody fragment that targets the CAR to a tumor is critically important. For the treatment of MUC1 positive or MUC1* positive cancers, that antibody recognition fragment must bind to the extracellular domain of portion of MUC1 that remains after cleavage and shedding of the bulk of the extracellular domain, which contains the tandem repeat domains. In one aspect of the invention, the portion that remains comprises the PSMGFR sequence. In another aspect of the invention, the portion of MUC1 that remains after cleavage and shedding contains the PSMGFR sequence plus nine (9) more amino acids extended at the N-terminus. In another aspect of the invention, the portion of MUC1 that remains after cleavage and shedding contains the PSMGFR sequence plus twenty one (21) more amino acids extended at the N-terminus. In one aspect the antibody recognition fragment binds to a PSMGFR peptide. In another aspect of the invention, the antibody recognition fragment binds to a peptide comprising the sequence SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620); or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621) As a demonstration, a single chain antibody fragment that included the variable domain of the monoclonal anti-MUC1* antibodies called MN-E6 or MN-C2 were engineered into a panel of CARs. The MUC1* targeting CARs were then transduced, separately or in combinations, into immune cells. When challenged with surfaces presenting a MUC1* peptide, an antigen presenting cell transfected with MUC1*, or MUC1* positive cancer cells, the immune cells that were transduced with MUC1* targeting CARs elicited immune responses, including cytokine release, killing of the targeted cells and expansion of the immune cells. In one case, human jurkat cells were transduced with MUC1*-targeting CARs and upon exposure to a surface presenting the PSMGFR peptide, K562 antigen presenting cells that had been transfected with MUC1* or MUC1* positive cancer cells, the jurkhat cells secreted IL-2. In another case, purified human T cells were transduced with MUC1*-targeting CARs and upon exposure to a surface presenting the PSMGFR peptide, K562 antigen presenting cells that had been transfected with MUC1* or MUC1* positive cancer cells, the T cells secreted IL-2, interferon gamma, and killed the targeted antigen presenting cells and cancer cells, while the T cells expanded. As demonstrated, CARs that comprise an antibody fragment, wherein the antibody fragment is able to bind to the PSMGFR peptide, a transmembrane domain and a cytoplasmic tail bearing co-stimulatory domains, elicit an immune system anti-tumor cell response when said CARs are transduced into immune cells, which include T cells. Therefore, other antibodies, antibody fragments or antibody mimics that are able to bind to the PSMGFR peptide will perform similarly and can be used to treat or prevent cancers. Those skilled in the art will recognize that there are a number of technologies available for transfecting or transducing cells with CARs and the invention is not limited by the method used for making the immune cell express a MUC1*-targeting CAR. For example, retroviruses, adeno viruses, lenti viruses and the like can be used. Similarly, the identity of molecules that make up the non-targeting, portions of the CAR such as the extracellular domain, transmembrane domain and membrane proximal portion of the cytoplasmic domain, are not essential to the function of a MUC1*-targeting CAR. For example, the extracellular domain, transmembrane domain and membrane proximal portion of the cytoplasmic domain can be comprised of portions of CD8, CD4, CD28, or generic antibody domains such as Fc, CH2CH3, or CH3. Further, the non-targeting portions of a CAR can be a composite of portions of one or more of these molecules or other family members.

(135) One aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein the patient is administered an effective amount of immune cells that have been transduced with a MUC1* targeting CAR. In another aspect of the invention, the immune cells are T cells isolated from a patient, which are then transduced with CARs wherein the targeting head of the CAR binds to MUC1*, and after expansion of transduced T cells, the CAR T cells are administered in an effective amount to the patient. In yet another aspect of the invention, the immune cells are T cells isolated from a patient, which are then transduced with CARs wherein the targeting head of the CAR comprises portions of huMN-E6, huMN-C2, huMN-C3 or huMN-C8, and after optional expansion of transduced T cells, the CAR T cells are administered in an effective amount to the patient.

(136) Specifics of CARs Made and Tested

(137) Many MUC1* targeting CARs were generated wherein the targeting antibody fragment at the distal end of the CAR was either MN-E6, MN-C2, MN-C3 or MN-C8. The DNA of each CAR was sequenced to verify that cloning was correctly done. Each construct was then shuffled into an expression plasmid, transfected into cells and then verified that the construct had successfully inserted by Western blot. Surface expression was verified by FACS. The MUC1* targeting CARs were then virally transduced into immune cells. In one aspect they were transduced into Jurkat cells. In another aspect they were transduced into primary human T cells that were purified from blood. A series of functional assays were performed and verified that the CARs were functional. Functional assays showed that both Jurkat cells and primary T cells transduced with MUC1* targeting CAR secreted the cytokine IL-2 when challenged with cells presenting MUC1*. FIG. 29 is a graph of an experiment measuring IL-2 cytokine secretion by Jurkat cells that were transduced with a panel of CARs, including MN-E6 CD8/CD3z, MN-E6 CD8/CD28/CD3z, MN-E6 CD8/41BB/CD3z, MN-E6 CD4/CD28/CD3z and MN-E6 CD4/CD28/41BB/CD3z. IL-2 was secreted only when the CAR Jurkat cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*. It should be noted that the parent K562-wt cells express very low levels of MUC1*. Another group of CARs transfected into Jurkat cells was similarly tested for cytokine secretion. FIG. 30 shows IL-2 secretion by Jurkat T cells that were transduced with MN-E6 CD8/CD28/CD3z, MN-E6 CD8/41BB/CD3z, MN-E6 CD4/CD28/CD3z or MN-E6 CD4/41BB/CD3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*. Similarly, FIG. 31 shows IL-2 cytokine secretion by primary human T cells that were transduced with MN-E6 CD8/CD28/CD3z, MN-E6 CD8/41BB/CD3z or MN-E6 CD4/41BB/CD3z. Cytokine secretion only occurred when the MUC1* targeting CART cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*. Another cytokine that is secreted by activated T cells when they see a target cell is interferon-gamma (IFN-g). FIG. 32 shows that interferon-gamma was secreted by primary human T cells that were transduced with a panel of CARs, including MN-E6 CD8/CD28/CD3z and MN-E6 CD4/41BB/CD3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*. Interferon-gamma was similarly secreted by primary human T cells that were transduced with a panel of CARs, including MN-E6 CD8/CD28/CD3z, MN-E6 CD8/41BB/CD3z and MN-E6 CD8/CD28/41BB/CD3z, when the MUC1* targeting CAR T cells were exposed to K562-wt cells, K562 cells that had been transfected with MUC1*, or MUC1* positive cancer cells of prostate cancer (DU145), breast cancer (1500) or pancreatic cancer (Capan) (FIG. 33).

(138) Another measure of function of CAR T cells is whether or not they induce killing of the targeted cells. T cells transfected with a variety of CARs comprising antibody fragments that bind to the PSMGFR sequence of MUC1* killed MUC1* expressing cells in co-culture assays. In one assay, target MUC1* expressing cells are incubated with calcein. When they are mixed with CAR T cells wherein the CAR comprises an antibody fragment such as MN-E6, MN-C2, MN-C3 or MN-C8 the CAR T cells kill the MUC1* presenting cells which causes the target cells to lyse and releases calcein into the supernatant. FIG. 34 is a graph of an experiment measuring target cell death when primary human T cells, isolated from a blood sample, that were transduced with a panel of CARs, including MN-E6 CD8/CD28/CD3z, MN-E6 CD8/41BB/CD3z and MN-E6 CD4/41BB/CD3z, when the CAR T cells were exposed to K562-wt cells or K562 cells that had been transfected with MUC1*. The ratio of T cells to target cells was 1:1 and the cells were co-cultured for 24 hours. FIG. 35 is a graph of FACS measuring a time course of target cell survival from Day 1 to Day 3. Primary human T cells, isolated from a blood sample, were transduced with a panel of CARs, including humanized MN-E6-CD8-3z, MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were then exposed to K562-wt cells that naturally express low levels of MUC1*, or K562 cells that had been transfected with MUC1* high. The ratio of MUC1* targeting CAR T cells to target cells was either 1:1, 10:1, or 20:1. Surviving cells were detected and measured at Day 1 (A) or Day 3 (B).

(139) FIG. 36 is a graph of FACS measurements of target cell survival at Day 3 of co-culture experiment. Primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-3z, MN-E6-CD8-CD28-3z, MN-E6-CD8-41BB-3z and MN-E6-CD8-CD28-41BB-3z.

(140) The CAR T cells were then exposed to MUC1* positive T47D breast cancer cells or MUC1* positive 1500 aka ZR-75-1 breast cancer cells. The ratio of MUC1* targeting CAR T cells to target cells was either 1:1 or 10:1. As can be seen from the graph, T cells transduced with a MUC1* targeting CAR have a much greater killing effect on MUC1* cancer cells than the untransduced control T cells. In addition, the killing effect is much greater when the ratio of T cells: target cells is increased. FIG. 37 is a graph of FACS measurements of target cell survival at Day 1 of co-culture experiment. Primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-41BB-3z, MN-E6-CD4-41BB-3z, and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were then exposed to the following MUC1* positive cancer cells: T47D breast cancer; capan2 pancreatic cancer; or DU-145 prostate cancer. The ratio of MUC1* targeting CAR T cells to target cells was 5:1. As can be seen from the graph, T cells transduced with a MUC1* targeting CAR have a much greater killing effect on MUC1* cancer cells than the untransduced control T cells. Note that the measurements were taken after 24 hours with only a 5:1 T cell to target cell ratio. Also note that MUC1* targeting CARs that have a CD4 extracellular domain-transmembrane-cytoplasmic tail work equally well as CD8 constructs. FIG. 38 is a graph of FACS measurements of target cell survival at Day 3 of co-culture experiment. Primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-41BB-3z, MN-E6-CD4-41BB-3z, and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were then exposed to the following MUC1* positive cancer cells: K562 leukemia cells transfected with MUC1*; T47D breast cancer; 1500 aka ZR-75-1 breast cancer cells; or CAPAN-2 pancreatic cancer cells. In addition to the untransduced T cell controls, the assay was performed on PC3 MUC1* negative prostate cancer cells. The ratio of MUC1* targeting CAR T cells to target cells was 1:1. As can be seen from the graph, T cells transduced with a MUC1* targeting CAR have a much greater killing effect on MUC1* cancer cells than the untransduced control T cells. In addition, the killing effect is specific for MUC1* positive cells. Note that MUC1* targeting CARs that have a CD4 extracellular domain-transmembrane-cytoplasmic tail work equally well as CD8 constructs. FIG. 39 is a graph of FACS measurements of CART cell expansion over 24 hours in co-culture with target cells at a ratio of 5:1 CAR T cells to target cells. The primary human T cells were transduced with a panel of CARs, including humanized MN-E6-CD8-41BB-3z, MN-E6-CD4-41BB-3z, and MN-E6-CD8-CD28-41BB-3z. The CAR T cells were co-cultured with MUC1* positive T47D breast cancer cells, MUC1* positive Capan pancreatic cancer cells, and MUC1-negative cells HCT-116 colon cancer cells and HEK-293 human embryonic kidney cells. As can be seen from the graph, the CAR T population is increased in the presence of MUC1* positive cells. FIG. 40 shows a photograph of a Western blot of MUC1* targeting CARs. From 1 to 9 are: 1. MN-E6scFv-Fc-8-41BB-CD3z (Human Fc as hinge region with CD8 TM); 2: MN-E6scFv-FcH-8-41BB-CD3z (Human Fc hingeless as hinge region with CD8 TM); 3: MN-E6scFv-Fc-4-41BB-CD3z (Human Fc as hinge region with CD4 TM); 4: MN-E6scFv-FcH-4-41BB-CD3z (Human Fc as hingeless hinge region with CD4 TM); 5: MN-E6scFv-IgD-8-41BB-CD3z (hinge region from human IgD with CD8 TM); 6: MN-E6scFv-IgD-4-41BB-CD3z (hinge region from human IgD with CD4 TM); 7: MN-E6scFv-X4-8-41BB-CD3z (Long flexible linker as hinge region with CD8 TM); 8: MN-E6scFv-X4-4-41BB-CD3z (Long flexible linker as hinge region with CD4 TM); 9: MN-E6scFv-8-4-41BB-CD3z (Hinge region from CD8 and CD4 a with CD4 TM).

(141) FIG. 41 shows graphs of FACS scans of T47D breast cancer cells co-cultured with human T cells that were transduced with MN-E6scFv-Fc-8-41BB-CD3z, MN-E6scFv-FcH-8-41BB-CD3z (hingeless), MN-E6scFv-Fc-4-41BB-CD3z, MN-E6scFv-IgD-8-41BB-CD3z, MN-E6scFv-X4-8-41BB-CD3z and MN-E6scFv-X4-4-41BB-CD3z. T cells and cancer cells were co-cultured at a 1:1 ratio for 48 hours. T cell counts were normalized to an average of all untransduced T cells and target cells were normalized to each specific cell type when co-cultured with untransduced T cells. The graph shows that when the CAR T cells are co-cultured with MUC1* positive cancer cells, the T cell population expands and the targeted cancer cell population decreases.

(142) FIG. 42 shows graphs of FACS scans of T47D breast cancer cells, Capan-2 pancreatic cancer cells, K562-MUC1* transfected cells, and K562-wt cells that were co-cultured with human T cells that were transduced with MN- E6scFv-Fc-8-41BB-CD3z, MN-E6scFv-FcH-8-41BB-CD3z, MN-E6scFv-Fc-4-41BB-CD3z, MN-E6scFv-IgD-8-41BB-CD3z, MN-E6scFv-X4-8-41BB-CD3z and MN-E6scFv-X4-4-41BB-CD3z. T cells and cancer cells were co-cultured at a 1:1 ratio for 48 hours. T cell counts were normalized to an average of all untransduced T cells and target cells were normalized to each specific cell type when co-cultured with untransduced T cells. The graph shows that when the CAR T cells are co-cultured with MUC1* positive cancer cells, the T cell population expands and the targeted cancer cell population decreases.

(143) As these experiments demonstrate, the critical portion of a CAR is the antibody fragment that directs the immune cell to the tumor cell. As we will show in the following section, MN-E6 and MN-C2 are specific for the form of MUC1* that is expressed on tumor cells. The next most important part of a CAR is the cytoplasmic tail bearing immune system co-stimulatory domains. The identity of these domains modulates the degree of immune response but in no way effect the specificity. As shown, the identity of the transmembrane portion of a CAR is the least important. It appears that as long as the transmembrane portion has some flexibility and is long enough to allow the antibody fragment to reach its cognate receptor on the tumor cell, it will suffice. This is demonstrated in FIGS. 40-42. CARs comprising the MN-E6 targeting antibody fragment, and intracellular co-stimulatory domains 41BB and CD3-zeta but having a variety of different extracellular, transmembrane and short cytoplasmic tail all worked in that they specifically killed the targeted cells while stimulating the expansion of the host T cells. These CARs with variable mid-sections are: MN-E6scFv-Fc-8-41BB-CD3z (Human Fc as hinge region with CD8 TM); 2: MN-E6scFv-FcH-8-41BB-CD3z (Human Fc hingeless as hinge region with CD8 TM); 3: MN-E6scFv-Fc-4-41BB-CD3z (Human Fc as hinge region with CD4 TM); 4: MN-E6scFv-FcH-4-41BB-CD3z (Human Fc as hingeless hinge region with CD4 TM); 5: MN-E6scFv-IgD-8-41BB-CD3z (hinge region from human IgD with CD8 TM); 6: MN-E6scFv-IgD-4-41BB-CD3z (hinge region from human IgD with CD4 TM); 7: MN-E6scFv-X4-8-41BB-CD3z (Long flexible linker as hinge region with CD8 TM); 8: MN-E6scFv-X4-4-41BB-CD3z (Long flexible linker as hinge region with CD4 TM); 9: MN-E6scFv-8-4-41BB-CD3z (Hinge region from CD8 and CD4 a with CD4 TM).

(144) One aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein the patient is administered an effective amount of immune cells that have been transduced with a MUC1* targeting CAR, wherein the CAR is chosen from among the group consisting of MN-E6-CD8-3z; MN-E6-CD4-3z; MN-E6-CD8-CD28-3z; MN-E6-CD4-CD28-3z; MN-E6-CD8-41BB-3z; MN-E6-CD4-41BB-3z; MN-E6-CD8-CD28-41BB-3z; MN-E6-CD4-CD28-41BB-3z; MN-E6scFv-Fc-8-41BB-CD3z; MN-E6scFv-FcH-8-41BB-CD3z; MN-E6scFv-Fc-4-41BB-CD3z; MN-E6scFv-FcH-4-41BB-CD3z; MN-E6scFv-IgD-8-41BB-CD3z; MN-E6scFv-IgD-4-41BB-CD3z; MN-E6scFv-X4-8-41BB-CD3z; MN-E6scFv-X4-4-41BB-CD3z; MN-E6scFv-8-4-41BB-CD3z, or any of the aforementioned CARs wherein the MN-E6 is replaced by MN-C2, MN-C3 or MN-C8. Another aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a cancer, wherein the patient is administered an effective amount of immune cells that have been transduced with one of the aforementioned CARs wherein the MN-E6 is replaced by a peptide comprising antibody variable domain fragments that are specific for a cancer antigen. In any of the above methods, the immune cell may be a T cell and may further be isolated from the patient to be treated.

(145) Specificity of Anti-MUC1* Targeting Antibodies

(146) The most accurate way of demonstrating antibody specificity is testing the antibody on normal human tissue specimens compared to cancerous tissue specimens. MN-C2 and MN-E6 were shown to specifically bind to MUC1 or MUC1* positive cancer cells. Several breast tumor arrays were assayed using several anti-MUC1 or MUC1* antibodies. Essentially the studies involving serial sections of breast cancer tissue specimens from over 1,200 different breast cancer patients showed that very little full-length MUC1 remains on breast cancer tissues. The vast majority of the MUC1 expressed is MUC1* and is stained by MN-C2. The analysis was performed by Clarient Diagnostics and tissue staining was scored using the Allred method. For example, FIG. 43 shows serial sections of breast cancer tissue arrays that were stained with either VU4H5, a commercially available anti-MUC1 antibody that binds to the tandem repeats, or MN-C2 that binds to MUC1*. FIGS. 43 and 44 are photographs of breast cancer tissue arrays stained with either VU4H5 which recognizes MUC1-FL (full length) or MN-C2 which recognizes cancerous MUC1*. Tissue staining was scored using Allred scoring method which combines an intensity score and a distribution score. Below the photographs of the tissue arrays are color-coded graphs displaying the results. As can be seen, the arrays stained with VU4H5 are very light and many tissues do not stain at all despite the published reports that MUC1 is aberrantly expressed on over 96% of all breast cancers as evidenced by nucleic acid based diagnostics. In contrast, the arrays stained with MN-C2 are very dark (red versus yellow or white in graph). Additionally, many tissues did not stain at all with anti-full-length MUC1 but stained very dark with MN-C2, (see green boxes in graph). Similarly, we stained normal or cancerous breast tissues with humanized MN-E6 scFv-Fc. The antibody fragment was biotinylated so it could be visualized by a secondary streptavidin based secondary. As can be seen in FIG. 45, hMN-E6 scFv-Fc does not stain normal breast tissue but stains cancerous breast tissue. Further, the intensity and homogeneity of staining increases with tumor grade and/or metastatic grade of the patient (FIGS. 45 and 46). Similarly, hMN-E6 scFv-Fc did not stain normal lung tissue but did stain lung cancer tissue (FIGS. 47-51) and the intensity and distribution of staining increased as tumor grade or metastatic grade increased. FIG. 52 shows photographs of normal small intestine and cancerous small intestine tissues stained with humanized MN-E6-scFv-Fc biotinylated anti-MUC1* antibody at 5 ug/mL, then stained with a secondary streptavidin HRP antibody. A) is a normal small intestine tissue. B) is small intestine cancer from patient as denoted in the figure. C,D are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 53 shows photographs of normal small intestine tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are normal small intestine tissue. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 54 shows photographs of cancerous small intestine tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are cancerous small intestine tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 55 shows photographs of cancerous small intestine tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are cancerous small intestine tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 56 shows photographs of normal colon tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are normal colon. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 57 shows photographs of colon cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are colon cancer tissue from a metastatic patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 58 shows photographs of colon cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are colon cancer tissue from a Grade 2 patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 59 shows photographs of colon cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are colon cancer tissue from a metastatic patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 60 shows photographs of prostate cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are prostate cancer tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 61 shows photographs of prostate cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are prostate cancer tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone. FIG. 62 shows photographs of prostate cancer tissues stained with humanized MN-E6-scFv-Fc anti-MUC1* antibody at 50 ug/mL, then stained with a secondary goat-anti-human HRP antibody. A-D are prostate cancer tissue from a patient as denoted in figure. E-H are photographs of the corresponding serial sections that were stained with the secondary antibody alone.

(147) One aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein a specimen is obtained from the patient's cancer and is tested for reactivity with an antibody that binds to PSMGFR SEQ ID NO:2, SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620) or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621).

(148) The patient is then treated with an scFv, scFv-Fc or CAR T that comprises antibody variable fragments from the antibody that reacted with their cancer specimen. Another aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein a specimen is obtained from the patient's cancer and is tested for reactivity with MN-E6-scFv, MN-C2-scFv, MN-C3-scFv or MN-C8-scFv; the patient is then treated with the scFv, scFv-Fc-mut or CAR T that comprises portions of the antibody that reacted with their cancer specimen.

(149) BiTEs

(150) Divalent (or bivalent) single-chain variable fragments (di-says, bi-scFvs) can be engineered by linking two says. This can be done by producing a single peptide chain with two V.sub.H and two V.sub.L regions, yielding tandem scFvs. Another possibility is the creation of scFvs with linker peptides that are too short for the two variable regions to fold together (about five amino acids), forcing scFvs to dimerize. This type is known as diabodies. Diabodies have been shown to have dissociation constants up to 40-fold lower than corresponding scFvs, meaning that they have a much higher affinity to their target. Consequently, diabody drugs could be dosed much lower than other therapeutic antibodies and are capable of highly specific targeting of tumors in vivo. Still shorter linkers (one or two amino acids) lead to the formation of trimmers, so-called triabodies or tribodies. Tetrabodies have also been produced. They exhibit an even higher affinity to their targets than diabodies.

(151) All of these formats can be composed from variable fragments with specificity for two different antigens, in which case they are types of bispecific antibodies. The furthest developed of these are bispecific tandem di-scFvs, known as hi-specific I-cell engagers (BiTE antibody constructs). BiTEs are fusion proteins consisting of two scFvs of different antibodies, on a. single peptide chain of about 55 kilodaltons. One of the scFvs may bind to T cells such as via. the CD3 receptor, and the other to a tumor cell via a tumor specific molecule, such aberrantly expressed MUC1*.

(152) Another aspect of the invention is a method for treating a patient diagnosed with, suspected of having, or at risk of developing a MUC1 positive or MUC1* positive cancer, wherein the patient is administered an effective amount of a BiTE wherein one antibody variable fragment of the BiTE binds to a T cell surface antigen and the other antibody variable fragment of the BiTE binds to PSMGFR SEQ ID NO:2, SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620) or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621). In one case, the antibody variable fragment of the BiTE that binds to MUC1* comprises portions of huMN-E6, huMN-C2, huMN-C3, or huMN-C8.

(153) In another aspect of the invention, MUC1* peptides including PSMGFR SEQ ID NO:2, most or all of SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620) or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621) are used in adoptive T cell approaches. In this case, a patient's T cells are exposed to the MUC1* peptides and through various rounds of maturation, the T cells develop MUC1* specific receptors. The adapted T cells are then expanded and administered to the donor patient who is diagnosed with, suspected of having, or is at risk of developing a MUC1* positive cancer.

(154) Other MUC1 Cleavage Sites

(155) However, MUC1 is cleaved to the growth factor receptor form, MUC1*, on some healthy cells in addition to cancer cells. For example, MUC1 is cleaved to MUC1* on healthy stem and progenitor cells. A large percentage of bone marrow cells are MUC1* positive. Portions of the intestine are MUC1* positive.

(156) The inventors have discovered that MUC1 can be cleaved at different positions that are relatively close to each other but the location of cleavage changes the fold of the remaining portion of the extracellular domain. As a result, monoclonal antibodies can be identified that bind to MUC1* cleaved at a first position but do not bind to MUC1* that has been cleaved at a second position. This discovery is disclosed in WO2014/028668, filed Aug. 14, 2013, the contents of which are incorporated by reference herein its entirety. We identified a set of anti-MUC1* monoclonal antibodies that bind to a MUC1* as it appears on cancer cells but do not bind to MUC1* as it appears on stem and progenitor cells. Conversely, we identified a second set of monoclonal antibodies that bind to stem and progenitor cells but do not bind to cancer cells. One method used to identify stem specific antibodies is as follows: supernatants from monoclonal hybridomas were separately adsorbed onto 2 multi-well plates. Stem cells, which are non-adherent cells, were put into one plate and cancer cells which are adherent were put into an identical plate. After an incubation period, the plates were rinsed and inverted. If the non-adherent stem cells stuck to the plate, then the monoclonal in that particular well recognizes stem cells and will not recognize cancer cells. Antibodies that did not capture stem cells or antibodies that captured cancer cells were identified as cancer specific stem cells. FACS analysis has confirmed this method works. Antibodies MN-E6 and MN-C2 are examples of cancer-specific antibodies. Antibodies MN-C3 and MN-C8 are examples of stem-specific antibodies. Although both sets of antibodies are able to bind to a peptide having the PSMGFR sequence, FACS analysis shows that the anti-MUC1* polyclonal antibody and MN-C3 bind to MUC1* positive bone marrow cells but MN-E6 does not. The MUC1* polyclonal antibody was generated by immunizing a rabbit with the PSMGFR peptide. Similarly, MN-C3 binds to stem cells of the intestinal crypts but MN-E6 does not. Conversely, MN-E6 antibody binds to cancerous tissue while the stem-specific MN-C3 does not. Competition ELISA experiments indicate that the C-terminal 10 amino acids of the PSMGFR peptide are required for MN-E6 and MN-C2 binding, but not for MN-C3 and MN-C8. Therefore, another method for identifying antibodies that are cancer specific is to immunize with a peptide having the sequence of the PSMGFR peptide minus the 10 N-terminal amino acids or use that peptide to screen for antibodies or antibody fragments that will be cancer specific. Antibodies that bind to a peptide with a sequence of PSMGFR peptide minus the N-terminal 10 amino acids but do not bind to a peptide with a sequence of PSMGFR peptide minus the C-terminal 10 amino acids are cancer specific antibodies for use in the treatment or prevention of cancers.

(157) The extracellular domain of MUC1 is also cleaved on stem cells and some progenitor cells, where activation of cleaved MUC1 by ligands NME1 in dimer form or NME7 promotes growth and pluripotency and inhibits differentiation. The transmembrane portion of MUC1 that remains after cleavage is called MUC1* and the extracellular domain is comprised essentially of the Primary Sequence of MUC1 Growth Factor Receptor (PSMGFR) sequence. However, the exact site of cleavage can vary depending on cell type, tissue type, or which cleavage enzyme a particular person expresses or overexpresses. In addition to the cleavage site that we previously identified which leaves the transmembrane portion of MUC1* comprising most or all of the PSMGFR SEQ ID NO:2, other cleavage sites result in an extended MUC1* comprised of most or all of SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:620); or SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY (SEQ ID NO:621). The site of MUC1 cleavage affects how the remaining extracellular domain folds. We have identified monoclonal antibodies that bind to cleaved MUC1* on cancer cells but do not bind to cleaved MUC1* as it exists on healthy stem and progenitor cells.

(158) Whereas an anti-MUC1* antibody or antibody-like molecule may be most effective if it competitively inhibits the binding of NME1, NME6, NME8 or NME7 or NME7-AB to MUC1*, for example an antibody that binds to the PSMGFR sequence especially if said antibody is unable to bind to a PSMGFR peptide if the 10 C-terminal amino acids are missing, antibodies or antibody-like molecules that carry a payload need not competitively inhibit the binding of MUC1* ligands to be effective as anti-cancer agents. For example antibodies or antibody-like molecules that are conjugated to a toxin could be effective at killing target cancer cells without necessarily inhibiting binding of the activating ligands. For example, antibodies or antibody-like molecules such as CARs or BiTEs which recruit the patient's immune system to the tumor can be effective as anti-cancer agents even if the antibody fragment targets a portion of MUC1* such that antibody fragment binding does not competitively inhibit the binding of NME1, NME6, NME8, NME7-AB or NME7. In a preferred embodiment the antibody fragment incorporated into a CAR, an adaptive T cell receptor or a BiTE does competitively inhibit the binding of NME1, NME6, NME8, NME7-AB or NME7 to MUC1*.

(159) Antibodies that are able to bind to the extracellular domain of the remaining transmembrane portion block the interaction between the MUC1* extracellular domain and activating ligands and in this way can be used as therapeutic agents, for example for the treatment of cancers. Anti-MUC1* antibodies are also useful for the growth, delivery, identification or isolation of stem cells both in vitro and in vivo.

(160) General Strategy for Using Antibodies, Antibody Fragments and CARs that Target the Extracellular Domain of MUC1*

(161) Monoclonal antibodies MN-C3 and MN-C8 have a greater binding affinity for stem cells than cancer cells. Humanized antibodies and antibody fragments containing sequences derived from the variable regions of MN-C3 and MN-C8 can be used as an adhesion surface coating for human stem cells.

(162) Alternatively, humanized antibodies and antibody fragments containing sequences derived from the variable regions of MN-C3 and MN-C8 can be used to deliver stem cells to a specific location such as for in situ human therapeutics. In one case, a substrate coated with humanized MN-C3 or MN-C8 derived antibodies or antibody fragments is loaded with stem cells then inserted into a patient. In another case, a substrate coated with humanized MN-C3 or MN-C8 derived antibodies or antibody fragments is inserted into a patient in order to recruit the patient's own stem cells to a specific area for therapy. Human therapies in which antibodies that bind to human stem cells will be of therapeutic use include spinal cord repair. Substrates coated with humanized MN-C3 or MN-C8 derived antibodies or antibody fragments are also used to identify or isolate human antibodies. Humanized MN-C3 or MN-C8 derived antibodies can also be used to stimulate the growth of stem cells.

(163) Sequence Listing Free Text

(164) ASCII text file named “6977 3710 Sequence Listing.txt” having byte size of 602659, created Aug. 9, 2020 is incorporated by reference herein.

(165) As regards the use of nucleotide symbols other than a, g, c, t, they follow the convention set forth in WIPO Standard ST.25, Appendix 2, Table 1, wherein k represents t or g; n represents a, c, t or g; m represents a or c; r represents a or g; s represents c or g; w represents a or t and y represents c or t.

(166) TABLE-US-00011 MUC1 Receptor  (Mucin 1 precursor, Genbank Accession number: P15941)  (SEQ ID NO: 1) MTPGTQSPFFLLLLLTVLTVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTT QGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRP APGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVT SAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTA PPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTR PAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGV TSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGST APPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDT RPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHG VTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGS TAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPD TRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAH GVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALG STAPPVHNVTSASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSSV PPLTSSNHSTSPQLSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFR PGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVC VLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL SYTNPAVAAASANL PSMGFR (SEQ ID NO: 2) GTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGA Human NME1 (DNA) (SEQ ID NO: 3) atggccaactgtgagcgtaccttcattgcgatcaaaccagatggggtccagcggggtcttgtgggagagatta tcaagcgttttgagcagaaaggattccgccttgttggtctgaaattcatgcaagcttccgaagatcttctcaa ggaacactacgttgacctgaaggaccgtccattctttgccggcctggtgaaatacatgcactcagggccggta gttgccatggtctgggaggggctgaatgtggtgaagacgggccgagtcatgctcggggagaccaaccctgcag actccaagcctgggaccatccgtggagacttctgcatacaagttggcaggaacattatacatggcagtgattc tgtggagagtgcagagaaggagatcggcttgtggtttcaccctgaggaactggtagattacacgagctgtgct cagaactggatctatgaatga (amino acids)  (SEQ ID NO: 4) MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPV  VAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCA  QNWIYE-  Human NME7  (DNA)  (SEQ ID NO: 5)  atgaatcatagtgaaagattcgttttcattgcagagtggtatgatccaaatgcttcacttcttcgacgttatg  agcttttattttacccaggggatggatctgttgaaatgcatgatgtaaagaatcatcgcacctttttaaagcg  gaccaaatatgataacctgcacttggaagatttatttataggcaacaaagtgaatgtcttttctcgacaactg  gtattaattgactatggggatcaatatacagctcgccagctgggcagtaggaaagaaaaaacgctagccctaa  ttaaaccagatgcaatatcaaaggctggagaaataattgaaataataaacaaagctggatttactataaccaa  actcaaaatgatgatgctttcaaggaaagaagcattggattttcatgtagatcaccagtcaagaccctttttc  aatgagctgatccagtttattacaactggtcctattattgccatggagattttaagagatgatgctatatgtg  aatggaaaagactgctgggacctgcaaactctggagtggcacgcacagatgcttctgaaagcattagagccct  ctttggaacagatggcataagaaatgcagcgcatggccctgattcttttgcttctgcggccagagaaatggag  ttgttttttccttcaagtggaggttgtgggccggcaaacactgctaaatttactaattgtacctgttgcattg  ttaaaccccatgctgtcagtgaaggactgttgggaaagatcctgatggctatccgagatgcaggttttgaaat  ctcagctatgcagatgttcaatatggatcgggttaatgttgaggaattctatgaagtttataaaggagtagtg  accgaatatcatgacatggtgacagaaatgtattctggcccttgtgtagcaatggagattcaacagaataatg  ctacaaagacatttcgagaattttgtggacctgctgatcctgaaattgcccggcatttacgccctggaactct  cagagcaatctttggtaaaactaagatccagaatgctgttcactgtactgatctgccagaggatggcctatta  gaggttcaatacttcttcaagatcttggataattag  (amino acids)  (SEQ ID NO: 6)  MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQL  VLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFF  NELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDSFASAAREME  LFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVV  TEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLL  EVQYFFKILDN-  NME7 peptides  NME7A peptide 1 (A domain): (SEQ ID NO: 7) MLSRKEALDFHVDHQS  NME7A peptide 2 (A domain): (SEQ ID NO: 8) SGVARTDASES  NME7B peptide 1 (B domain): (SEQ ID NO: 9) DAGFEISAMQMFNMDRVNVE  NME7B peptide 2 (B domain): (SEQ ID NO: 10) EVYKGVVTEYHDMVTE  NME7B peptide 3 (B domain): (SEQ ID NO: 11)  AIFGKTKIQNAVHCTDLPEDGLLEVQYFF  Mouse E6 Heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 12) gaggtgaaggtggtggagtctgggggagacttagtgaagcctggagggtccctgaaactctcctgtgtagtct  ctggattcactttcagtagatatggcatgtcttgggttcgccagactccaggcaagaggctggagtgggtcgc  aaccattagtggtggcggtacttacatctactatccagacagtgtgaaggggcgattcaccatctccagagac  aatgccaagaacaccctgtacctgcaaatgagcagtctgaagtctgaggacacagccatgtatcactgtacaa  gggataactacggtaggaactacgactacggtatggactactggggtcaaggaacctcagtcaccgtctcctc  a  (amino acids)  (SEQ ID NO: 13) EVKVVESGGDLVKPGGSLKLSCVVSGFTFSRYGMSWVRQTPGKRLEWVATISGGGTYIYYPDSVKGRFTISRD  NAKNTLYLQMSSLKSEDTAMYHCTRDNYGRNYDYGMDYWGQGTSVTVSS  Mouse E6 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 14) gaggtgaaggtggtggagtctgggggagacttagtgaagcctggagggtccctgaaactctcctgtgtagtct  ct  (amino acids)  (SEQ ID NO: 15) EVKVVESGGDLVKPGGSLKLSCVVSGFTFS  Mouse E6 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA) (SEQ ID NO: 16) ggattcactttcagtagatatggcatgtct  (amino acids)  (SEQ ID NO: 17) RYGMS  Mouse E6 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 18) tgggttcgccagactccaggcaagaggctggagtgggtcgca  (amino acids)  (SEQ ID NO: 19) WVRQTPGKRLEWVA  Mouse E6 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 20) accattagtggtggcggtacttacatctactatccagacagtgtgaagggg  (amino acids)  (SEQ ID NO: 21) TISGGGTYIYYPDSVKG  Mouse E6 heavy chain variable framework region 3 (FWR3) acid sequence:  (DNA)  (SEQ ID NO: 22) cgattcaccatctccagagacaatgccaagaacaccctgtacctgcaaatgagcagtctgaagtctgaggaca  cagccatgtatcactgtacaagg  (amino acids)  (SEQ ID NO: 23) RFTISRDNAKNTLYLQMSSLKSEDTAMYHCTR  Mouse E6 heavy chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 24) gataactacggtaggaactacgactacggtatggactac  (amino acids)  (SEQ ID NO: 25)  DNYGRNYDYGMDY  IGHV3-21*03 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 26) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtagctatagcatgaactgggtccgccaggctccagggaaggggctggagtgggtctc  atccattagtagtagtagtagttacatatactacgcagactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtgcga  ga  (amino acids)  (SEQ ID NO: 27) EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCAR  IGHV3-21*01 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 28)  gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagt  (amino acids)  (SEQ ID NO: 29) EVQLVESGGGLVKPGGSLRLSCAASGFTFS  IGHV3-21*01 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 30)  agctatagcatgaac  (amino acids)  (SEQ ID NO: 31) SYSMN  IGHV3-21*01 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 32) tgggtccgccaggctccagggaaggggctggagtgggtctca  (amino acids)  (SEQ ID NO: 33) WVRQAPGKGLEWVS  IGHV3-21*01 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 34) tccattagtagtagtagtagttacatatactacgcagactcagtgaagggc  (amino acids)  (SEQ ID NO: 35) SISSSSSYIYYADSVKG  IGHV3-21*01 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 36) cgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggaca  cggctgtgtattactgtgcgaga  (amino acids)  (SEQ ID NO: 37) RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR  Humanized E6 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 38) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgggtctc  aaccattagtggcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctccagagac  aacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtacca  gagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccgtgagcag  c  (amino acids)  (SEQ ID NO: 39) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGRFTISRD  NAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSS  Humanized E6 heavy chain variable framework region 1 (FWR1) acid  sequence:  (DNA)  (SEQ ID NO: 40) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagt  (amino acids)  (SEQ ID NO: 41) VQLVESGGGLVKPGGSLRLSCAASGFTFS  Humanized E6 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 42) aggtatggcatgagc  (amino acids)  (SEQ ID NO: 43) RYGMS  Humanized E6 heavy chain variable framework region 2 (FWR2) acid  sequence:  (DNA)  (SEQ ID NO: 44) tgggtccgccaggctccagggaagaggctggagtgggtctca  (amino acids)  (SEQ ID NO: 45) WVRQAPGKRLEWVS  Humanized E6 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 46) accattagtggcggaggcacctacatatactacccagactcagtgaagggc  (amino acids)  (SEQ ID NO: 47) TISGGGTYIYYPDSVKG  Humanized E6 heavy chain variable framework region 3 (FWR3) acid  sequence:  (DNA)  (SEQ ID NO: 48) cgattcaccatctccagagacaacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgaggaca  cggctgtgtattactgtaccaga  (amino acids)  (SEQ ID NO: 49) RFTISRDNAKNTLYLQMNSLRAEDTAVYYCTR  Humanized E6 heavy chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 50) gataactatggccgcaactatgattatggcatggattat  (amino acids)  (SEQ ID NO: 51) DNYGRNYDYGMDY  Humanized E6 IgG2 heavy chain synthesized by Genescript:  (DNA)  (SEQ ID NO: 52) gaattctaagcttgggccaccatggaactggggctccgctgggttttccttgttgctattttagaaggtgtcc  agtgtgaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgc  agcctctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgg  gtctcaaccattagtggcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctcca  gagacaacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactg  taccagagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccgtg  agcagcgcctccaccaagggcccatcggtcttccccctggcgccctgctccaggagcacctccgagagcacag  ccgccctgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgctctgac  cagcggcgtgcacaccttcccagctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtg  ccctccagcaacttcggcacccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggaca  agacagttgagcgcaaatgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcaggaccgtcagtctt  cctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacgtgcgtggtggtggac  gtgagccacgaagaccccgaggtccagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaa  agccacgggaggagcagttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggct  gaacggcaaggagtacaagtgcaaggtctccaacaaaggcctcccagcccccatcgagaaaaccatctccaaa  accaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccagg  tcagcctgacctgcctggtcaaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggcagcc  ggagaacaactacaagaccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcacc  gtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccact  acacgcagaagagcctctccctgtctccgggtaaatagtaagtttaaactctaga  (amino acids)  (SEQ ID NO: 53) EF*AWATMELGLRWVFLVAILEGVQCEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEW  VSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTV  SSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV  PSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVD  VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISK  TKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLT  VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**V*TLX  Human IgG2 heavy chain constant region sequence:  (DNA)  (SEQ ID NO: 54) gcctccaccaagggcccatcggtcttccccctggcgccctgctccaggagcacctccgagagcacagccgccc  tgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgctctgaccagcgg  cgtgcacaccttcccagctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctcc  agcaacttcggcacccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagacag  ttgagcgcaaatgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcaggaccgtcagtcttcctctt  ccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacgtgcgtggtggtggacgtgagc  cacgaagaccccgaggtccagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccac  gggaggagcagttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggctgaacgg  caaggagtacaagtgcaaggtctccaacaaaggcctcccagcccccatcgagaaaaccatctccaaaaccaaa  gggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcc  tgacctgcctggtcaaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaa  caactacaagaccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcaccgtggac  aagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgc  agaagagcctctccctgtctccgggtaaatag  (amino acids)  (SEQ ID NO: 55) ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS  SNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS  HEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTK  GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVD  KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK  Humanized E6 IgG1 heavy chain sequence:  (DNA)  (SEQ ID NO: 56) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgggtctc  aaccattagtggcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctccagagac  aacgccaagaacccactgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtccca  gagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccgtgagcag  cgctagcaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctgggggcacagcggcc  ctgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcg  gcgtgcacaccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgacagtgccctc  cagcagcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaa  gttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgt  cagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggt  ggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgcc  aagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccagg  actggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccat  ctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaag  aaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatg  ggcagccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaa  gctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcac  aaccactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 57) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGRFTISRD  NAKNPLYLQMNSLRAEDTAVYYCPRDNYGRNYDYGMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA  LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK  VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA  KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK  NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH  NHYTQKSLSLSPGK**  Human IgG1 heavy chain constant region sequence:  (DNA)  (SEQ ID NO: 58) gctagcaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctgggggcacagcggccc  tgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcgg  cgtgcacaccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgacagtgccctcc  agcagcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaag  ttgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtc  agtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtg  gtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgcca  agacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccagga  ctggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatc  tccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaaga  accaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgg  gcagccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaag  ctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcaca  accactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 59) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS  SSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV  VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI  SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK  LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 heavy chain constant region gBLOCK#1 sequence:  (DNA)  (SEQ ID NO: 60) atggcatggattattggggccagggcaccctggtgaccgtgagcagcgctagcaccaagggcccatcggtctt  ccccctggcaccctcctccaagagcacctctgggggcacagcggccctgggctgcctggtcaaggactacttc  cccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccggctgtcctac  agtcctcaggactctactccctcagcagcgtggtgacagtgccctccagcagcttgggcacccagacctacat  ctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttgagcccaaatcttgtgacaaaact  cacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaaccca  aggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga  ggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  Human IgG1 heavy chain constant region gBLOCK#2 sequence:  (DNA)  (SEQ ID NO: 61) tacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtg  tggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaa  agccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacacc  ctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatccca  gcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctgga  ctccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttc  tcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaat  gataagtttaaacccgctgatcagcctcgactgtgccttctagttg  E6 heavy chain variable region overlapping sequence:  (DNA)  (SEQ ID NO: 62) atggcatggattattggggccagggcaccct  IgG1 heavy chain constant region overlapping region sequence:  (DNA)  (SEQ ID NO: 63) tacgtggacggcgtggaggtgcataatgccaag  pCDNA3.1 V5 and pSECTag2 overlapping sequence:  (DNA)  (SEQ ID NO: 64) ccgctgatcagcctcgactgtgccttctagttg  Mouse E6 Light Chain variable region sequence:  (DNA)  (SEQ ID NO: 65) caaattgttctcacccagtctccagcaatcatgtctgcatctccaggggaggaggtcaccctaacct  gcagtgccacctcaagtgtaagttacatacactggttccagcagaggccaggcacttctcccaaact  ctggatttatagcacatccaacctggcttctggagtccctgttcgcttcagtggcagtggatatggg  acctcttactctctcacaatcagccgaatggaggctgaagatgctgccacttattactgccagcaaa  ggagtagttccccattcacgttcggctcggggacaaagttggaaataaaa  (amino acids)  (SEQ ID NO: 66) QIVLTQSPAIMSASPGEEVTLTCSATSSVSYIHWFQQRPGTSPKLWIYSTSNLASGVPVRFSGSGYGTSYSLT  ISRMEAEDAATYYCQQRSSSPFTFGSGTKLEIK  Mouse E6 light chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 67) caaattgttctcacccagtctccagcaatcatgtctgcatctccaggggaggaggtcaccctaacctgc  (amino acids)  (SEQ ID NO: 68) QIVLTQSPAIMSASPGEEVTLTC  Mouse E6 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 69) AGTGCCACCTCAAGTGTAAGTTACATACAC  (amino acids)  (SEQ ID NO: 70) SATSSVSYIH  Mouse E6 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 71) tggttccagcagaggccaggcacttctcccaaactctggatttat  (amino acids)  (SEQ ID NO: 72) WFQQRPGTSPKLWIY  Mouse E6 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 73) agcacatccaacctggcttct  (amino acids)  (SEQ ID NO: 74) STSNLAS  Mouse E6 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 75) ggagtccctgttcgcttcagtggcagtggatatgggacctcttactctctcacaatcagccgaatggaggctg  aagatgctgccacttattactgc  (amino acids)  (SEQ ID NO: 76) GVPVRFSGSGYGTSYSLTISRMEAEDAATYYC  Mouse E6 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 77) cagcaaaggagtagttccccattcacg  (amino acids)  (SEQ ID NO: 78) QQRSSSPFT  IGKV3-11*02 light chain variable region sequence: (DNA) (SEQ ID NO: 79) gaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctctcctgcaggg  ccagtcagagtgttagcagctacttagcctggtaccaacagaaacctggccaggctcccaggctcctcatcta  tgatgcatccaacagggccactggcatcccagccaggttcagtggcagtgggtctgggagagacttcactctc  accatcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcaactggcctcc  (amino acids)  (SEQ ID NO: 80) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA  RFSGSGSGRDFTLTISSLEPEDFAVYYCQQRSNWPP  IGKV3-11*02 light chain variable framework region 1 (FWR1) acid sequence:  (DNA)  (SEQ ID NO: 81) gaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctctcctgc  (amino acids)  (SEQ ID NO: 82) EIVLTQSPATLSLSPGERATLSC  IGKV3-11*02 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 83) agggccagtcagagtgttagcagctacttagcc  (amino acids)  (SEQ ID NO: 84) RASQSVSSYLA  IGKV3-11*02 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 85) tggtaccaacagaaacctggccaggctcccaggctcctcatctat  (amino acids)  (SEQ ID NO: 86) WYQQKPGQAPRLLIY  IGKV3-11*02 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 87) gatgcatccaacagggccact  (amino acids)  (SEQ ID NO: 88) DASNRAT  IGKV3-11*02 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 89) ggcatcccagccaggttcagtggcagtgggtctgggagagacttcactctcaccatcagcagcctagagcctg  aagattttgcagtttattactgt  (amino acids)  (SEQ ID NO: 90) GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC  IGKV3-11*02 light chain variable complementarity determining regions3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 91) cagcagcgtagcaactggcctcc  (amino acids)  (SEQ ID NO: 92) QQRSNWPP  Humanized E6 light chain variable region sequence:  (DNA)  (SEQ ID NO: 93) gaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcacctgcagcg  ccaccagcagtgttagctacatccactggtaccaacagaggcctggccagagccccaggctcctcatctatag  cacctccaacctggccagcggcatcccagccaggttcagtggcagtgggtctgggagcgactacactctcacc  atcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcagctcccctttcacctttg  gcagcggcaccaaagtggaaattaaa  (amino acids)  (SEQ ID NO: 94) EIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGSGSGSDYTLT  ISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIK  Humanized E6 light chain variable framework region 1 (FWR1) acid  sequence:  (DNA)  (SEQ ID NO: 95) gaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcacctgc  (amino acids)  (SEQ ID NO: 96) EIVLTQSPATLSLSPGERATLTC  Humanized E6 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 97) agcgccaccagcagtgttagctacatccac  (amino acids)  (SEQ ID NO: 98) SATSSVSYIH  Humanized E6 heavy light variable framework region 2 (FWR2) acid  sequence:  (DNA)  (SEQ ID NO: 99) tggtaccaacagaggcctggccagagccccaggctcctcatctat  (amino acids)  (SEQ ID NO: 100) WYQQRPGQSPRLLIY  Humanized E6 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 101) agcacctccaacctggccagc  (amino acids)  (SEQ ID NO: 102) STSNLAS  Humanized E6 light chain variable framework region 3 (FWR3) acid  sequence:  (DNA)  (SEQ ID NO: 103) ggcatcccagccaggttcagtggcagtgggtctgggagcgactacactctcaccatcagcagcctagagcctg  aactattttgcagtttattactgt  (amino acids)  (SEQ ID NO: 104) GIPARFSGSGSGSDYTLTISSLEPEDFAVYYC  Humanized E6 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 105) cagcagcgtagcagctcccctttcacc  (amino acids)  (SEQ ID NO: 106) QQRSSSPFT  Humanized E6 Kappa light chain synthesized by Genescript:  (DNA)  (SEQ ID NO: 107) gaattctaagcttgggccaccatggaagccccagcgcagcttctcttcctcctgctactctggctcccagata  ccactggagaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcac  ctgcagcgccaccagcagtgttagctacatccactggtaccaacagaggcctggccagagccccaggctcctc  atctatagcacctccaacctggccagcggcatcccagccaggttcagtggcagtgggtctgggagcgactaca  ctctcaccatcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcagctccccttt  cacctttggcagcggcaccaaagtggaaattaaaaggacggtggctgcaccatctgtcttcatcttcccgcca  tctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggcca  aagtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaa  ggacagcacctacagcctcagcagcaccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcc  tgcgaagtcacccatcagggcctgagctcgcccgtcacaaagagcttcaacaggggagagtgttagtaagttt  aaactctaga  (amino acids)  (SEQ ID NO: 108) EF*AWATMEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLL  IYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKRTVAAPSVFIFPP  SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYA  CEVTHQGLSSPVTKSFNRGEC**V*TLX  Human Kappa light chain constant region sequence:  (DNA)  (SEQ ID NO: 109) aggacggtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctggaactgcctctg  ttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtggataacgccctccaatc  gggtaactcccaggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctgacg  ctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagctcgcccg  tcacaaagagcttcaacaggggagagtgttag  (amino acids)  (SEQ ID NO: 110) RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT  LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC  Humanized E6 lambda light chain sequence:  (DNA)  (SEQ ID NO: 111) gaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcacctgcagcg  ccaccagcagtgttagctacatccactggtaccaacagaggcctggccagagccccaggctcctcatctatag  cacctccaacctggccagcggcatcccagccaggttcagtggcagtgggtctgggagcgactacactctcacc  atcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcagctcccctttcacctttg  gcagcggcaccaaagtggaaattaaaggtcagcccaaggctgccccctcggtcactctgttcccgccctcctc  tgaggagcttcaagccaacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgacagtg  gcctggaaggcagatagcagccccgtcaaggcgggagtggagaccaccacaccctccaaacaaagcaacaaca  agtacgcggccagcagctatctgagcctgacgcctgagcagtggaagtcccacagaagctacagctgccaggt  cacgcatgaagggagcaccgtggagaagacagtggcccctacagaatgttcatagtaa  (amino acids)  (SEQ ID NO: 112) EIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGSGSGSDYTLT  ISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV  AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS**  Humanized lambda light chain constant region sequence:  (DNA)  (SEQ ID NO: 113) ggtcagcccaaggctgccccctcggtcactctgttcccgccctcctctgaggagcttcaagccaacaaggcca  cactggtgtgtctcataagtgacttctacccgggagccgtgacagtggcctggaaggcagatagcagccccgt  caaggcgggagtggagaccaccacaccctccaaacaaagcaacaacaagtacgcggccagcagctatctgagc  ctgacgcctgagcagtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagcaccgtggaga  agacagtggcccctacagaatgttcatagtaa  (amino acids)  (SEQ ID NO: 114) GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLS  LTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS**  Human lambda light chain constant region gBLOCK#3 sequence:  (DNA)  (SEQ ID NO: 115) agcgccaccagcagtgttagctacatccactggtaccaacagaggcctggccagagccccaggctcctcatct  atagcacctccaacctggccagcggcatcccagccaggttcagtggcagtgggtctgggagcgactacactct  caccatcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcagctcccctttcacc  tttggcagcggcaccaaagtggaaattaaaggtcagcccaaggctgccccctcggtcactctgttcccgccct  cctctgaggagcttcaagccaacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgac  agtggcctggaaggcagatagcagccccgtcaaggcgggagtggagaccaccacaccctccaaacaaagcaac  aacaagtacgcggccagcagctatctgagcctgacgcctgagcagtggaagtcccacagaagctacagctgcc  aggtcacgcatgaagggagcaccgtggagaagacagtggcccctacagaatgttcatagtaagtttaaacccg  ctgatcagcctcgactgtgccttctagttg  E6 light chain variable region overlapping sequence:  (DNA)  (SEQ ID NO: 116) agcgccaccagcagtgttagctacatccact  pCDNA3.1 V5 and pSECTag2 overlapping sequence:  (DNA)  (SEQ ID NO: 117) ccgctgatcagcctcgactgtgccttctagttg  Mouse C2 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 118) gaggtccagctggaggagtcagggggaggcttagtgaagcctggagggtccctgaaactctcctgtgcagcct  ctggattcactttcagtggctatgccatgtcttgggttcgccagactccggagaagaggctggagtgggtcgc  aaccattagtagtggtggtacttatatctactatccagacagtgtgaaggggcgattcaccatctccagagac  aatgccaagaacaccctgtacctgcaaatgagcagtctgaggtctgaggacacggccatgtattactgtgcaa  gacttgggggggataattactacgaatacttcgatgtctggggcgcagggaccacggtcaccgtctcctccgc  caaaacgacacccccatctgtctat  (amino acids)  (SEQ ID NO: 119) EVQLEESGGGLVKPGGSLKLSCAASGFTFSGYAMSWVRQTPEKRLEWVATISSGGTYIYYPDSVKGRFTISRD  NAKNTLYLQMSSLRSEDTAMYYCARLGGDNYYEYFDVWGAGTTVTVSSAKTTPPSVY  Mouse C2 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 120) gaggtccagctggaggagtcagggggaggcttagtgaagcctggagggtccctgaaactctcctgtgcagcct  ctggattcactttcagt  (amino acids)  (SEQ ID NO: 121) EVQLEESGGGLVKPGGSLKLSCAASGFTFS  Mouse C2 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 122) ggctatgccatgtct  (amino acids)  (SEQ ID NO: 123) GYAMS  Mouse C2 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 124) tgggttcgccagactccggagaagaggctggagtgggtcgca  (amino acids)  (SEQ ID NO: 125) WVRQTPEKRLEWVA  Mouse C2 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 126) accattagtagtggtggtacttatatctactatccagacagtgtgaagggg  (amino acids)  (SEQ ID NO: 127) TISSGGTYIYYPDSVKG  Mouse C2 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 128) cgattcaccatctccagagacaatgccaagaacaccctgtacctgcaaatgagcagtctgaggtctgaggaca  cggccatgtattactgtgcaaga  (amino acids)  (SEQ ID NO: 129) RFTISRDNAKNTLYLQMSSLRSEDTAMYYCAR  Mouse C2 heavy chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 130) cttgggggggataattactacgaatacttcgatgtc  (amino acids)  (SEQ ID NO: 131) LGGDNYYEYFDV  IGHV3-21*04 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 132) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtagctatagcatgaactgggtccgccaggctccagggaaggggctggagtgggtctc  atccattagtagtagtagtagttacatatactacgcagactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  ga  (amino acids)  (SEQ ID NO: 133) EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCAR  IGHV3-21*04 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 134) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagt  (amino acids)  (SEQ ID NO: 135) EVQLVESGGGLVKPGGSLRLSCAASGFTFS  IGHV3-21*04 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 136) agctatagcatgaac  (amino acids)  (SEQ ID NO: 137) SYSMN  IGHV3-21*04 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 138) gggtccgccaggctccagggaaggggctggagtgggtctca  (amino acids)  (SEQ ID NO: 139) WVRQAPGKGLEWVS  IGHV3-21*04 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 140) tccattagtagtagtagtagttacatatactacgcagactcagtgaagggc  (amino acids)  (SEQ ID NO: 141) SISSSSSYIYYADSVKG  IGHV3-21*04 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 142) cgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggaca  cggccgtgtattactgtgcgaga  (amino acids)  (SEQ ID NO: 143) RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR  Humanized C2 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 144) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtctcctcc  (amino acids)  (SEQ ID NO: 145) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSS  Humanized C2 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 146) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagt  (amino acids)  (SEQ ID NO: 147) EVQLVESGGGLVKPGGSLRLSCAASGFTFS  Humanized C2 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 148) ggctatgccatgagc  (amino acids)  (SEQ ID NO: 149) GYAMS  Humanized C2 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 150) tgggtccgccaggctccagggaaggggctggagtgggtctcaa  (amino acids)  (SEQ ID NO: 151) WVRQAPGKGLEWVS  Humanized C2 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 152) accattagtagtggcggaacctacatatactaccccgactcagtgaagggc  (amino acids)  (SEQ ID NO: 153) TISSGGTYIYYPDSVKG  Humanized C2 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 154) cgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggaca  cggccgtgtattactgtgcgaga  (amino acids)  (SEQ ID NO: 155) RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR  Humanized C2 heavy chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 156) cttgggggggataattactacgaatacttcgatgtc  (amino acids)  (SEQ ID NO: 157) LGGDNYYEYFDV  Humanized C2 IgG1 heavy chain sequence  (DNA)  (SEQ ID NO: 157) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtctcctccgc  tagcaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctgggggcacagcggccctg  ggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcg  tgcacaccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgacagtgccctccag  cagcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagtt  gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 158) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAAL  GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV  EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK  TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN  QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN  HYTQKSLSLSPGK**  Humanized C2 gBLOCK#4 sequence:  (DNA)  (SEQ ID NO: 160) actcactatagggagacccaagctggctagttaagcttgggccaccatggagacagacacactcctgctatgg  gtactgctgctctgggttccaggttccactggtgacgaggtgcagctggtggagtctgggggaggcctggtca  agcctggggggtccctgagactctcctgtgcagcctctggattcaccttcagtggctatgccatgagctgggt  ccgccaggctccagggaaggggctggagtgggtctcaaccattagtagtggcggaacctacatatactacccc  gactcagtgaagggccgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcc  tgagagccgaggacacggccgtgtattactgtgcgagacttgggggggataattactacgaatacttcgatgt  ctggggcaaagggaccacggtcaccgtctcctccgctagcaccaagggcccatcggtcttccccctggcaccc  tcctccaagagcacctctgggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtga  cggtgtcgtggaactcaggcgccctgaccagc  pCDNA3.1 V5 overlapping sequence:  (DNA)  (SEQ ID NO: 161) actcactatagggagacccaagctggctagtt  Human IgG1 constant region overlapping sequence:  (DNA)  (SEQ ID NO: 162) gacggtgtcgtggaactcaggcgccctgaccagc  Humanized C2 IgG2 heavy chain sequence  (DNA)  (SEQ ID NO: 163) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtctcctccgc  ctccaccaagggcccatcggtcttccccctggcgccctgctccaggagcacctccgagagcacagccgccctg  ggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgctctgaccagcggcg  tgcacaccttcccagctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccag  caacttcggcacccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagacagtt  gagcgcaaatgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcaggaccgtcagtcttcctcttcc  ccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacgtgcgtggtggtggacgtgagcca  cgaagaccccgaggtccagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccacgg  gaggagcagttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggctgaacggca  aggagtacaagtgcaaggtctccaacaaaggcctcccagcccccatcgagaaaaccatctccaaaaccaaagg  gcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctg  acctgcctggtcaaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaaca  actacaagaccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaa  gagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcag  aagagcctctccctgtctccgggtaaatagtaa  (amino acids)  (SEQ ID NO: 164) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSASTKGPSVFPLAPCSRSTSESTAAL  GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTV  ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPR  EEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSL  TCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ  KSLSLSPGK**  Humanized C2 gBLOCK#5 sequence:  (DNA)  (SEQ ID NO: 165) tgctctgggttccaggttccactggtgacgcggcccagccggccgaggtgcagctggtggagtctgggggagg  cctggtcaagcctggggggtccctgagactctcctgtgcagcctctggattcaccttcagtggctatgccatg  agctgggtccgccaggctccagggaaggggctggagtgggtctcaaccattagtagtggcggaacctacatat  actaccccgactcagtgaagggccgattcaccatctccagagacaacgccaagaactcactgtatctgcaaat  gaacagcctgagagccgaggacacggccgtgtattactgtgcgagacttgggggggataattactacgaatac  ttcgatgtctggggcaaagggaccacggtcaccgtctcctccgcctccaccaagggcccatcggtcttccccc  tggcgccctgctccaggagcacctccgagagcacagccgccctgggctgcctggtcaaggactacttccccga  accggtgacggtgtcgtggaactcaggcgctctgacca  pSEC Tag2 overlapping sequence:  (DNA)  (SEQ ID NO: 166) tgctctgggttccaggttccactggtgacgc  Human IgG2 constant region overlapping sequence:  (DNA)  (SEQ ID NO: 167) gacggtgtcgtggaactcaggcgctctgacca  Mouse C2 light chain variable region sequence:  (DNA)  (SEQ ID NO: 168) gacattgtgatcacacagtctacagcttccttaggtgtatctctggggcagagggccaccatctcatgcaggg  ccagcaaaagtgtcagtacatctggctatagttatatgcactggtaccaacagagaccaggacagccacccaa  actcctcatctatcttgcatccaacctagaatctggggtccctgccaggttcagtggcagtgggtctgggaca  gacttcaccctcaacatccatcctgtggaggaggaggatgctgcaacctattactgtcagcacagtagggagc  ttccgttcacgttcggaggggggaccaagctggagataaaacgggctgatgctgcaccaactgtatcc  (amino acids)  (SEQ ID NO: 169) DIVITQSTASLGVSLGQRATISCRASKSVSTSGYSYMHWYQQRPGQPPKLLIYLASNLESGVPARFSGSGSGT  DFTLNIHPVEEEDAATYYCQHSRELPFTFGGGTKLEIKRADAAPTVS  Mouse C2 light chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 170) gacattgtgatcacacagtctacagcttccttaggtgtatctctggggcagagggccaccatctcatgc  (amino acids)  (SEQ ID NO: 171) DIVITQSTASLGVSLGQRATISC  Mouse C2 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 172) agggccagcaaaagtgtcagtacatctggctatagttatatgcac  (amino acids)  (SEQ ID NO: 173) RASKSVSTSGYSYMH  Mouse C2 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 174) tggtaccaacagagaccaggacagccacccaaactcctcatctat  (amino acids)  (SEQ ID NO: 175)  WYQQRPGQPPKLLIY  Mouse C2 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 176) cttgcatccaacctagaatc  (amino acids)  (SEQ ID NO: 177) LASNLES  Mouse C2 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 178) tggggtccctgccaggttcagtggcagtgggtctgggacagacttcaccctcaacatccatcctgtggaggag  gaggatgctgcaacctattactgt  (amino acids)  (SEQ ID NO: 179) GVPARFSGSGSGTDFTLNIHPVEEEDAATYYC  Mouse C2 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 180) cagcacagtagggagcttccgttcacg  (amino acids)  (SEQ ID NO: 181) QHSRELPFT  IGKV7-3*01 light chain variable region sequence:  (DNA)  (SEQ ID NO: 182) gacattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacctgcagag  ccagtgagagtgtcagtttcttgggaataaacttaattcactggtatcagcagaaaccaggacaacctcctaa  actcctgatttaccaagcatccaataaagacactggggtcccagccaggttcagcggcagtgggtctgggacc  gatttcaccctcacaattaatcctgtggaagctaatgatactgcaaattattactgtctgcagagtaagaatt  ttcctcccaca  (amino acid)  (SEQ ID NO: 183) DIVLTQSPASLAVSPGQRATITCRASESVSFLGINLIHWYQQKPGQPPKLLIYQASNKDTGVPARFSGSGSGT  DFTLTINPVEANDTANYYCLQSKNFPPT  IGKV7-3*01 light chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO:184) gacattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacctgc  (amino acids)  (SEQ ID NO: 185) DIVLTQSPASLAVSPGQRATITC  IGKV7-3*01 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 186) agagccagtgagagtgtcagtttcttgggaataaacttaattcac  (amino acids)  (SEQ ID NO:187) RASESVSFLGINLIH  IGKV7-3*01 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 188) tggtatcagcagaaaccaggacaacctcctaaactcctgatttac  (amino acids)  (SEQ ID NO: 189) WYQQKPGQPPKLLIY  IGKV7-3*01 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 190) caagcatccaataaagacact  (amino acids)  (SEQ ID NO: 191) QASNKDT  IGKV7-3*01 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 192) ggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagcta  atgatactgcaaattattactgt  (amino acids)  (SEQ ID NO: 193) GVPARFSGSGSGTDFTLTINPVEANDTANYYC  Humanized C2 light chain variable region sequence:  (DNA)  (SEQ ID NO: 194) gacattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacctgcagag  ccagtaagagtgtcagtaccagcggatactcctacatgcactggtatcagcagaaaccaggacaacctcctaa  actcctgatttacctggcatccaatctggagagcggggtcccagccaggttcagcggcagtgggtctgggacc  gatttcaccctcacaattaatcctgtggaagctaatgatactgcaaattattactgtcagcacagtagggagc  tgcctttcacattcggcggagggaccaaggtggagatcaaacgaact  (amino acids)  (SEQ ID NO: 195) DIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGT  DFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRT  Humanized C2 light chain variable framework region 1 (FWR1) acid  sequence:  (DNA)  (SEQ ID NO: 196) gacattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacctgc  (amino acids)  (SEQ ID NO: 197) DIVLTQSPASLAVSPGQRATITC  Humanized C2 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 198) agagccagtaagagtgtcagtaccagcggatactcctacatgcac  (amino acids)  (SEQ ID NO: 199) RASKSVSTSGYSYMH  Humanized C2 heavy light variable framework region 2 (FWR2) acid  sequence:  (DNA)  (SEQ ID NO: 200) tggtatcagcagaaaccaggacaacctcctaaactcctgatttac  (amino acids)  (SEQ ID NO: 201) WYQQKPGQPPKLLIY  Humanized C2 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 202) ctggcatccaatctggagagc  (amino acids)  (SEQ ID NO: 203) LASNLES  Humanized C2 light chain variable framework region 3 (FWR3) acid  sequence:  (DNA)  (SEQ ID NO: 204) ggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagcta  atgatactgcaaattattactgt  (amino acids)  (SEQ ID NO: 205) GVPARFSGSGSGTDFTLTINPVEANDTANYYC  Humanized C2 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 206) cagcacagtagggagctgcctttcaca  (amino acids)  (SEQ ID NO: 207) QHSRELPFT  Humanized C2 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 208) ctgcagagtaagaattttcctcccaca  (amino acids)  (SEQ ID NO: 209) LQSKNFPPT  Humanized C2 gBLOCK#6 sequence (Kappa light chain in pCDNA3.1 V5):  (DNA)  (SEQ ID NO: 210) actcactatagggagacccaagctggctagttaagcttgggccaccatggagacagacacactcctgctatgg  gtactgctgctctgggttccaggttccactggtgacgacattgtgctgacccagtctccagcctccttggccg  tgtctccaggacagagggccaccatcacctgcagagccagtaagagtgtcagtaccagcggatactcctacat  gcactggtatcagcagaaaccaggacaacctcctaaactcctgatttacctggcatccaatctggagagcggg  gtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagctaatg  atactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcggagggaccaaggtggagat  caaacgaactacggtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctggaact  gcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtggataacgccc  tccaatcgggtaactcccaggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagcac  cctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagc  tcgcccgtcacaaagagcttcaacaggggagagtgttagtaagtttaaacccgctgatcagcctcgactgtgc  cttctagttg  pCDNA3.1 V5 5′ overlapping sequence:  (DNA)  (SEQ ID NO: 211) actcactatagggagacccaagctggctagtt  pCDNA3.1 V5 3′ overlapping sequence:  (DNA)  (SEQ ID NO: 212) ccgctgatcagcctcgactgtgccttctagttg  Humanized C2 gBLOCK#7 sequence (Kappa light chain in pSEC Tag2):  (DNA)  (SEQ ID NO: 213) tgctctgggttccaggttccactggtgacgcggcccagccggccgacattgtgctgacccagtctccagcctc  cttggccgtgtctccaggacagagggccaccatcacctgcagagccagtaagagtgtcagtaccagcggatac  tcctacatgcactggtatcagcagaaaccaggacaacctcctaaactcctgatttacctggcatccaatctgg  agagcggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtgga  agctaatgatactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcggagggaccaag  gtggagatcaaacgaactacggtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaat  ctggaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtgga  taacgccctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaaggacagcacctacagcctc  agcagcaccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagg  gcctgagctcgcccgtcacaaagagcttcaacaggggagagtgttagtaagtttaaacccgctgatcagcctc  gactgtgccttctagttg  pSEC Tag2 5′ overlapping sequence:  (DNA)  (SEQ ID NO: 214) tgctctgggttccaggttccactggtgacgc  pSEC Tag2 3′ overlapping sequence:  (DNA)  (SEQ ID NO: 215) ccgctgatcagcctcgactgtgccttctagttg  Humanized C2 gBLOCK#8 sequence (lambda light chain in pCDNA3.1 V5):  (DNA)  (SEQ ID NO: 216) actcactatagggagacccaagctggctagttaagcttgggccaccatggagacagacacactcctgctatgg  gtactgctgctctgggttccaggttccactggtgacgacattgtgctgacccagtctccagcctccttggccg  tgtctccaggacagagggccaccatcacctgcagagccagtaagagtgtcagtaccagcggatactcctacat  gcactggtatcagcagaaaccaggacaacctcctaaactcctgatttacctggcatccaatctggagagcggg  gtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagctaatg  atactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcggagggaccaaggtggagat  caaacgaactggtcagcccaaggctgccccctcggtcactctgttcccgccctcctctgaggagcttcaagcc  aacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgacagtggcctggaaggcagata  gcagccccgtcaaggcgggagtggagaccaccacaccctccaaacaaagcaacaacaagtacgcggccagcag  ctatctgagcctgacgcctgagcagtggaagtcccacagaagctacagctgccaggtcacgcatgaagggagc  accgtggagaagacagtggcccctacagaatgttcatagtaagtttaaacccgctgatcagcctcgactgtgc  cttctagttg  pCDNA3.1 V5 5′ overlapping sequence:  (DNA)  (SEQ ID NO: 217) actcactatagggagacccaagctggctagtt  pCDNA3.1 V5 3′ overlapping sequence:  (DNA)  (SEQ ID NO: 218) ccgctgatcagcctcgactgtgccttctagttg  Humanized C2 gBLOCK#9 sequence (lambda light chain in pSEC Tag2):  (DNA)  (SEQ ID NO: 219) tgctctgggttccaggttccactggtgacgcggcccagccggccgacattgtgctgacccagtctccagcctc  cttggccgtgtctccaggacagagggccaccatcacctgcagagccagtaagagtgtcagtaccagcggatac  tcctacatgcactggtatcagcagaaaccaggacaacctcctaaactcctgatttacctggcatccaatctgg  agagcggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtgga  agctaatgatactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcggagggaccaag  gtggagatcaaacgaactggtcagcccaaggctgccccctcggtcactctgttcccgccctcctctgaggagc  ttcaagccaacaaggccacactggtgtgtctcataagtgacttctacccgggagccgtgacagtggcctggaa  ggcagatagcagccccgtcaaggcgggagtggagaccaccacaccctccaaacaaagcaacaacaagtacgcg  gccagcagctatctgagcctgacgcctgagcagtggaagtcccacagaagctacagctgccaggtcacgcatg  aagggagcaccgtggagaagacagtggcccctacagaatgttcatagtaagtttaaacccgctgatcagcctc  gactgtgccttctagttg  pSEC Tag2 5′ overlapping sequence:  (DNA)  (SEQ ID NO: 220) tgctctgggttccaggttccactggtgacgc  pSEC Tag2 3′ overlapping sequence:  (DNA)  (SEQ ID NO: 221) ccgctgatcagcctcgactgtgccttctagttg  Murine Ig kappa chain leader sequence  (DNA)  (SEQ ID NO: 222) atggagacagacacactcctgctatgggtactgctgctctgggttccaggttccactggtgac  (amino acids)  (SEQ ID NO: 223) METDTLLLWVLLLWVPGSTGD  Interleukin-2 (IL-2) leader sequence  (DNA)  (SEQ ID NO: 224) atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt  (amino acids)  (SEQ ID NO: 225) MYRMQLLSCIALSLALVTNS  CD33 leader sequence  (DNA)  (SEQ ID NO: 226) atgcctcttctgcttctgcttcctctgctttgggctggagctcttgct  (amino acids)  (SEQ ID NO: 227) MPLLLLLPLLWAGALA  IGHV3-21*03 leader sequence  (DNA)  (SEQ ID NO: 228) atggaactggggctccgctgggttttccttgttgctattttagaaggtgtccagtgt  (amino acids)  (SEQ ID NO: 229) MELGLRWVFLVAILEGVQC  IGHV3-11*02 leader sequence  (DNA)  (SEQ ID NO: 230) atggaagccccagcgcagcttctcttcctcctgctactctggctcccagataccactgga  (amino acids)  (SEQ ID NO: 231) MEAPAQLLFLLLLWLPDTTG  Humanized E6 single chain GS3  (DNA)  (SEQ ID NO: 232) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtg  cagcctctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggct  ggagtgggtctcaaccattagtggcggaggcacctacatatactacccagactcagtgaagggccga  ttcaccatctccagagacaacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgagg  acacggctgtgtattactgtaccagagataactatggccgcaactatgattatggcatggattattg  gggccagggcaccctggtgaccgtgagcagcggcggtggcggatccggcggtggcggatccggcggt  ggcggatccgaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagcca  ccctcacctgcagcgccaccagcagtgttagctacatccactggtaccaacagaggcctggccagag  ccccaggctcctcatctatagcacctccaacctggccagcggcatcccagccaggttcagtggcagt  gggtctgggagcgactacactctcaccatcagcagcctagagcctgaagattttgcagtttattact  gtcagcagcgtagcagctcccctttcacctttggcagcggcaccaaagtggaaattaaa  (amino acids)  (SEQ ID NO: 233) EVQLVESGGGLVKPGGSLRLSCAASGFIFSRYGMSWVRQAPGKRLEWVSTISGGGIYIYYPDSVKGRFTISRD  NAKNTLYLQMNSLRAEDTAVYYCIRDNYGRNYDYGMDYWGQGTLVIVSSGGGGSGGGGSGGGGSEIVLIQSPA  ILSLSPGERATLICSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGSGSGSDYILTISSLEPEDF  AVYYCQQRSSSPFTFGSGTKVEIK  Humanized E6 single chain IgGlnoC  (DNA)  (SEQ ID NO: 234) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgggtctc  aaccattagtggcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctccagagac  aacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtacca  gagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccgtgagcag  cgataaaacccatactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtgaaattgtg  ttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcacctgcagcgccaccagca  gtgttagctacatccactggtaccaacagaggcctggccagagccccaggctcctcatctatagcacctccaa  cctggccagcggcatcccagccaggttcagtggcagtgggtctgggagcgactacactctcaccatcagcagc  ctagagcctgaagattttgcagtttattactgtcagcagcgtagcagctcccctttcacctttggcagcggca  ccaaagtggaaattaaa  (amino acids)  (SEQ ID NO: 235) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGRFTISRD  NAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSDKTHTKPPKPAPELLGGPGTGEIV  LTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGSGSGSDYTLTISS  LEPEDFAVYYCQQRSSSPFTFGSGTKVEIK  Humanized E6 single chain X4 (linker is IgG1 and IgG2 modified hinge  region)  (DNA)  (SEQ ID NO: 236) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgggtctc  aaccattagtggcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctccagagac  aacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtacca  gagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccgtgagcag  cgataaaacccatactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtactggtggt  ccgactattaaacctccgaaacctccgaaacctgctccgaacctgctgggtggtccggaaattgtgttgacac  agtctccagccaccctgtctttgtctccaggggaaagagccaccctcacctgcagcgccaccagcagtgttag  ctacatccactggtaccaacagaggcctggccagagccccaggctcctcatctatagcacctccaacctggcc  agcggcatcccagccaggttcagtggcagtgggtctgggagcgactacactctcaccatcagcagcctagagc  ctgaagattttgcagtttattactgtcagcagcgtagcagctcccctttcacctttggcagcggcaccaaagt  ggaaattaaa  (amino acids)  (SEQ ID NO: 237) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGRFTISRD  NAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSDKTHTKPPKPAPELLGGPGTGTGC  PTIKPPKPPKPAPNLLGGPEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLA  SGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIK  Humanized C2 single chain GS3  (DNA)  (SEQ ID NO: 238) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtctcctccgg  cggtggcggatccggcggtggcggatccggcggtggcggatccgacattgtgctgacccagtctccagcctcc  ttggccgtgtctccaggacagagggccaccatcacctgcagagccagtaagagtgtcagtaccagcggatact  cctacatgcactggtatcagcagaaaccaggacaacctcctaaactcctgatttacctggcatccaatctgga  gagcggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaa  gctaatgatactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcggagggaccaagg  tggagatcaaacgaact  (amino acids)  (SEQ ID NO: 239) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPAS  LAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVE  ANDTANYYCQHSRELPFTFGGGTKVEIKRT  Humanized C2 single chain IgG (no Cysteine)  (DNA)  (SEQ ID NO: 240) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtctcctccga  taaaacccatactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtgacattgtgctg  acccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacctgcagagccagtaagagtg  tcagtaccagcggatactcctacatgcactggtatcagcagaaaccaggacaacctcctaaactcctgattta  cctggcatccaatctggagagcggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctc  acaattaatcctgtggaagctaatgatactgcaaattattactgtcagcacagtagggagctgcctttcacat  tcggcggagggaccaaggtggagatcaaacgaact  (amino acids)  (SEQ ID NO: 241) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSDKTHTKPPKPAPELLGGPGTGDIVL  TQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTL  TINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRT  Humanized C2 single chain X4 (linker is IgG1 and IgG2 modified hinge  region)  (DNA)  (SEQ ID NO: 242) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtctcctccga  taaaacccatactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtactggtggtccg  actattaaacctccgaaacctccgaaacctgctccgaacctgctgggtggtccggacattgtgctgacccagt  ctccagcctccttggccgtgtctccaggacagagggccaccatcacctgcagagccagtaagagtgtcagtac  cagcggatactcctacatgcactggtatcagcagaaaccaggacaacctcctaaactcctgatttacctggca  tccaatctggagagcggggtcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaatta  atcctgtggaagctaatgatactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcgg  agggaccaaggtggagatcaaacgaact  (amino acids) (SEQ ID NO: 243) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSDKTHTKPPKPAPELLGGPGTGTGGP  TIKPPKPPKPAPNLLGGPDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLA  SNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRT  Humanized C3 single chain GS3  (DNA)  (SEQ ID NO: 244) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatggg  agtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagac  acatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcga  gaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagcggcggtgg  cggatccggcggtggcggatccggcggtggcggatccgatattgtgatgacccagactccactctctctgtcc  gtcacccctggacagccggcctccatctcctgcaggtctagtcagaccattgtccatagtaatggaaacacct  atttggagtggtacctgcagaagccaggccagtctccacagctcctgatctataaggtttccaaccggttctc  tggagtgccagataggttcagtggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggct  gaggatgttggggtttattactgcttccaaggtagccacgtgcctttcaccttcggcggagggaccaaggtgg  agatcaaacgaact  (amino acids)  (SEQ ID NO: 245) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGRVTMTTD  TSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLS  VTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEA  EDVGVYYCFQGSHVPFTFGGGTKVEIKRT  Humanized C3 single chain IgG1 (no Cysteine)  (DNA)  (SEQ ID NO: 246) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatggg  agtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagac  acatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcga  gaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagcgataaaac  ccatactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtgatattgtgatgacccag  actccactctctctgtccgtcacccctggacagccggcctccatctcctgcaggtctagtcagaccattgtcc  atagtaatggaaacacctatttggagtggtacctgcagaagccaggccagtctccacagctcctgatctataa  ggtttccaaccggttctctggagtgccagataggttcagtggcagcgggtcagggacagatttcacactgaaa  atcagccgggtggaggctgaggatgttggggtttattactgcttccaaggtagccacgtgcctttcaccttcg  gcggagggaccaaggtggagatcaaacgaact  (amino acids)  (SEQ ID NO: 247) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGRVTMTTD  TSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSDKTHTKPPKPAPELLGGPGTGDIVMTQ  TPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLK  ISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRT  Humanized C3 single chain X4 (linker is IgG1 and IgG2 modified hinge  region)  (DNA)  (SEQ ID NO: 248) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatggg  agtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagac  acatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcga  gaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagcgataaaac  ccatactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtactggtggtccgactatt  aaacctccgaaacctccgaaacctgctccgaacctgctgggtggtccggatattgtgatgacccagactccac  tctctctgtccgtcacccctggacagccggcctccatctcctgcaggtctagtcagaccattgtccatagtaa  tggaaacacctatttggagtggtacctgcagaagccaggccagtctccacagctcctgatctataaggtttcc  aaccggttctctggagtgccagataggttcagtggcagcgggtcagggacagatttcacactgaaaatcagcc  gggtggaggctgaggatgttggggtttattactgcttccaaggtagccacgtgcctttcaccttcggcggagg  gaccaaggtggagatcaaacgaact  (amino acids)  (SEQ ID NO: 249) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGRVTMTTD  TSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSDKTHTKPPKPAPELLGGPGTGTGGPTI  KPPKPPKPAPNLLGGPDIVMTQTPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVS  NRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRT  Humanized C8 single chain GS3 (linker is +Gly4Ser1+3)  (DNA)  (SEQ ID NO: 250) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccctgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gactgggcggcgataactattatgaatattggggcaaagggaccacggtcaccgtctcctccggcggtggcgg  atccggcggtggcggatccggcggtggcggatccgacatcgtgatgacccagtctccagactccctggctgtg  tctctgggcgagagggccaccatcaactgcagggccagcaagagtgttagcaccagcggctacagctacatgc  actggtaccagcagaaaccaggacagcctcctaagctgctcatttacctggtgtctaacctggaatccggggt  ccctgaccgattcagtggcagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctgaagat  gtggcagtttattactgtcaacacattcgggaactgaccaggagtgaattcggcggagggaccaaggtggaga  tcaaacgaact  (amino acids)  (SEQ ID NO: 251) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSSGGGGSGGGGSGGGGSDIVMTQSPDSLAV  SLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNLESGVPDRFSGSGSGTDFTLTISSLQAED  VAVYYCQHIRELTRSEFGGGTKVEIKRT  Humanized C8 single chain IgG1 (no Cysteine)  (DNA)  (SEQ ID NO: 252) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccctgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gactgggcggcgataactattatgaatattggggcaaagggaccacggtcaccgtctcctccgataaaaccca  tactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtgacatcgtgatgacccagtct  ccagactccctggctgtgtctctgggcgagagggccaccatcaactgcagggccagcaagagtgttagcacca  gcggctacagctacatgcactggtaccagcagaaaccaggacagcctcctaagctgctcatttacctggtgtc  taacctggaatccggggtccctgaccgattcagtggcagcgggtctgggacagatttcactctcaccatcagc  agcctgcaggctgaagatgtggcagtttattactgtcaacacattcgggaactgaccaggagtgaattcggcg  gagggaccaaggtggagatcaaacgaact  (amino acids)  (SEQ ID NO: 253) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSSDKTHTKPPKPAPELLGGPGTGDIVMTQS  PDSLAVSLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNLESGVPDRFSGSGSGTDFTLTIS  SLQAEDVAVYYCQHIRELTRSEFGGGTKVEIKRT  Humanized C8 single chain X4 (linker is IgG1 and IgG2 modified hinge  region)  (DNA)  (SEQ ID NO: 254) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactacccagactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gactgggcggcgacaattactatgagtattggggcaaagggaccacggtcaccgtctcctccgataaaaccca  tactaaaccgccaaaaccggcgccggaactgctgggtggtcctggtaccggtactggtggtccgactattaaa  cctccgaaacctccgaaacctgctccgaacctgctgggtggtccggacatcgtgatgacccagtctccagact  ccctggctgtgtctctgggcgagagggccaccatcaactgcagggccagcaagagtgttagcaccagcggcta  cagctacatgcactggtaccagcagaaaccaggacagcctcctaagctgctcatttacctggtgtctaacctg  gaatccggggtccctgaccgattcagtggcagcgggtctgggacagatttcactctcaccatcagcagcctgc  aggctgaagatgtggcagtttattactgtcaacacattcgggaactgaccaggagtgaattcggcggagggac  caaggtggagatcaaacgaact  (amino acids)  (SEQ ID NO: 255) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSSDKTHTKPPKPAPELLGGPGTGTGGPTIK  PPKPPKPAPNLLGGPDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNL  ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHIRELTRSEFGGGTKVEIKRT  pSECTag2 E6 scFV-FC  (DNA)  (SEQ ID NO: 256) atggagacagacacactcctgctatgggtactgctgctctgggttccaggttccactggtgacgcgg  cccagccggccgaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgag  actctcctgtgcagcctctggattcaccttcagtaggtatggcatgagctgggtccgccaggctcca  gggaagaggctggagtgggtctcaaccattagtggcggaggcacctacatatactacccagactcag  tgaagggccgattcaccatctccagagacaacgccaagaacaccctgtatctgcaaatgaacagcct  gagagccgaggacacggctgtgtattactgtaccagagataactatggccgcaactatgattatggc  atggattattggggccagggcaccctggtgaccgtgagcagcggcggtggcggatccggcggtggcg  gatccggcggtggcggatccgaaattgtgttgacacagtctccagccaccctgtctttgtctccagg  ggaaagagccaccctcacctgcagcgccaccagcagtgttagctacatccactggtaccaacagagg  cctggccagagccccaggctcctcatctatagcacctccaacctggccagcggcatcccagccaggt  tcagtggcagtgggtctgggagcgactacactctcaccatcagcagcctagagcctgaagattttgc  agtttattactgtcagcagcgtagcagctcccctttcacctttggcagcggcaccaaagtggaaatt  aaagagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggg  gaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggt  cacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggc  gtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtca  gcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaa  agccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtg  tacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaag  gcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagac  cacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagc  aggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgc  agaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 257) METDTLLLWVLLLWVPGSTGDAAQPAEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAP  GKRLEWVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYG  MDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQR  PGQSPRLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEI  KEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG  VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV  YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS  RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  E6 scFC-FC 1 gBLOCk sequence:  (SEQ ID NO: 258) tgctctgggttccaggttccactggtgacgcggcccagccggccgaggtgcagctggtggagtctgg  gggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcctctggattcaccttcagt  aggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgggtctcaaccattagtg  gcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctccagagacaacgc  caagaacaccctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtacc  agagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccg  tgagcagcggcggtggcggatccggcggtggcggatccggcggtggcggatccgaaattgtgttgac  acagtctccagccaccctgtctttgtc  E6 scFC-FC 2 gBLOCk sequence:  (SEQ ID NO: 259) aattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcacctgc  agcgccaccagcagtgttagctacatccactggtaccaacagaggcctggccagagccccaggctcc  tcatctatagcacctccaacctggccagcggcatcccagccaggttcagtggcagtgggtctgggag  cgactacactctcaccatcagcagcctagagcctgaagattttgcagtttattactgtcagcagcgt  agcagctcccctttcacctttggcagcggcaccaaagtggaaattaaagagcccaaatcttgtgaca  aaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccc  cccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtg  agccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaaga  caaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagc  pSECTag2 C2 scFV-FC  (DNA)  (SEQ ID NO: 260) atggagacagacacactcctgctatgggtactgctgctctgggttccaggttccactggtgacgcgg  cccagccggccgaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgag  actctcctgtgcagcctctggattcaccttcagtggctatgccatgagctgggtccgccaggctcca  gggaaggggctggagtgggtctcaaccattagtagtggcggaacctacatatactaccccgactcag  tgaagggccgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcct  gagagccgaggacacggccgtgtattactgtgcgagacttgggggggataattactacgaatacttc  gatgtctggggcaaagggaccacggtcaccgtctcctccggcggtggcggatccggcggtggcggat  ccggcggtggcggatccgacattgtgctgacccagtctccagcctccttggccgtgtctccaggaca  gagggccaccatcacctgcagagccagtaagagtgtcagtaccagcggatactcctacatgcactgg  tatcagcagaaaccaggacaacctcctaaactcctgatttacctggcatccaatctggagagcgggg  tcccagccaggttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagc  taatgatactgcaaattattactgtcagcacagtagggagctgcctttcacattcggcggagggacc  aaggtggagatcaaacgaactgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccag  cacctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgat  ctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttc  aactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaaca  gcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaa  gtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcag  ccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcc  tgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagcc  ggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaag  ctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctc  tgcacaaccactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 261) METDTLLLWVLLLWVPGSTGDAAQPAEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAP  GKGLEWVSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYF  DVWGKGTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHW  YQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGT  KVEIKRTEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF  NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ  PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK  LTVDKSRWQQGNVESCSVMHEALHNHYTQKSLSLSPGK**  C2 scFV-FC 1 gBLOCk sequence:  (DNA)  (SEQ ID NO: 262) tgctctgggttccaggttccactggtgacgcggcccagccggccgaggtgcagctggtggagtctgg  gggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcctctggattcaccttcagt  ggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctcaaccattagta  gtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagacaacgc  caagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcg  agacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcaccgtct  cctccggcggtggcggatccggcggtggcggatccggcggtggcggatccgacattgtgctgaccca  gtctccagcctccttggc  C2 scFV-FC 2 gBLOCk sequence:  (DNA)  (SEQ ID NO: 263) cattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacctgc  agagccagtaagagtgtcagtaccagcggatactcctacatgcactggtatcagcagaaaccaggac  aacctcctaaactcctgatttacctggcatccaatctggagagcggggtcccagccaggttcagcgg  cagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagctaatgatactgcaaattat  tactgtcagcacagtagggagctgcctttcacattcggcggagggaccaaggtggagatcaaacgaa  ctgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctgggggg  accgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtc  acatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcg  tggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcag  c  pSECTag2 C3 scFV-FC  (DNA)  (SEQ ID NO: 264) atggagacagacacactcctgctatgggtactgctgctctgggttccaggttccactggtgacgcgg  cccagccggcccaggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaa  ggtctcctgcaaggcttctggttacacctttaccgactacgccatgaactgggtgcgacaggcccct  ggacaagggcttgagtggatgggagtgatcagcaccttcagcggtaacacaaacttcaaccagaagt  tcaagggcagagtcaccatgaccacagacacatccacgagcacagcctacatggagctgaggagcct  gagatctgacgacacggccgtgtattactgtgcgagaagcgactactacggcccatacttcgactac  tggggccagggcaccaccctgaccgtgtccagcggcggtggcggatccggcggtggcggatccggcg  gtggcggatccgatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggc  ctccatctcctgcaggtctagtcagaccattgtccatagtaatggaaacacctatttggagtggtac  ctgcagaagccaggccagtctccacagctcctgatctataaggtttccaaccggttctctggagtgc  cagataggttcagtggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctga  ggatgttggggtttattactgcttccaaggtagccacgtgcctttcaccttcggcggagggaccaag  gtggagatcaaacgaactgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcac  ctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctc  ccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaac  tggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagca  cgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtg  caaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccc  cgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctga  cctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgga  gaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctc  accgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgc  acaaccactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 265) METDTLLLWVLLLWVPGSTGDAAQPAQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEW  MGVISTFSGNTNFNQKFKGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSG  GGGSGGGGSGGGGSDIVMTQTPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNR  FSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRTEPKSCDKTHTCPPCPAPE  LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL  TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV  EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  C3 GS scFV FC 1 gBLOCk sequence:  (DNA)  (SEQ ID NO: 266) tgctctgggttccaggttccactggtgacgcggcccagccggcccaggttcagctggtgcagtctgg  agctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggcttctggttacacctttacc  gactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatgggagtgatcagca  ccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagacacatc  cacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcg  agaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagcg  gcggtggcggatccggcggtggcggatccggcggtggcggatccgatattgtgatgacccagactcc  actctctctgt  C3 scFV FC2 gBLOCk sequence:  (DNA)  (SEQ ID NO: 267) tattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgc  aggtctagtcagaccattgtccatagtaatggaaacacctatttggagtggtacctgcagaagccag  gccagtctccacagctcctgatctataaggtttccaaccggttctctggagtgccagataggttcag  tggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctgaggatgttggggtt  tattactgcttccaaggtagccacgtgcctttcaccttcggcggagggaccaaggtggagatcaaac  gaactgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggg  gggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgag  gtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacg  gcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggt  cagc  pSECTag2 C8 scFV-FC  (DNA)  (SEQ ID NO: 268) atggagacagacacactcctgctatgggtactgctgctctgggttccaggttccactggtgacgcgg  cccagccggccgaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgag  actctcctgtgcagcctctggattcaccttcagtggctatgccatgagctgggtccgccaggctcca  gggaaggggctggagtgggtctcaaccattagtagtggcggaacctacatatactaccctgactcag  tgaagggccgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcct  gagagccgaggacacggccgtgtattactgtgcgagactgggcggcgataactattatgaatattgg  ggcaaagggaccacggtcaccgtctcctccggcggtggcggatccggcggtggcggatccggcggtg  gcggatccgacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccac  catcaactgcagggccagcaagagtgttagcaccagcggctacagctacatgcactggtaccagcag  aaaccaggacagcctcctaagctgctcatttacctggtgtctaacctggaatccggggtccctgacc  gattcagtggcagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctgaagatgt  ggcagtttattactgtcaacacattcgggaactgaccaggagtgaattcggcggagggaccaaggtg  gagatcaaacgaactgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctg  aactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccg  gacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactgg  tacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgt  accgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaa  ggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccga  gaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacct  gcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaa  caactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcacc  gtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcaca  accactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 269) METDTLLLWVLLLWVPGSTGDAAQPAEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEW  VSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSSGG  GGSGGGGSGGGGSDIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNLES  GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQHIRELTRSEFGGGTKVEIKRTEPKSCDKTHTCPPCPAPEL  LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT  VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE  WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  C8 scFV FC 1 gBLOCk sequence:  (DNA)  (SEQ ID NO: 270) tgctctgggttccaggttccactggtgacgcggcccagccggccgaggtgcagctggtggagtctgg  gggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcctctggattcaccttcagt  ggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctcaaccattagta  gtggcggaacctacatatactaccctgactcagtgaagggccgattcaccatctccagagacaacgc  caagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcg  agactgggcggcgataactattatgaatattggggcaaagggaccacggtcaccgtctcctccggcg  gtggcggatccggcggtggcggatccggcggtggcggatccgacatcgtgatgacccagtctccaga  ctccctgg  C8 scFV FC2 gBLOCk sequence:  (DNA)  (SEQ ID NO: 271) catcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaactgc  agggccagcaagagtgttagcaccagcggctacagctacatgcactggtaccagcagaaaccaggac  agcctcctaagctgctcatttacctggtgtctaacctggaatccggggtccctgaccgattcagtgg  cagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctgaagatgtggcagtttat  tactgtcaacacattcgggaactgaccaggagtgaattcggcggagggaccaaggtggagatcaaac  gaactgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggg  gggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgag  gtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacg  gcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggt  cagc  Human IgG1 Fc sequence:  (DNA)  (SEQ ID NO: 272) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 273) EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK  TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN  QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN  HYTQKSLSLSPGK**  Human IgG1 CH2-CH3 domain sequence:  (DNA)  (SEQ ID NO: 274) ccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctca  tgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaa  ctggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtac  cgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctcca  acaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgta  caccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctat  cccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgc  tggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgt  cttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggt  aaatgataa  (amino acids) (SEQ ID NO: 275) PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY  RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY  PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG  K**  Human IgG1 CH3 domain sequence:  (DNA)  (SEQ ID NO: 276) gggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcc  tgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaa  caactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggac  aagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgc  agaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 277) GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD  KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 Fc Y407R sequence:  (DNA)  (SEQ ID NO: 278) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctcaggagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 279) EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK  TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKN  QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLRSKLTVDKSRWQQGNVFSCSVMHEALHN  HYTQKSLSLSPGK**  Human IgG1 Fc F405Q sequence:  (DNA)  (SEQ ID NO: 280) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttccagctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 281) EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV  EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY  TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFQLYSKLTVDKSR  WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 Fc T394D sequence:  (DNA)  (SEQ ID NO: 282) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccgaccctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 283) EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV  EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY  TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTDPPVLDSDGSFFLYSKLTVDKSR  WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 Fc T366W/L368W sequence:  (DNA)  (SEQ ID NO: 284) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcagcctgtggtgctgggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 285) EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV  EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY  TLPPSREEMTKNQVSLWCWVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR  WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 Fc T364R/L368R sequence:  (DNA)  (SEQ ID NO: 286) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcag  tcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaag  acaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggact  ggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctc  caaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaac  caggtcaggctgacctgcagggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggc  agccggagaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaac  cactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 287) EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV  EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY  TLPPSREEMTKNQVRLTCRVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR  WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 Fc hingeless sequence:  (DNA)  (SEQ ID NO: 288) gcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctccc  ggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgt  ggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtc  agcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccc  tcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcc  cccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgac  atcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctggactccg  acggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatg  ctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 289) APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV  SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD  IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK**  Human IgG1 G237A FC sequence:  (DNA)  (SEQ ID NO: 290) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctgggggccc  cgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcac  atgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtg  gaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcg  tcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagc  cctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac  accctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct  tctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccac  gcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcagg  tggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcaga  agagcctctccctgtctccgggtaaa  (amino acids)  (SEQ ID NO: 291) EPKSCDKTHTCPPCPAPELLGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV  EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY  TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR  WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK  Human IgG1 L234A/L235A FC sequence:  (DNA)  (SEQ ID NO: 292) gagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaagccgccgggggac  cgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcac  atgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtg  gaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcg  tcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagc  cctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtac  accctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggct  tctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccac  gcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcagg  tggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcaga  agagcctctccctgtctccgggtaaa  (amino acids)  (SEQ ID NO: 293) EPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV  EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY  TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR  WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK  CAR-T E6 CD3z sequence:  (DNA)  (SEQ ID NO: 294) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggggggg  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttg  ggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgccgcgtt  aagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctga  atctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcgg  caagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaa  gcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagg  gcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgata  a  (amino acids)  (SEQ ID NO: 295) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTP  APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRV  KFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE  AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  **  CAR-T E6 CD3z gBLOCK sequence:  (DNA)  (SEQ ID NO: 296) tggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttgggccccgctcgcaggcacatgt  ggagtgctcctcctctccctggtgattaccctgtactgccgcgttaagttctcccgatcagccgacgcgcctg  cttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttgga  caaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaat  gagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaag  gacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcact  tccaccacggtgataagtttaaacccgctgatcagcctcgactgtgc  CAR-T E6 CD28/CD3z sequence:  (DNA)  (SEQ ID NO: 297) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggggggg  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttg  ggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcagaagc  aagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggccccaccagga  aacattaccagccctacgctccgccacgcgacttcgctgcctaccggtcccgcgttaagttctcccg  atcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtaga  cgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgca  ggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcga  gatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccaca  gcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 298) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTP  APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRS  KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYKQGQNQLYNELNLGR  REEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST  ATKDTYDALHMQALPPR**  CAR-T E6 CD28/CD3z g BLOCK sequence:  (DNA)  (SEQ ID NO: 299) tggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttgggccccgctcgcaggcacatgt  ggagtgctcctcctctccctggtgattaccctgtactgcagaagcaagcggtctcggctcctgcattctgatt  acatgaacatgaccccaagaagaccaggccccaccaggaaacattaccagccctacgctccgccacgcgactt  cgctgcctaccggtcccgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaa  ctgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccag  aaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggc  agaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggc  ctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataagtttaaa  cccgctgatcagcctcgactgtgc  CAR-T E6 4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 300) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggggggg  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttg  ggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcaaaagg  ggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtacagacgactcaagagg  aagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctc  ccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggt  agacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctc  gcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatag  cgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtcc  acagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 301) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTIS  GGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSGGG  GSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARF  SGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTPAPRPPTPAPTIASQPLSLRPEACR  PAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRF  PEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQ  KDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  CAR-T E6 4-1BB/CD3z gBLOCK sequence:  (DNA)  (SEQ ID NO: 302) tggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttgggccccgctcgcaggcacatgt  ggagtgctcctcctctccctggtgattaccctgtactgcaaaaggggccgcaaaaaactcctttacattttta  agcagccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccgctttcctgaggagga  ggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaac  caactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacc  cagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagat  ggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcag  ggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataagttt  aaacccgctgatcagcctcgactgtgc  CAR-T E6 CD28/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 303) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggggggg  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttg  ggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcagaagc  aagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggccccaccagga  aacattaccagccctacgctccgccacgcgacttcgctgcctaccggtccaaaaggggccgcaaaaa  actcctttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgc  tcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccg  acgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaaga  gtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaac  ccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaa  tgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaa  agatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 304) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTIS  GGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSGGG  GSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARF  SGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTPAPRPPTPAPTIASQPLSLRPEACR  PAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAP  PRDFAAYRSKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYN  ELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST  ATKDTYDALHMQALPPR**  CAR-T E6 CD28/4-1BB/CD3z gBLOCK sequence:  (DNA)  (SEQ ID NO: 305) atagggagacccaagctggctagttaagcttggtaccgagggccaccatggccctgcccgtgaccgc  tttgctgctccccctggcgctgctgctgcacgccgccaggccagaggtccagctggttgagagtggc  ggtgggctggttaagcctggcggctccctgcggctgagctgcgccgcgagtggatttactttcagcc  gatatgggatgagttgggtgcggcaagctcccgggaagaggctggaatgggtctcaacaatctccgg  ggggggcacttacatctattaccccgactcagtcaaggggagatttaccatttcacgagacaacgct  aagaataccctgtatttgcagatgaattctctgagagcagaggacacagctgtttactattgtaccc  gcgacaactatggcaggaactacgactacggtatggactattggggacaagggacattggttacagt  gagcagtggcggcgggggcagcggaggaggaggcagcggtggggggggcagcgagatagtgctcacg  cagtcacccgcgactctcagtctctcacctggggaacgagctaccctgacgtgctctgctacctcct  cagtgtcatatattcactggtatcagcaacggcccgggcagtcccctagattgctcatttatagtac  ctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattacaccctc  actatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctccccat  tcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccggcccccagaccaccaacgcc  agcccccaccatcgccagccaacccctgtctctgagaccagaagcctgtaggcctgccgccggtgga  gctgtgcacacaagaggactggatttcgcctgtgatatctacatttgggccccgctcgcaggcacat  gtggagtgctcctcctctccctggtgattaccctgtactgcagaagcaagcggtctcggctcctgca  ttctgattacatgaacatgaccccaagaagaccaggccccaccaggaaacattaccagccctacgct  ccgccacgcgacttcgctgcctaccggtccaaaaggggccgcaaaaaactcctttacatttttaagc  agccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccgctttcctgagga  ggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcag  ggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaac  ggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaa  tgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacga  gggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctcc  atatgcaggcacttccaccacggtgataagtttaaacccgctgatcagcctcgactgtgc  CAR-T C2 CD28/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 306) atggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcctgaagtgcagc  tcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcctcaggtttcac  tttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtctactatcagc  tcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaaga  actccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcacgcctoggcgg  cgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagoggaggaggtggc  tcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctccctggctgtgt  ctccoggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgca  ctggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtg  cctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgata  cagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaattaa  gagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctg  agaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatct  acatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcagaag  caagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggccccaccaggaaacat  taccagccctacgctccgccacgcgacttcgctgcctaccggtccaaaaggggccgcaaaaaactcctttaca  tttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccgctttcctga  ggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggc  cagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggcc  gcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaaga  taagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctt  tatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgat  aa  (amino acids)  (SEQ ID NO: 307) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPAS  LAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVE  ANDTANYYCQHSRELPFTFGGGTKVEIKRTTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA  CDIYIWAPLAGTCGVLLLSLVITLYCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKK  LLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDK  RRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP  PR**  CAR-T C2-1 gBLOCK sequence:  (DNA)  (SEQ ID NO: 308) atagggagacccaagctggctagttaagcttggtaccgagggccaccatggccttgccagtgacggccctgct  gctgccattggctcttctgttgcacgctgccaggcctgaagtgcagctcgtagagagtggcgggggactggtg  aagcccggtggaagcctcagactcagttgcgccgcctcaggtttcactttttcaggttacgccatgtcctggg  taagacaggcaccggggaaaggactcgagtgggtgtctactatcagctcaggaggcacttatatatattatcc  tgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaagaactccctctacctccaaatgaacagt  cttagggcagaagacactgctgtatactattgtgcacgcctcggcggcgacaactactacgagtactttgacg  tgtgggggaaagggactaccgtgacagtttcaagcggaggaggtggctcaggtggaggcgggtcagggggggg  aggaagtgatattgtgctcacacaatccccagcctccctggc  CAR-T C2-2 gBLOCK sequence:  (DNA)  (SEQ ID NO: 309) aagtgatattgtgctcacacaatccccagcctccctggctgtgtctcccggccaacgcgctacaattacatgt  cgggcctccaaaagcgtgagcaccagcggctacagctacatgcactggtatcaacagaaaccaggacaacccc  ccaaactgttgatttatctcgcttcaaacttggagtccggcgtgcctgcgcgcttttcagggagtgggagcgg  cacagattttacgctgactatcaaccccgtagaagcaaacgatacagcgaattattattgtcaacattcccgg  gaactcccctttacgttcggcgggggcacaaaggtcgaaattaagagaaccacgacaaccccggcccccagac  caccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcctgtaggcctgccgccgg  tggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttgggccccgctcgcaggcacatgt  ggagtgc  CAR E6 Fc/8/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 310) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagagcccaaatct  tgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcc  tcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataat  gccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcc  tgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccc  catcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgccccca  tcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcg  acatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgct  ggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcagggg  aacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccc  tgtctccgggtaaaatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccct  ggtgattaccctgtactgcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatg  aggccagtacagacgactcaagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggag  ggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaacca  actgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgc  gacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcaga  aagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggaca  cgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggca  cttccaccacggtgataa  (amino acids)  (SEQ ID NO: 311) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKEPKS  CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN  AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP  SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG  NVFSCSVMHEALHNHYTQKSLSLSPGKIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFM  RPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGR  DPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQA  LPPR**  E6 CAR pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 312) acgctgttttgacctccatagaagattctagagctagctgtagagcttggtaccgagggccaccatg  gccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagaggtcc  agctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgcgag  tggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaatgg  gtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagatttacca  tttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacacagc  tgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattggggacaa  gggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggaggca  gcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccctgac  gtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccctaga  ttgctcatttatagtacctctaatctggcctcaggtatccctgc  E6 CAR Fc pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 313) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaagagcccaaatcttgtgacaaaactcac  acatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaaac  ccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacga  agaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg  cgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggc  tgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccat  ctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatg  accaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagt  gggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctg  E6 CAR 8BB3 pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 314) agaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctg  cacaaccactacacgcagaagagcctctccctgtctccgggtaaaatctacatttgggccccgctcg  caggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcaaaaggggccgcaaaaa  actcctttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgc  tcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccg  acgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaaga  gtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaac  ccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaa  tgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaa  agatacgtatgacgccctccatatgcaggcacttccaccacggtgataagtttaaacccgctgatca  ggcggccgcgaaggatctgcgatcgctccggtgcccgtcag  CAR E6 FcH/8/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 315) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagcacctgaactc  ctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggaccc  ctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgt  ggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgt  gtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtct  ccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaacc  acaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctg  gtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaact  acaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtgga  caagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccac  tacacgcagaagagcctctccctgtctccgggtaaaatctacatttgggccccgctcgcaggcacat  gtggagtgctcctcctctccctggtgattaccctgtactgcaaaaggggccgcaaaaaactccttta  catttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccgc  tttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctg  cttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgt  gttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggag  ggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaaggggg  aaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgta  tgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 316) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKAPEL  LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR  VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL  VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH  YTQKSLSLSPGKIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCR  FPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQE  GLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  E6 CAR FcH pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 317) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaagcacctgaactcctggggggaccgtca  gtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcg  tggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggt  gcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctc  accgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcc  cagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccct  gcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctat  cccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctc  ccgtgctg  CAR E6 Fc/4/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 318) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagagcccaaatct  tgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcc  tcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggt  ggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataat  gccaagacaaagccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcc  tgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccc  catcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgccccca  tcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcg  acatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgct  ggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcagggg  aacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccc  tgtctccgggtaaaatggccctgattgtgctggggggcgtcgccggcctcctgcttttcattgggct  aggcatcttcttcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggcca  gtacagacgactcaagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcg  aactgcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgta  caacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgaccca  gaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagata  agatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacgg  cctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttcca  ccacggtgataa  (amino acids)  (SEQ ID NO: 319) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKEPKS  CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN  AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP  SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG  NVFSCSVMHEALHNHYTQKSLSLSPGKMALIVLGGVAGLLLFIGLGIFFKRGRKKLLYIFKQPFMRP  VQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDP  EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP  PR**  E6 CAR 44BB3 pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 320) agaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagct  caccgtggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctg  cacaaccactacacgcagaagagcctctccctgtctccgggtaaaatggccctgattgtgctggggg  gcgtcgccggcctcctgcttttcattgggctaggcatcttcttcaaaaggggccgcaaaaaactcct  ttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgc  cgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgc  ctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacga  cgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccag  gagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagg  gggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatac  gtatgacgccctccatatgcaggcacttccaccacggtgataagtttaaacccgctgatcaggcggc  cgcgaaggatctgcgatcgctccggtgcccgtcag  CAR E6 FcH/4/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 321) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagcacctgaactc  ctggggggaccgtcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggaccc  ctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgt  ggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtaccgt  gtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtct  ccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaacc  acaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctg  gtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaact  acaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtgga  caagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccac  tacacgcagaagagcctctccctgtctccgggtaaaatggccctgattgtgctggggggcgtcgccg  gcctcctgcttttcattgggctaggcatcttcttcaaaaggggccgcaaaaaactcctttacatttt  taagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccgctttcct  gaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctgcttaca  agcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttgga  caaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactg  tacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaagga  gacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgc  cctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 322) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKAPEL  LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR  VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL  VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH  YTQKSLSLSPGKMALIVLGGVAGLLLFIGLGIFFKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFP  EEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL  YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  CAR E6 IgD/8/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 323) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagaggtccagc  tggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgcgagtggatttac  tttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaatgggtctcaacaatctcc  ggggggggcacttacatctattaccccgactcagtcaaggggagatttaccatttcacgagacaacgctaaga  ataccctgtatttgcagatgaattctctgagagcagaggacacagctgtttactattgtacccgcgacaacta  tggcaggaactacgactacggtatggactattggggacaagggacattggttacagtgagcagtggcggcggg  ggcagcggaggaggaggcagcggtggcggaggcagcgagatagtgctcacgcagtcacccgcgactctcagtc  tctcacctggggaacgagctaccctgacgtgctctgctacctcctcagtgtcatatattcactggtatcagca  acggcccgggcagtcccctagattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattt  tctggatctggttcaggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttatt  actgccagcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagagtctccaaa  ggcacaggcctcctcagtgcccactgcacaaccccaagcagagggcagcctcgccaaggcaaccacagcccca  gccaccacccgtaacacaggaagaggcggcgaagagaagaaaaaggagaaggagaaagaggaacaagaagaga  gagagacaaagacaccaatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggt  gattaccctgtactgcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagta  cagacgactcaagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcg  ttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatct  cggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgc  aggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcg  gaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaaga  tacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 324) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKESPK  AQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPIYIWAPLAGTCGV  LLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYK  QGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERR  RGKGHDGLYQGLSTATKDTYDALHMQALPPR**  E6 CAR IgD8 pcDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 325) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaagagtctccaaaggcacaggcctcctca  gtgcccactgcacaaccccaagcagagggcagcctcgccaaggcaaccacagccccagccaccaccc  gtaacacaggaagaggcggcgaagagaagaaaaaggagaaggagaaagaggaacaagaagagagaga  gacaaagacaccaatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctg  gtgattaccctgtactgcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatga  ggccag  E6 CAR BB 3 pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 326) acatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccg  ctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcct  gcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacg  tgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccagga  gggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggg  gaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgt  atgacgccctccatatgcaggcacttccaccacggtgataagtttaaacccgctgatcaggcggccg  cgaaggatctgcgatcgctccggtgcccgtcag  CAR E6 IgD/4/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 327) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagagtctccaaag  gcacaggcctcctcagtgcccactgcacaaccccaagcagagggcagcctcgccaaggcaaccacag  ccccagccaccacccgtaacacaggaagaggcggcgaagagaagaaaaaggagaaggagaaagagga  acaagaagagagagagacaaagacaccaatggccctgattgtgctggggggcgtcgccggcctcctg  cttttcattgggctaggcatcttcttcaaaaggggccgcaaaaaactcctttacatttttaagcagc  cttttatgaggccagtacagacgactcaagaggaagacgggtgctcatgccgctttcctgaggagga  ggaaggagggtgcgaactgcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggc  cagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacgga  gaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatga  gttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgaggg  aaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccata  tgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 328) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKESPK  AQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPMALIVLGGVAGLL  LFIGLGIFFKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQG  QNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG  KGHDGLYQGLSTATKDTYDALHMQALPPR**  E6 CAR IgD4 pcDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 329) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaagagtctccaaaggcacaggcctcctca  gtgcccactgcacaaccccaagcagagggcagcctcgccaaggcaaccacagccccagccaccaccc  gtaacacaggaagaggcggcgaagagaagaaaaaggagaaggagaaagaggaacaagaagagagaga  gacaaagacaccaatggccctgattgtgctggggggcgtcgccggcctcctgcttttcattgggcta  ggcatcttcttcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggccag  CAR E6 X4/8/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 330) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagacaagacgcac  accaagccacctaaaccagctccagaactgctcggaggtcctggcaccggaaccggaggacctacca  tcaaaccacctaagccacctaagcctgctcctaacctgctcggaggacctatctacatttgggcccc  gctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcaaaaggggccgc  aaaaaactcctttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacg  ggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatc  agccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgg  gaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcagga  aaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagat  cggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagca  acaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 331) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKDKTH  TKPPKPAPELLGGPGTGTGGPTIKPPKPPKPAPNLLGGPIYIWAPLAGTCGVLLLSLVITLYCKRGR  KKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRR  EEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA  TKDTYDALHMQALPPR**  E6 CAR X48 pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 332) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaagacaagacgcacaccaagccacctaaa  ccagctccagaactgctcggaggtcctggcaccggaaccggaggacctaccatcaaaccacctaagc  cacctaagcctgctcctaacctgctcggaggacctatctacatttgggccccgctcgcaggcacatg  tggagtgctcctcctctccctggtgattaccctgtactgcaaaaggggccgcaaaaaactcctttac  atttttaagcagccttttatgaggccag  CAR E6 X4/4/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 333) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaagacaagacgcac  accaagccacctaaaccagctccagaactgctcggaggtcctggcaccggaaccggaggacctacca  tcaaaccacctaagccacctaagcctgctcctaacctgctcggaggacctatggccctgattgtgct  ggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttcaaaaggggccgcaaaaaa  ctcctttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacgggtgct  catgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccga  cgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagag  tacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacc  cccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaat  gaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaa  gatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 334) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKDKTH  TKPPKPAPELLGGPGTGTGGPTIKPPKPPKPAPNLLGGPMALIVLGGVAGLLLFIGLGIFFKRGRKK  LLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREE  YDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK  DTYDALHMQALPPR**  E6 CAR X44 pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 335) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaagacaagacgcacaccaagccacctaaa  ccagctccagaactgctcggaggtcctggcaccggaaccggaggacctaccatcaaaccacctaagc  cacctaagcctgctcctaacctgctcggaggacctatggccctgattgtgctggggggcgtcgccgg  cctcctgcttttcattgggctaggcatcttcttcaaaaggggccgcaaaaaactcctttacattttt  aagcagccttttatgaggccag  CAR E6 8 + 4/4/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 336) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggcggag  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatggccctgat  tgtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttcaaaaggggccgc  aaaaaactcctttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagacg  ggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatc  agccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgg  gaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcagga  aaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagat  cggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagca  acaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 337) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTP  APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDMALIVLGGVAGLLLFIGLGIFFKRGR  KKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRR  EEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA  TKDTYDALHMQALPPR**  E6 CAR CD844 pCDH gBLOCK sequence:  (DNA)  (SEQ ID NO: 338) agtacctctaatctggcctcaggtatccctgcacgattttctggatctggttcaggttctgattaca  ccctcactatctctagcctggagcctgaagactttgccgtttattactgccagcagaggtctagctc  cccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccggcccccagaccacca  acgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcctgtaggcctgccgccg  gtggagctgtgcacacaagaggactggatttcgcctgtgatatggccctgattgtgctggggggcgt  cgccggcctcctgcttttcattgggctaggcatcttcttcaaaaggggccgcaaaaaactcctttac  atttttaagcagccttttatgaggccag  Humanized C2 scFV sequence in CAR:  (DNA)  (SEQ ID NO: 339) gagggccaccatggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcct  gaagtgcagctcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcct  caggtttcactttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtc  tactatcagctcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgac  aatgcaaagaactccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcac  gcctcggcggcgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagcgg  aggaggtggctcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctcc  ctggctgtgtctcccggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctaca  gctacatgcactggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttgga  gtccggcgtgcctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaa  gcaaacgatacagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaagg  tcgaaattaagagaacc  (amino acids)  (SEQ ID NO: 340) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGR  FTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSGGGGSGGGGSGGG  GSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPAR  FSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRT  Humanized E6 scFV sequence in CAR:  (DNA)  (SEQ ID NO: 341) gaggtccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcg  ccgcgagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggct  ggaatgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggaga  tttaccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagagg  acacagctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattg  gggacaagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggg  gggggcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagcta  ccctgacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtc  ccctagattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatct  ggttcaggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattact  gccagcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaa  (amino acids)  (SEQ ID NO: 342) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGR  FTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSGGGGSGGGGSGG  GGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGS  GSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIK  CD8 leader sequence:  (DNA)  (SEQ ID NO: 343) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggcca  (amino acids)  (SEQ ID NO: 344) MALPVTALLLPLALLLHAARP  CD8 hinge domain sequence:  (DNA)  (SEQ ID NO: 345) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  t  (amino acids)  (SEQ ID NO: 346) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD  CD4 hinge domain sequence:  (DNA)  (SEQ ID NO: 347) tcgggacaggtcctgctggaatccaacatcaaggttctgcccacatggtccaccccggtgcagcca  (amino acids)  (SEQ ID NO: 348) SGQVLLESNIKVLPTWSTPVQP  CD28 hinge domain sequence:  (DNA)  (SEQ ID NO: 349) aaacacctttgtccaagtcccctatttcccggaccttctaagccc  (amino acids)  (SEQ ID NO: 350) KHLCPSPLFPGPSKP  CD8 + CD4 hinge domain sequence:  (DNA)  (SEQ ID NO: 351) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  ttcgggacaggtcctgctggaatccaacatcaaggttctgcccacatggtccaccccggtgcagcca  (amino acids)  (SEQ ID NO: 352) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDSGQVLLESNIKVLPTWSTPVQP  CD8 + CD28 hinge domain sequence:  (DNA)  (SEQ ID NO: 353) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  taaacacctttgtccaagtcccctatttcccggaccttctaagccc  (amino acids)  (SEQ ID NO: 354) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDKHLCPSPLFPGPSKP  CD28 + CD4 hinge domain sequence:  (DNA)  (SEQ ID NO: 355) aaacacctttgtccaagtcccctatttcccggaccttctaagccctcgggacaggtcctgctggaat  ccaacatcaaggttctgcccacatggtccaccccggtgcagcca  (amino acids)  (SEQ ID NO: 356) KHLCPSPLFPGPSKPSGQVLLESNIKVLPTWSTPVQP  Human IgD hinge domain sequence:  (DNA)  (SEQ ID NO: 357) gagtctccaaaggcacaggcctcctcagtgcccactgcacaaccccaagcagagggcagcctcgcca  aggcaaccacagccccagccaccacccgtaacacaggaagaggcggcgaagagaagaaaaaggagaa  ggagaaagaggaacaagaagagagagagacaaagacacca  (amino acids)  (SEQ ID NO: 358) ESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTP  X4 linker (IgG1 and IgG2 modified hinge region) sequence:  (DNA)  (SEQ ID NO: 359) gacaagacgcacaccaagccacctaaaccagctccagaactgctcggaggtcctggcaccggaaccg  gaggacctaccatcaaaccacctaagccacctaagcctgctcctaacctgctcggaggacct  (amino acids)  (SEQ ID NO: 360) DKTHTKPPKPAPELLGGPGTGTGGPTIKPPKPPKPAPNLLGGP  CD3 zeta transmembrane domain sequence:  (DNA)  (SEQ ID NO: 361) ctctgctacctgctggatggaatcctcttcatctatggtgtcattctcactgccttgttcctg  (amino acids)  (SEQ ID NO: 362) LCYLLDGILFIYGVILTALFL  CD8 transmembrane domain sequence:  (DNA)  (SEQ ID NO: 363) atctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgt  actgc  (amino acids)  (SEQ ID NO: 364) IYIWAPLAGTCGVLLLSLVITLYC  CD4 transmembrane domain sequence:  (DNA)  (SEQ ID NO: 365) atggccctgattgtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttc  (amino acids)  (SEQ ID NO: 366) MALIVLGGVAGLLLFIGLGIFF  CD28 transmembrane domain sequence:  (DNA)  (SEQ ID NO: 367) ttttgggtgctggtggtggttggtggagtcctggcttgctatagcttgctagtaacagtggccttta  ttattttctgggtg  (amino acids)  (SEQ ID NO: 368) FWVLVVVGGVLACYSLLVTVAFIIFWV  4-1BB transmembrane domain sequence:  (DNA)  (SEQ ID NO: 369) atcatctccttctttcttgcgctgacgtcgactgcgttgctcttcctgctgttcttcctcacgctcc  gtttctctgttgtt  (amino acids)  (SEQ ID NO: 370) IISFFLALTSTALLFLLFFLTLRFSVV  OX40 transmembrane domain sequence:  (DNA)  (SEQ ID NO: 371) gttgccgccatcctgggcctgggcctggtgctggggctgctgggccccctggccatcctgctggccc  tgtacctgctc  (amino acids)  (SEQ ID NO: 372) VAAILGLGLVLGLLGPLAILLALYLL  CD3 zeta domain sequence:  (DNA)  (SEQ ID NO: 373) cgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacg  agctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaat  gggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatg  gcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggccttt  atcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacg  g  (amino acids)  (SEQ ID NO: 374) RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKM  AEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR  CD3 zeta domain variant sequence:  (DNA)  (SEQ ID NO: 375) agagtgaagttcagcaggagcgcagacgcccccgcgtaccagcagggccagaaccagctctataacg  agctcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagat  ggggggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatg  gcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaaggggcacgatggccttt  accagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgccccctcg  c  (amino acids)  (SEQ ID NO: 376) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKM  AEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR  CD28 domain sequence:  (DNA)  (SEQ ID NO: 377) agaagcaagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggcccca  ccaggaaacattaccagccctacgctccgccacgcgacttcgctgcctaccggtcc  (amino acids)  (SEQ ID NO: 378) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS  4-1BB domain sequence:  (DNA)  (SEQ ID NO: 379) aaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtacagacgactc  aagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactg  (amino acids)  (SEQ ID NO: 380) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL  OX40 domain sequence:  (DNA)  (SEQ ID NO: 381) cggagggaccagaggctgccccccgatgcccacaagccccctgggggaggcagtttccggaccccca  tccaagaggagcaggccgacgcccactccaccctggccaagatc  (amino acids)  (SEQ ID NO: 382) RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI  Humanized anti CD3 scFV clone 12F6 (VH-VL) sequence:  (DNA)  (SEQ ID NO: 383) caggtgcagctggtgcagagcggaggtggagtggtccaacctggaagatctctgagactgagctgta  aggctagcgggtacacgttcacatcttacacgatgcactgggtgaggcaagcccccggtaagggcct  ggaatggatcggatatataaaccccagctcagggtataccaaatataatcagaagttcaaagatcgg  ttcacgatttctgctgataaaagtaagtccaccgctttcctgcagatggactcactcaggccagaag  atactggtgtttatttctgtgcaaggtggcaggactacgacgtgtactttgactattgggggcaggg  gacgcctgtaacagtatcaagcggcggtggcggatccggcggtggcggatccggcggtggcggatcc  gatattcagatgacccagagcccgagcagcctgagcgcgagcgtgggcgatcgcgtgaccatgacct  gccgcgcgagcagcagcgtgagctatatgcattggtatcagcagaccccgggcaaagcgccgaaacc  gtggatttatgcgaccagcaacctggcgagcggcgtgccgagccgctttagcggcagcggcagcggc  accgattataccctgaccattagcagcctgcagccggaagatattgcgacctattattgccagcagt  ggagcagcaacccgccgacctttggccagggcaccaaactgcagattacccgc  (amino acids)  (SEQ ID NO: 384) QVQLVQSGGGVVQPGRSLRLSCKASGYTFTSYTMHWVRQAPGKGLEWIGYINPSSGYTKYNQKFKDR  FTISADKSKSTAFLQMDSLRPEDTGVYFCARWQDYDVYFDYWGQGTPVTVSSGGGGSGGGGSGGGGS  DIQMTQSPSSLSASVGDRVTMTCRASSSVSYMHWYQQTPGKAPKPWIYATSNLASGVPSRFSGSGSG  TDYTLTISSLQPEDIATYYCQQWSSNPPTFGQGTKLQITR  Humanized anti CD3 scFV clone 12F6 (VL-VH) sequence:  (DNA)  (SEQ ID NO: 385) gatattcagatgacccagagcccgagcagcctgagcgcgagcgtgggcgatcgcgtgaccatgacct  gccgcgcgagcagcagcgtgagctatatgcattggtatcagcagaccccgggcaaagcgccgaaacc  gtggatttatgcgaccagcaacctggcgagcggcgtgccgagccgctttagcggcagcggcagcggc  accgattataccctgaccattagcagcctgcagccggaagatattgcgacctattattgccagcagt  ggagcagcaacccgccgacctttggccagggcaccaaactgcagattacccgcggcggtggcggatc  cggcggtggcggatccggcggtggcggatcccaggtgcagctggtgcagagcggaggtggagtggtc  caacctggaagatctctgagactgagctgtaaggctagcgggtacacgttcacatcttacacgatgc  actgggtgaggcaagcccccggtaagggcctggaatggatcggatatataaaccccagctcagggta  taccaaatataatcagaagttcaaagatcggttcacgatttctgctgataaaagtaagtccaccgct  ttcctgcagatggactcactcaggccagaagatactggtgtttatttctgtgcaaggtggcaggact  acgacgtgtactttgactattgggggcaggggacgcctgtaacagtatcaagc  (amino acids)  (SEQ ID NO: 386) DIQMTQSPSSLSASVGDRVTMTCRASSSVSYMHWYQQTPGKAPKPWIYATSNLASGVPSRFSGSGSG  TDYTLTISSLQPEDIATYYCQQWSSNPPTFGQGTKLQITRGGGGSGGGGSGGGGSQVQLVQSGGGVV  QPGRSLRLSCKASGYTFTSYTMHWVRQAPGKGLEWIGYINPSSGYTKYNQKFKDRFTISADKSKSTA  FLQMDSLRPEDTGVYFCARWQDYDVYFDYWGQGTPVTVSS  Humanized anti CD3 scFV clone OKT3 (VH-VL) sequence:  (DNA)  (SEQ ID NO: 387) caggtgcagctggtgcagagcggaggcggagtggtgcagcctggaagaagcctgcgcctgagctgca  aagcgagcggctatacctttacccgctataccatgcattgggtgcgccaggcgccgggcaaaggcct  ggaatggattggctatattaacccgagccgcggctataccaactataaccagaaagtgaaagatcgc  tttaccattagcaccgataaaagcaaaagcaccgcgtttctgcagatggatagcctgcgcccggaag  ataccgcggtgtattattgcgcgcgctattatgatgatcattattgcctggattattggggccaggg  caccaccctgaccgtgagcagcggcggtggcggatccggcggtggcggatccggcggtggcggatcc  gatattcagatgacccagagcccgagcagcctgagcgcgagcgtgggcgatcgcgtgaccattacct  gcagcgcgagcagcagcgtgagctatatgaactggtatcagcagaccccgggcaaagcgccgaaacg  ctggatttatgataccagcaaactggcgagcggcgtgccgagccgctttagcggcagcggcagcggc  accgattatacctttaccattagcagcctgcagccggaagatattgcgacctattattgccagcagt  ggagcagcaacccgtttacctttggccagggcaccaaactgcagattacccgc  (amino acids)  (SEQ ID NO: 388) QVQLVQSGGGVVQPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDR  FTISTDKSKSTAFLQMDSLRPEDTAVYYCARYYDDHYCLDYWGQGTTLTVSSGGGGSGGGGSGGGGS  DIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSG  TDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQITR  Humanized anti CD3 scFV clone OKT3 (VH-VM) sequence:  (DNA)  (SEQ ID NO: 389) gatattcagatgacccagagcccgagcagcctgagcgcgagcgtgggcgatcgcgtgaccattacct  gcagcgcgagcagcagcgtgagctatatgaactggtatcagcagaccccgggcaaagcgccgaaacg  ctggatttatgataccagcaaactggcgagcggcgtgccgagccgctttagcggcagcggcagcggc  accgattatacctttaccattagcagcctgcagccggaagatattgcgacctattattgccagcagt  ggagcagcaacccgtttacctttggccagggcaccaaactgcagattacccgcggcggtggcggatc  cggcggtggcggatccggcggtggcggatcccaggtgcagctggtgcagagcggaggcggagtggtg  cagcctggaagaagcctgcgcctgagctgcaaagcgagcggctatacctttacccgctataccatgc  attgggtgcgccaggcgccgggcaaaggcctggaatggattggctatattaacccgagccgcggcta  taccaactataaccagaaagtgaaagatcgctttaccattagcaccgataaaagcaaaagcaccgcg  tttctgcagatggatagcctgcgcccggaagataccgcggtgtattattgcgcgcgctattatgatg  atcattattgcctggattattggggccagggcaccaccctgaccgtgagcagc  (amino acids)  (SEQ ID NO: 390) DIQMTQSPSSLSASVGDRVTITCSASSSVSYMNWYQQTPGKAPKRWIYDTSKLASGVPSRFSGSGSG  TDYTFTISSLQPEDIATYYCQQWSSNPFTFGQGTKLQITRGGGGSGGGGSGGGGSQVQLVQSGGGVV  QPGRSLRLSCKASGYTFTRYTMHWVRQAPGKGLEWIGYINPSRGYTNYNQKVKDRFTISTDKSKSTA  FLQMDSLRPEDTAVYYCARYYDDHYCLDYWGQGTTLTVSS  HumanizeE6 scFV (VH-VL) sequence:  (DNA)  (SEQ ID NO: 391) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtg  cagcctctggattcaccttcagtaggtatggcatgagctgggtccgccaggctccagggaagaggct  ggagtgggtctcaaccattagtggcggaggcacctacatatactacccagactcagtgaagggccga  ttcaccatctccagagacaacgccaagaacaccctgtatctgcaaatgaacagcctgagagccgagg  acacggctgtgtattactgtaccagagataactatggccgcaactatgattatggcatggattattg  gggccagggcaccctggtgaccgtgagcagcggcggtggcggatccggcggtggcggatccggcggt  ggcggatccgaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagcca  ccctcacctgcagcgccaccagcagtgttagctacatccactggtaccaacagaggcctggccagag  ccccaggctcctcatctatagcacctccaacctggccagcggcatcccagccaggttcagtggcagt  gggtctgggagcgactacactctcaccatcagcagcctagagcctgaagattttgcagtttattact  gtcagcagcgtagcagctcccctttcacctttggcagcggcaccaaagtggaaattaaa  (amino acids)  (SEQ ID NO: 392) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGR  FTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSGGGGSGGGGSGG  GGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGS  GSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIK  HumanizeE6 scFV (VL-VH) sequence:  (DNA)  (SEQ ID NO: 393) gaaattgtgttgacacagtctccagccaccctgtctttgtctccaggggaaagagccaccctcacct  gcagcgccaccagcagtgttagctacatccactggtaccaacagaggcctggccagagccccaggct  cctcatctatagcacctccaacctggccagcggcatcccagccaggttcagtggcagtgggtctggg  agcgactacactctcaccatcagcagcctagagcctgaagattttgcagtttattactgtcagcagc  gtagcagctcccctttcacctttggcagcggcaccaaagtggaaattaaaggcggtggcggatccgg  cggtggcggatccggcggtggcggatccgaggtgcagctggtggagtctgggggaggcctggtcaag  cctggggggtccctgagactctcctgtgcagcctctggattcaccttcagtaggtatggcatgagct  gggtccgccaggctccagggaagaggctggagtgggtctcaaccattagtggcggaggcacctacat  atactacccagactcagtgaagggccgattcaccatctccagagacaacgccaagaacaccctgtat  ctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtaccagagataactatggcc  gcaactatgattatggcatggattattggggccagggcaccctggtgaccgtgagcagc  (amino acids)  (SEQ ID NO: 394) EIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGSGSG  SDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVK  PGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLY  LQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSS  HumanizeC2 scFV (VH-VL) sequence:  (DNA)  (SEQ ID NO: 395) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtg  cagcctctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggct  ggagtgggtctcaaccattagtagtggcggaacctacatatactaccccgactcagtgaagggccga  ttcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgagg  acacggccgtgtattactgtgcgagacttgggggggataattactacgaatacttcgatgtctgggg  caaagggaccacggtcaccgtctcctccggcggtggcggatccggcggtggcggatccggcggtggc  ggatccgacattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccacca  tcacctgcagagccagtaagagtgtcagtaccagcggatactcctacatgcactggtatcagcagaa  accaggacaacctcctaaactcctgatttacctggcatccaatctggagagcggggtcccagccagg  ttcagcggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagctaatgatactg  caaattattactgtcagcacagtagggagctgcctttcacattcggcggagggaccaaggtggagat  caaacgaact  (amino acids)  (SEQ ID NO: 396) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGR  FTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSGGGGSGGGGSGGG  GSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPAR  FSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRT  HumanizeE6 scFV (VL-VH) sequence:  (DNA)  (SEQ ID NO: 397) gacattgtgctgacccagtctccagcctccttggccgtgtctccaggacagagggccaccatcacct  gcagagccagtaagagtgtcagtaccagcggatactcctacatgcactggtatcagcagaaaccagg  acaacctcctaaactcctgatttacctggcatccaatctggagagcggggtcccagccaggttcagc  ggcagtgggtctgggaccgatttcaccctcacaattaatcctgtggaagctaatgatactgcaaatt  attactgtcagcacagtagggagctgcctttcacattcggcggagggaccaaggtggagatcaaacg  aactggcggtggcggatccggcggtggcggatccggcggtggcggatccgaggtgcagctggtggag  tctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcctctggattcacct  tcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctcaaccat  tagtagtggcggaacctacatatactaccccgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattact  gtgcgagacttgggggggataattactacgaatacttcgatgtctggggcaaagggaccacggtcac  cgtctcctcc  (amino acids)  (SEQ ID NO: 398) DIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPARFS  GSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRTGGGGSGGGGSGGGGSEVQLVE  SGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSS  G.sub.4S.sub.1 linker sequence:  (DNA)  (SEQ ID NO: 399) ggcggtggcggatcc  (amino acids)  (SEQ ID NO:400) GGGGS  [G.sub.4S.sub.1]x3 linker sequence:  (DNA)  (SEQ ID NO: 401) ggcggtggcggatccggcggtggcggatccggcggtggcggatcc  (amino acids)  (SEQ ID NO: 402) GGGGSGGGGSGGGGS  8 aa GS linker sequence:  (DNA)  (SEQ ID NO: 403) ggcggttccggcggtggatccgga  (amino acids)  (SEQ ID NO: 404) GGSGGGSG  12 aa GS linker sequence:  (DNA)  (SEQ ID NO: 405) ggcggttccggcggtggatccggcggtggcggatccgga  (amino acids)  (SEQ ID NO: 406) GGSGGGSGGGSG  13 aa GS linker sequence:  (DNA)  (SEQ ID NO: 407) ggcggtggatccggcggtggcggatccggcggtggatcc  (amino acids)  (SEQ ID NO: 408) GGGSGGGGSGGGS  22 aa GS linker sequence:  (DNA)  (SEQ ID NO: 409) ggcggtggaagcggcggtggcggatccggcagcggcggaagcggcggtggcggatccggcggtgga  (amino acids)  (SEQ ID NO: 4110) GGGSGGGGSGSGGSGGGGSGGG  24 aa GS linker sequence:  (DNA)  (SEQ ID NO: 411) ggcggttccggcggtggatccggcggtggcggatccggaggcggttccggcggtggatccggcggtg  gcggatccgga  (amino acids)  (SEQ ID NO: 412) GGSGGGSGGGSGGGSGGGSGGGSG  Mouse C3 Heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 413) caggtccagctgcagcagtctgggcctgagctggtgaggcctggggtctcagtgaagatttcctgcaagggtt  ccggctacagattcactgattatgctatgaactgggtgaagcagagtcatgcaaagagtctagagtggattgg  agttattagtactttctctggtaatacaaacttcaaccagaagtttaagggcaaggccacaatgactgtagac  aaatcctccagcacagcctatatggaacttgccagattgacatctgaggattctgccatgtattactgtgcaa  gatcggattactacggcccatactttgactactggggccaaggcaccactctcacagtctcctca  (amino acids)  (SEQ ID NO: 414) QVQLQQSGPELVRPGVSVKISCKGSGYRFTDYAMNWVKQSHAKSLEWIGVISTFSGNTNFNQKFKGKATMTVD  KSSSTAYMELARLTSEDSAMYYCARSDYYGPYFDYWGQGTTLTVSS  Mouse C3 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 415) caggtccagctgcagcagtctgggcctgagctggtgaggcctggggtctcagtgaagatttcctgcaagggtt  ccggctacagattcact  (amino acids)  (SEQ ID NO: 416) QVQLQQSGPELVRPGVSVKISCKGSGYRFT  Mouse C3 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 417) gattatgctatgaac  (amino acids)  (SEQ ID NO: 418) DYAMN  Mouse C3 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 419) tgggtgaagcagagtcatgcaaagagtctagagtggattgga  (amino acids)  (SEQ ID NO: 420) WVKQSHAKSLEWIG  Mouse C3 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 421) gttattagtactttctctggtaatacaaacttcaaccagaagtttaagggc  (amino acids)  (SEQ ID NO: 422) VISTFSGNINFNQKFKG  Mouse C3 heavy chain variable framework region 3 (FWR3) acid sequence:  (DNA)  (SEQ ID NO: 423) aaggccacaatgactgtagacaaatcctccagcacagcctatatggaacttgccagattgacatctgaggatt  ctgccatgtattactgtgcaaga  (amino acids)  (SEQ ID NO: 424) KATMTVDKSSSTAYMELARLTSEDSAMYYCAR  Mouse C3 heavy chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 425) tcggattactacggcccatactttgactac  (amino acids)  (SEQ ID NO: 426) SDYYGPYFDY  IGHV1-18*04 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 427) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgca  aggcttctggttacacctttaccagctacggtatcagctgggtgcgacaggcccctggacaagggct  tgagtggatgggatggatcagcgcttacaatggtaacacaaactatgcacagaagctccagggcaga  gtcaccatgaccacagacacatccacgagcacagcctacatggagctgaggagcctgagatctgacg  acacggccgtgtattactgtgcgagaga  (amino acids)  (SEQ ID NO: 428) QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNINYAQKLQGRVIMITD  TSTSTAYMELRSLRSDDTAVYYCAR  IGHV1-18*04 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 429) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttacc  (amino acids)  (SEQ ID NO: 430) QVQLVQSGAEVKKPGASVKVSCKASGYTFT  IGHV1-18*04 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 431) agctacggtatcagc  (amino acids)  (SEQ ID NO: 432) SYGIS  IGHV1-18*04 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 433) tgggtgcgacaggcccctggacaagggcttgagtggatggga  (amino acids)  (SEQ ID NO: 434) WVRQAPGQGLEWMG  IGHV1-18*04 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 435) tggatcagcgcttacaatggtaacacaaactatgcacagaagctccagggc  (amino acids)  (SEQ ID NO: 436) WISAYNGNTNYAQKLQG  IGHV1-18*04 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 437) agagtcaccatgaccacagacacatccacgagcacagcctacatggagctgaggagcctgagatctgacgaca  cggccgtgtattactgtgcgaga  (amino acids)  (SEQ ID NO: 438) RVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR  Humanized C3 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 439) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatggg  agtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagac  acatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcga  gaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagc  (amino acids)  (SEQ ID NO: 440) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGRVTMTTD  TSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSS  Humanized C3 heavy chain variable framework region 1 (FWR1) acid  sequence:  (DNA)  (SEQ ID NO: 441) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttacc  (amino acids)  (SEQ ID NO: 442) QVQLVQSGAEVKKPGASVKVSCKASGYTFT  Humanized C3 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 443) gactacgccatgaac  (amino acids)  (SEQ ID NO: 444) DYAMN  Humanized C3 heavy chain variable framework region 2 (FWR2) acid  sequence:  (DNA)  (SEQ ID NO: 445) tgggtgcgacaggcccctggacaagggcttgagtggatggga  (amino acids)  (SEQ ID NO: 446) WVRQAPGQGLEWMG  Humanized C3 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 447) gtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggc  (amino acids)  (SEQ ID NO: 448) VISTFSGNTNFNQKFKG  Humanized C3 heavy chain variable framework region 3 (FWR3) acid  sequence:  (DNA)  (SEQ ID NO: 449) agagtcaccatgaccacagacacatccacgagcacagcctacatggagctgaggagcctgagatctgacgaca  cggccgtgtattactgtgcgaga  (amino acids)  (SEQ ID NO: 450) RVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR  Humanized C3 heavy chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 451) agcgactactacggcccatacttcgactac  (amino acids)  (SEQ ID NO: 452) SDYYGPYFDY  Humanized C3 IgG1 heavy chain sequence  (DNA)  (SEQ ID NO: 453) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatggg  agtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagac  acatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcga  gaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagcgctagcac  caagggcccatcggtcttccccctggcaccctcctccaagagcacctctgggggcacagcggccctgggctgc  ctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcaca  ccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgacagtgccctccagcagctt  gggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttgagccc  aaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcc  tcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgt  gagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaag  ccgcgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctga  atggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagc  caaagggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtc  agcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccgg  agaacaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgt  ggacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactac  acgcagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 454) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGRVTMTTD  TSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGC  LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP  KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK  PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV  SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY  TQKSLSLSPGK**  Humanized C3 IgG2 heavy chain sequence  (DNA)  (SEQ ID NO: 455) caggttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggctt  ctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgagtggatggg  agtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtcaccatgaccacagac  acatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggccgtgtattactgtgcga  gaagcgactactacggcccatacttcgactactggggccagggcaccaccctgaccgtgtccagcgcctccac  caagggcccatcggtcttccccctggcgccctgctccaggagcacctccgagagcacagccgccctgggctgc  ctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgctctgaccagcggcgtgcaca  ccttcccagctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcaactt  cggcacccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagacagttgagcgc  aaatgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcaggaccgtcagtcttcctcttccccccaa  aacccaaggacaccctcatgatctcccggacccctgaggtcacgtgcgtggtggtggacgtgagccacgaaga  ccccgaggtccagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccacgggaggag  cagttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggctgaacggcaaggagt  acaagtgcaaggtctccaacaaaggcctcccagcccccatcgagaaaaccatctccaaaaccaaagggcagcc  ccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgc  ctggtcaaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactaca  agaccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcag  gtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagc  ctctccctgtctccgggtaaatagtaa  (amino acids)  (SEQ ID NO: 456) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGRVTMTTD  TSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSASTKGPSVFPLAPCSRSTSESTAALGC  LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVER  KCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREE  QFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTC  LVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS  LSLSPGK**  Humanized C3 heavy chain IgG1 gBLOCK sequence:  (DNA)  (SEQ ID NO: 457) tgctctgggttccaggttccactggtgacgcggcccagccggcccaggttcagctggtgcagtctggagctga  ggtgaagaagcctggggcctcagtgaaggtctcctgcaaggcttctggttacacctttaccgactacgccatg  aactgggtgcgacaggcccctggacaagggcttgagtggatgggagtgatcagcaccttcagcggtaacacaa  acttcaaccagaagttcaagggcagagtcaccatgaccacagacacatccacgagcacagcctacatggagct  gaggagcctgagatctgacgacacggccgtgtattactgtgcgagaagcgactactacggcccatacttcgac  tactggggccagggcaccaccctgaccgtgtccagcgctagcaccaagggcccatcggtcttccccctggcac  cctcctccaagagcacctctgggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggt  gacggtgtcgtggaactcaggcgccctgaccagc  Mouse C3 Light Chain variable region sequence:  (DNA)  (SEQ ID NO: 458) gatgttttgatgacccaaactccactctccctgcctgtcagtcttggagatcaagcctccatctcttgcagat  ctagtcagaccattgtacatagtaatggaaacacctatttagaatggtacctgcagaaaccaggccagtctcc  aaagctcctgatctacaaagtttccaaccgattttctggggtcccagacaggttcagtggcagtggatcaggg  acagatttcacactcaagatcaacagagtggaggctgaggatctgggagtttattactgctttcaaggttcac  atgttccattcacgttcggctcggggacaaagttggaaataaaa  (amino acids)  (SEQ ID NO: 459) DVLMTQTPLSLPVSLGDQASISCRSSQTIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSG  TDFTLKINRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIK  Mouse C3 light chain variable framework region 1 (FWR1) sequence :  (DNA)  (SEQ ID NO: 460) gatgttttgatgacccaaactccactctccctgcctgtcagtcttggagatcaagcctccatctcttgc  (amino acids)  (SEQ ID NO: 461) DVLMTQTPLSLPVSLGDQASISC  Mouse C3 light chain variable complementarity determining regions 1  (CDR1) sequence :  (DNA)  (SEQ ID NO: 462) agatctagtcagaccattgtacatagtaatggaaacacctatttagaa  (amino acids)  (SEQ ID NO: 463) RSSQTIVHSNGNTYLE  Mouse C3 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 464) tggtacctgcagaaaccaggccagtctccaaagctcctgatctac  (amino acids)  (SEQ ID NO: 465) WYLQKPGQSPKLLIY  Mouse C3 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 466) aaagtttccaaccgattttct  (amino acids)  (SEQ ID NO: 467) KVSNRFS  Mouse C3 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 468) ggggtcccagacaggttcagtggcagtggatcagggacagatttcacactcaagatcaacagagtggaggctg  aggatctgggagtttattactgc  (amino acids)  (SEQ ID NO: 469) GVPDRFSGSGSGTDFTLKINRVEAEDLGVYYC  Mouse C3 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 470) tttcaaggttcacatgttccattcacg  (amino acids)  (SEQ ID NO: 471) FQGSHVPFT  IGKV2-29*03 light chain variable region sequence:  (DNA)  (SEQ ID NO: 472) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgcaagt  ctagtcagagcctcctgcatagtgatggaaagacctatttgtattggtacctgcagaagccaggccagtctcc  acagctcctgatctatgaagtttccagccggttctctggagtgccagataggttcagtggcagcgggtcaggg  acagatttcacactgaaaatcagccgggtggaggctgaggatgttggggtttattactgcatgcaaggtatac  accttcct  (amino acids)  (SEQ ID NO: 473) DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSG  TDFTLKISRVEAEDVGVYYCMQGIHLP  IGKV2-29*03 light chain variable framework region 1 (FWR1) acid sequence:  (DNA)  (SEQ ID NO: 474) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgc  (amino acids)  (SEQ ID NO: 475) DIVMTQTPLSLSVTPGQPASISC  IGKV2-29*03 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 476) aagtctagtcagagcctcctgcatagtgatggaaagacctatttgtat  (amino acids)  (SEQ ID NO: 477) KSSQSLLHSDGKTYLY  IGKV2-29*03 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 478) tggtacctgcagaagccaggccagtctccacagctcctgatctat  (amino acids)  (SEQ ID NO: 479) WYLQKPGQSPQLLIY  IGKV2-29*03 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 480) gaagtttccagccggttc  (amino acids)  (SEQ ID NO: 481) EVSSRFS  IGKV2-29*03 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 482) ggagtgccagataggttcagtggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctg  aggatgttggggtttattactgc  (amino acids)  (SEQ ID NO: 483) GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC  IGKV2-29*03 light chain variable complementarity determining regions3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 484) atgcaaggtatacaccttcct  (amino acids)  (SEQ ID NO: 485) MQGIHLP  Humanized C3 light chain variable region sequence:  (DNA)  (SEQ ID NO: 486) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcct  gcaggtctagtcagaccattgtccatagtaatggaaacacctatttggagtggtacctgcagaagcc  aggccagtctccacagctcctgatctataaggtttccaaccggttctctggagtgccagataggttc  agtggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctgaggatgttgggg  tttattactgcttccaaggtagccacgtgcctttcaccttcggcggagggaccaaggtggagatcaa  acgaact  (amino acids)  (SEQ ID NO: 487) DIVMTQTPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRF  SGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRT  Humanized C3 light chain variable framework region 1 (FWR1) acid  sequence:  (DNA)  (SEQ ID NO: 488) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcct  gc  (amino acids)  (SEQ ID NO: 489) DIVMTQTPLSLSVTPGQPASISC  Humanized C3 light chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 490) ggtctagtcagaccattgtccatagtaatggaaacacctatttggag  (amino acids)  (SEQ ID NO: 491) RSSQTIVHSNGNTYLE  Humanized C3 light chain variable framework region 2 (FWR2) acid  sequence:  (DNA)  (SEQ ID NO: 492) tggtacctgcagaagccaggccagtctccacagctcctgatctat  (amino acids)  (SEQ ID NO: 493) WYLQKPGQSPQLLIY  Humanized C3 light chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 494) aaggtttccaaccggttctct  (amino acids)  (SEQ ID NO: 495) KVSNRFS  Humanized C3 light chain variable framework region 3 (FWR3) acid  sequence:  (DNA)  (SEQ ID NO: 496) ggagtgccagataggttcagtggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctg  aggatgttggggtttattactgc  (amino acids)  (SEQ ID NO: 497) GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC  Humanized C3 light chain variable complementarity determining regions 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 498) ttccaaggtagccacgtgcctttcacc  (amino acids)  (SEQ ID NO: 499) FQGSHVPFT  Humanized C3 lambda light chain sequence  (DNA)  (SEQ ID NO: 500) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgcaggt  ctagtcagaccattgtccatagtaatggaaacacctatttggagtggtacctgcagaagccaggccagtctcc  acagctcctgatctataaggtttccaaccggttctctggagtgccagataggttcagtggcagcgggtcaggg  acagatttcacactgaaaatcagccgggtggaggctgaggatgttggggtttattactgcttccaaggtagcc  acgtgcctttcaccttcggcggagggaccaaggtggagatcaaacgaactggtcagcccaaggctgccccctc  ggtcactctgttcccgccctcctctgaggagcttcaagccaacaaggccacactggtgtgtctcataagtgac  ttctacccgggagccgtgacagtggcctggaaggcagatagcagccccgtcaaggcgggagtggagaccacca  caccctccaaacaaagcaacaacaagtacgcggccagcagctatctgagcctgacgcctgagcagtggaagtc  ccacagaagctacagctgccaggtcacgcatgaagggagcaccgtggagaagacagtggcccctacagaatgt  tcatagtaa  (amino acids)  (SEQ ID NO: 501) DIVMTQTPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSG  TDFTLKISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRTGQPKAAPSVTLFPPSSEELQANKATLVCLISD  FYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC  S**  Humanized C3 Kappa light chain  (DNA)  (SEQ ID NO: 502) gatattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgcaggt  ctagtcagaccattgtccatagtaatggaaacacctatttggagtggtacctgcagaagccaggccagtctcc  acagctcctgatctataaggtttccaaccggttctctggagtgccagataggttcagtggcagcgggtcaggg  acagatttcacactgaaaatcagccgggtggaggctgaggatgttggggtttattactgcttccaaggtagcc  acgtgcctttcaccttcggcggagggaccaaggtggagatcaaacgaactacggtggctgcaccatctgtctt  catcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctat  cccagagaggccaaagtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacag  agcaggacagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcagactacgagaaaca  caaagtctacgcctgcgaagtcacccatcagggcctgagctcgcccgtcacaaagagcttcaacaggggagag  tgttagtaa  (amino acids)  (SEQ ID NO: 503) DIVMTQTPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSG  TDFTLKISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRTTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY  PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE  C**  Humanized C3 Kappa light gBLOCK sequence:  (DNA)  (SEQ ID NO: 504) agctggctaggtaagcttggtaccgagctcggatccacgccaccatggagacagacacactcctgct  atgggtactgctgctctgggttccaggttccactggtgacgatattgtgatgacccagactccactc  tctctgtccgtcacccctggacagccggcctccatctcctgcaggtctagtcagaccattgtccata  gtaatggaaacacctatttggagtggtacctgcagaagccaggccagtctccacagctcctgatcta  taaggtttccaaccggttctctggagtgccagataggttcagtggcagcgggtcagggacagatttc  acactgaaaatcagccgggtggaggctgaggatgttggggtttattactgcttccaaggtagccacg  tgcctttcaccttcggcggagggaccaaggtggagatcaaacgaactacggtggctgcaccatctgt  cttcatcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaat  aacttctatcccagagaggccaaagtacagtggaaggtggataacgccctccaatcgggtaactccc  aggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagcaccctgacgctgag  caaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgagctcgccc  gtcacaaagagcttcaacaggggagagtgttagtaagtttaaacccgctgatcagcctcgactgtgc  cttctagttgc  Mouse C8 heavy chain variable region sequence  (DNA)  (SEQ ID NO: 505) gaagtgatggtcgtggaaagcggcggtggtctggtaaagccggggggatcccttaagctttcttgcg  ccgcatccgggttcacgttctccggctatgccatgtcctgggtccgacagactcccgaaaagcgctt  ggaatgggtggccactatctcctccggggggacgtacatctactaccccgacagtgtgaaaggaaga  tttacaatatctcgcgacaacgcaaaaaataccttgtatcttcaaatgagctccctgcggtcagagg  acactgccatgtactattgcgcccgcctgggcggcgacaattactatgagtat  (amino acids)  (SEQ ID NO: 506) EVMVVESGGGLVKPGGSLKLSCAASGFTFSGYAMSWVRQTPEKRLEWVATISSGGTYIYYPDSVKGRF  TISRDNAKNTLYLQMSSLRSEDTAMYYCARLGGDNYYEY  Mouse C8 heavy chain variable complementarity determining region 1 (CDR1)  sequence:  (DNA)  (SEQ ID NO: 507) ggctatgccatgtcc  (amino acids)  (SEQ ID NO: 508) GYAMS  Mouse C8 heavy chain variable complementarity determining region 2 (CDR2)  sequence:  (DNA)  (SEQ ID NO: 509) actatctoctccggggggacgtacatctactaccccgacagtgtgaaagga  (amino acids)  (SEQ ID NO: 510) TISSGGTYIYYPDSVKG  Mouse C8 heavy chain variable complementarity determining region 3 (CDR3)  sequence:  (DNA)  (SEQ ID NO: 511) ctgggcggcgacaattactatgagtat  (amino acids)  (SEQ ID NO: 512) LGGDNYYEY  IGHV3-21*04 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 513) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtg  cagcctctggattcaccttcagtagctatagcatgaactgggtccgccaggctccagggaaggggct  ggagtgggtctcatccattagtagtagtagtagttacatatactacgcagactcagtgaagggccga  ttcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgagg  acacggccgtgtattactgtgcga  (amino acids)  (SEQ ID NO: 514) EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCAR  IGHV3-21*04 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 515) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagt  (amino acids)  (SEQ ID NO: 516) EVQLVESGGGLVKPGGSLRLSCAASGFTFS  IGHV3-21*04 heavy chain variable complementarity determining regions 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 517) agctatagcatgaac  (amino acids)  (SEQ ID NO: 518) SYSMN  IGHV3-21*04 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 519) tgggtccgccaggctccagggaaggggctggagtgggtc  (amino acids)  (SEQ ID NO: 520) WVRQAPGKGLEWV  IGHV3-21*04 heavy chain variable complementarity determining regions 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 521) tcatccattagtagtagtagtagttacatatactacgcagactcagtgaagggc  (amino acids)  (SEQ ID NO: 522) SSISSSSSYIYYADSVKG  IGHV3-21*04 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 523) cgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggaca  cggccgtgtattactgtgcga  (amino acids)  (SEQ ID NO: 524) RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR  Humanized C8 heavy chain variable region sequence:  (DNA)  (SEQ ID NO: 525) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccctgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gactgggcggcgataactattatgaatattggggcaaagggaccacggtcaccgtctcctcc  (amino acids)  (SEQ ID NO: 526) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSS  Humanized C8 heavy chain variable framework region 1 (FWR1) sequence:  (DNA)  (SEQ ID NO: 527) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagt  (amino acids)  (SEQ ID NO: 528) EVQLVESGGGLVKPGGSLRLSCAASGFTFS  Humanized C8 heavy chain variable complementarity determining region 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 529) ggctatgccatgagc  (amino acids)  (SEQ ID NO: 530) GYAMS  Humanized C8 heavy chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 531) tgggtccgccaggctccagggaaggggctggagtgggtctca  (amino acids)  (SEQ ID NO: 532) WVRQAPGKGLEWVS  Humanized C8 heavy chain variable complementarity determining region 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 533) accattagtagtggcggaacctacatatactaccctgactcagtgaagggc  (amino acids)  (SEQ ID NO: 534) TISSGGTYIYYPDSVKG  Humanized C8 heavy chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 535) cgattcaccatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggaca  cggccgtgtattactgtgcgaga  (amino acids)  (SEQ ID NO: 536) RFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR  Humanized C8 heavy chain variable complementarity determining region 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 537) ctgggcggcgataactattatgaatat  (amino acids)  (SEQ ID NO: 538) LGGDNYYEY  Humanized C8 IgG1 heavy chain sequence  (DNA)  (SEQ ID NO: 539) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccctgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gactgggcggcgataactattatgaatattggggcaaagggaccacggtcaccgtctcctccgctagcaccaa  gggcccatcggtcttccccctggcaccctcctccaagagcacctctgggggcacagcggccctgggctgcctg  gtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacacct  tcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgacagtgccctccagcagcttggg  cacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttgagcccaaa  tcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctct  tccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgag  ccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccg  cgggaggagcagtacaacagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatg  gcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaa  agggcagccccgagaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagc  ctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatgggcagccggaga  acaactacaagaccacgcctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtgga  caagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacg  cagaagagcctctccctgtctccgggtaaatgataa  (amino acids)  (SEQ ID NO: 540) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL  VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK  SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP  REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS  LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT  QKSLSLSPGK**  Humanized C8 IgG2 heavy chain sequence  (DNA)  (SEQ ID NO: 541) gaggtgcagctggtggagtctgggggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcct  ctggattcaccttcagtggctatgccatgagctgggtccgccaggctccagggaaggggctggagtgggtctc  aaccattagtagtggcggaacctacatatactaccctgactcagtgaagggccgattcaccatctccagagac  aacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcga  gactgggcggcgataactattatgaatattggggcaaagggaccacggtcaccgtctcctccgcctccaccaa  gggcccatcggtcttccccctggcgccctgctccaggagcacctccgagagcacagccgccctgggctgcctg  gtcaaggactacttccccgaaccggtgacggtgtcgtggaactcaggcgctctgaccagcggcgtgcacacct  tcccagctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcaacttcgg  cacccagacctacacctgcaacgtagatcacaagcccagcaacaccaaggtggacaagacagttgagcgcaaa  tgttgtgtcgagtgcccaccgtgcccagcaccacctgtggcaggaccgtcagtcttcctcttccccccaaaac  ccaaggacaccctcatgatctcccggacccctgaggtcacgtgcgtggtggtggacgtgagccacgaagaccc  cgaggtccagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccacgggaggagcag  ttcaacagcacgttccgtgtggtcagcgtcctcaccgttgtgcaccaggactggctgaacggcaaggagtaca  agtgcaaggtctccaacaaaggcctcccagcccccatcgagaaaaccatctccaaaaccaaagggcagccccg  agaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctg  gtcaaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaaga  ccacacctcccatgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtg  gcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctc  tccctgtctccgggtaaatagtaa  (amino acids)  (SEQ ID NO: 542) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGRFTISRD  NAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYWGKGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCL  VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERK  CCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ  FNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCL  VKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL  SLSPGK**  Mouse C8 light chain variable region sequence  (DNA)  (SEQ ID NO: 543) gacatcgtcattacgcagacccctgccagtcttgccgtttctctgggccagagggccactatcagttacaggg  cgagtaagtctgtgagtaccagcggctatagttacatgcattggaaccagcagaaaccgggacagccaccacg  cctgcttatttatctggtgtctaatcttgagtccggggtgcccgccaggttcagcggcagcggctctgggacc  gacttcacactcaacattcatccagtggaagaagaggacgctgctacatactactgtcaacacattcgggaac  tgaccaggagtgaa  (amino acids)  (SEQ ID NO: 544) DIVITQTPASLAVSLGQRATISYRASKSVSTSGYSYMHWNQQKPGQPPRLLIYLVSNLESGVPARFS  GSGSGTDFTLNIHPVEEEDAATYYCQHIRELTRSE  Mouse C8 light chain variable complementarity determining region 1 (CDR1)  sequence:  (DNA)  (SEQ ID NO: 545) agggcgagtaagtctgtgagtaccagcggctatagttacatgcat  (amino acids)  (SEQ ID NO: 546) RASKSVSTSGYSYMH  Mouse C8 light chain variable complementarity determining region 2 (CDR2)  sequence:  (DNA)  (SEQ ID NO: 547) ctggtgtctaatcttgagtcc  (amino acids)  (SEQ ID NO: 548) LVSNLES  Mouse C8 light chain variable complementarity determining region 3 (CDR3)  sequence:  (DNA)  (SEQ ID NO: 549) caacacattcgggaactgaccaggagtgaa  (amino acids)  (SEQ ID NO: 550) QHIRELTRSE  NCBI germline z00023 light chain variable region sequence:  (DNA)  (SEQ ID NO: 551) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaactgcaagt  ccagccagagtgttttatacagctccaacaataagaactacttagcttggtaccagcagaaaccaggacagcc  tcctaagctgctcatttactgggcatctacccgggaatccggggtccctgaccgattcagtggcagcgggtct  gggacagatttcactctcaccatcagcagcctgcaggctgaagatgtggcagtttattactgtcagcaatatt  atagtactcct  (amino acids)  (SEQ ID NO: 552) DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGS  GTDFTLTISSLQAEDVAVYYCQQYYSTP  NCBI germline z00023 light chain variable framework region 1 (FWR1) acid  sequence:  (DNA)  (SEQ ID NO: 553) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaactgc  (amino acids)  (SEQ ID NO: 554) DIVMTQSPDSLAVSLGERATINC  NCBI germline z00023 light chain variable complementarity determining  regions 1 (CDR1) sequence:  (DNA)  (SEQ ID NO: 555) aagtccagccagagtgttttatacagctccaacaataagaactacttagct  (amino acids)  (SEQ ID NO: 556) KSSQSVLYSSNNKNYLA  NCBI germline z00023 light chain variable framework region 2 (FWR2)  sequence:  (DNA)  (SEQ ID NO: 557) tggtaccagcagaaaccaggacagcctcctaagctgctcatttac  (amino acids)  (SEQ ID NO: 558) WYQQKPGQPPKLLIY  NCBI germline z00023 light chain variable complementarity determining  regions 2 (CDR2) sequence:  (DNA)  (SEQ ID NO: 559) tgggcatctacccgggaatcc  (amino acids)  (SEQ ID NO: 560) WASTRES  NCBI germline z00023 light chain variable framework region 3 (FWR3)  sequence:  (DNA)  (SEQ ID NO: 561) ggggtccctgaccgattcagtggcagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctg  aagatgtggcagtttattactgt  (amino acids)  (SEQ ID NO: 562) GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC  NCBI germline z00023 light chain variable complementarity determining  regions3 (CDR3) sequence:  (DNA)  (SEQ ID NO: 563) cagcaatattatagtactcct  (amino acids)  (SEQ ID NO: 564) QQYYSTP  Humanized C8 light chain variable region sequence  (DNA)  (SEQ ID NO: 565) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaact  gcagggccagcaagagtgttagcaccagcggctacagctacatgcactggtaccagcagaaaccagg  acagcctcctaagctgctcatttacctggtgtctaacctggaatccggggtccctgaccgattcagt  ggcagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctgaagatgtggcagttt  attactgtcaacacattcgggaactgaccaggagtgaattcggcggagggaccaaggtggagatcaa  acgaact  (amino acids)  (SEQ ID NO: 566) DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNLESGVPDRFS  GSGSGTDFTLTISSLQAEDVAVYYCQHIRELTRSEFGGGTKVEIKRT  Humanized C8 light chain variable framework region 1 (FWR1)  sequence:  (DNA)  (SEQ ID NO: 567) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaact  gc  (amino acids)  (SEQ ID NO: 568) DIVMTQSPDSLAVSLGERATINC  Humanized C8 light chain variable complementarity determining region 1  (CDR1) sequence:  (DNA)  (SEQ ID NO: 569) agggccagcaagagtgttagcaccagcggctacagctacatg  (amino acids)  (SEQ ID NO: 570) RASKSVSTSGYSYM  Humanized C8 light chain variable framework region 2 (FWR2) sequence:  (DNA)  (SEQ ID NO: 571) cactggtaccagcagaaaccaggacagcctcctaagctgctcatttac  (amino acids)  (SEQ ID NO: 572) HWYQQKPGQPPKLLIY  Humanized C8 light chain variable complementarity determining region 2  (CDR2) sequence:  (DNA)  (SEQ ID NO: 573) ctggtgtctaacctggaatcc  (amino acids)  (SEQ ID NO: 574) LVSNLES  Humanized C8 light chain variable framework region 3 (FWR3) sequence:  (DNA)  (SEQ ID NO: 575) ggggtccctgaccgattcagtggcagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctg  aagatgtggcagtttattactgt  (amino acids)  (SEQ ID NO: 576) GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC  Humanized C8 light chain variable complementarity determining region 3  (CDR3) sequence:  (DNA)  (SEQ ID NO: 577) caacacattcgggaactgaccaggagtgaa  (amino acids)  (SEQ ID NO: 578) QHIRELTRSE  Humanized C8 Lambda light chain sequence  (DNA)  (SEQ ID NO: 579) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaactgcaggg  ccagcaagagtgttagcaccagcggctacagctacatgcactggtaccagcagaaaccaggacagcctcctaa  gctgctcatttacctggtgtctaacctggaatccggggtccctgaccgattcagtggcagcgggtctgggaca  gatttcactctcaccatcagcagcctgcaggctgaagatgtggcagtttattactgtcaacacattcgggaac  tgaccaggagtgaattcggcggagggaccaaggtggagatcaaacgaactggtcagcccaaggctgccccctc  ggtcactctgttcccgccctcctctgaggagcttcaagccaacaaggccacactggtgtgtctcataagtgac  ttctacccgggagccgtgacagtggcctggaaggcagatagcagccccgtcaaggcgggagtggagaccacca  caccctccaaacaaagcaacaacaagtacgcggccagcagctatctgagcctgacgcctgagcagtggaagtc  ccacagaagctacagctgccaggtcacgcatgaagggagcaccgtggagaagacagtggcccctacagaatgt  tcatagtaa  (amino acids)  (SEQ ID NO: 580) DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNLESGVPDRFSGSGSGT  DFTLTISSLQAEDVAVYYCQHIRELTRSEFGGGTKVEIKRTGQPKAAPSVTLFPPSSEELQANKATLVCLISD  FYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC  S**  Humanized C8 Kappa light chain sequence  (DNA)  (SEQ ID NO: 581) gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcgagagggccaccatcaactgcaggg  ccagcaagagtgttagcaccagcggctacagctacatgcactggtaccagcagaaaccaggacagcctcctaa  gctgctcatttacctggtgtctaacctggaatccggggtccctgaccgattcagtggcagcgggtctgggaca  gatttcactctcaccatcagcagcctgcaggctgaagatgtggcagtttattactgtcaacacattcgggaac  tgaccaggagtgaattcggcggagggaccaaggtggagatcaaacgaactacggtggctgcaccatctgtctt  catcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctat  cccagagaggccaaagtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacag  agcaggacagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaagcagactacgagaaaca  caaagtctacgcctgcgaagtcacccatcagggcctgagctcgcccgtcacaaagagcttcaacaggggagag  tgttagtaa  (amino acids)  (SEQ ID NO: 582) DIVMTQSPDSLAVSLGERATINCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLVSNLESGVPDRFSGSGSGT  DFTLTISSLQAEDVAVYYCQHIRELTRSEFGGGTKVEIKRTTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFY  PREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE  C**  Humanized C8 Kappa light chain gBLOCk sequence:  (DNA)  (SEQ ID NO: 583) agctggctaggtaagcttggtaccgagctcggatccacgccaccatggagacagacacactcctgctatgggt  actgctgctctgggttccaggttccactggtgacgacatcgtgatgacccagtctccagactccctggctgtg  tctctgggcgagagggccaccatcaactgcagggccagcaagagtgttagcaccagcggctacagctacatgc  actggtaccagcagaaaccaggacagcctcctaagctgctcatttacctggtgtctaacctggaatccggggt  ccctgaccgattcagtggcagcgggtctgggacagatttcactctcaccatcagcagcctgcaggctgaagat  gtggcagtttattactgtcaacacattcgggaactgaccaggagtgaattcggcggagggaccaaggtggaga  tcaaacgaactacggtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctggaac  tgcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtggataacgcc  ctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagca  ccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctgag  ctcgcccgtcacaaagagcttcaacaggggagagtgttagtaagtttaaacccgctgatcagcctcgactgtg  ccttctagttgc  CAR-T E6 CD8 sequence:  (DNA)  (SEQ ID NO: 584) gaggtccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgcga  gtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaatgggtctc  aacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagatttaccatttcacgagac  aacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacacagctgtttactattgtaccc  gcgacaactatggcaggaactacgactacggtatggactattggggacaagggacattggttacagtgagcag  tggcggcgggggcagcggaggaggaggcagcggtggggggggcagcgagatagtgctcacgcagtcacccgcg  actctcagtctctcacctggggaacgagctaccctgacgtgctctgctacctcctcagtgtcatatattcact  ggtatcagcaacggcccgggcagtcccctagattgctcatttatagtacctctaatctggcctcaggtatccc  tgcacgattttctggatctggttcaggttctgattacaccctcactatctctagcctggagcctgaagacttt  gccgtttattactgccagcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaa  cgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccaga  agcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttgg  gccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgctgataa  (amino acids)  (SEQ ID NO: 585) EVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLEWVSTISGGGTYIYYPDSVKGR  FTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWGQGTLVTVSSGGGGSGGGGSGG  GGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSPRLLIYSTSNLASGIPARFSGS  GSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTPAPRPPTPAPTIASQPLSLRPE  ACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC**  CAR-T C2 CD8 sequence:  (DNA)  (SEQ ID NO: 586) gaagtgcagctcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcg  ccgcctcaggtttcactttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggact  cgagtgggtgtctactatcagctcaggaggcacttatatatattatcctgactctgtaaaaggccga  tttacgatttctcgcgacaatgcaaagaactccctctacctccaaatgaacagtcttagggcagaag  acactgctgtatactattgtgcacgcctcggcggcgacaactactacgagtactttgacgtgtgggg  gaaagggactaccgtgacagtttcaagcggaggaggtggctcaggtggaggcgggtcagggggggga  ggaagtgatattgtgctcacacaatccccagcctccctggctgtgtctcccggccaacgcgctacaa  ttacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgcactggtatcaacagaa  accaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtgcctgcgcgc  ttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgatacag  cgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaat  taagagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaaccc  ctgtctctgagaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatt  tcgcctgtgatatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggt  gattaccctgtactgctgataa  (amino acids)  (SEQ ID NO: 587) EVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLEWVSTISSGGTYIYYPDSVKGR  FTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGKGTTVTVSSGGGGSGGGGSGGG  GSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKPGQPPKLLIYLASNLESGVPAR  FSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIKRTTTTPAPRPPTPAPTIASQP  LSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC**  CD8/4-1BB sequence  (DNA)  (SEQ ID NO: 588) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  tatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctg  tactgcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtacaga  cgactcaagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgtg  ataa  (amino acids)  (SEQ ID NO: 589) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL  YCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL**  CD8/CD28 sequence  (DNA)  (SEQ ID NO: 590) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  tatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctg  tactgcagaagcaagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccag  gccccaccaggaaacattaccagccctacgctccgccacgcgacttcgctgcctaccggtcctgata  a  (amino acids)  (SEQ ID NO: 591) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL  YCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS**  CD8/CD3z sequence:  (DNA)  (SEQ ID NO: 592) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  tatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctg  tactgccgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgt  acaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgaccc  agaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagat  aagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacg  gcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttcc  accacggtgataa  (amino acids)  (SEQ ID NO: 593) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL  YCRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKD  KMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  CD8/CD28/CD3z sequence:  (DNA)  (SEQ ID NO: 594) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  tatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctg  tactgcagaagcaagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccag  gccccaccaggaaacattaccagccctacgctccgccacgcgacttcgctgcctaccggtcccgcgt  taagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctg  aatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcg  gcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcaga  agcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcag  ggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgat  aa  (amino acids)  (SEQ ID NO: 595) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL  YCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYKQGQNQLYNEL  NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQ  GLSTATKDTYDALHMQALPPR**  CD8/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 596) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  tatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctg  tactgcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtacaga  cgactcaagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcg  cgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgag  ctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgg  gcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggc  agaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttat  cagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggt  gataa  (amino acids)  (SEQ ID NO: 597) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL  YCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNE  LNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY  QGLSTATKDTYDALHMQALPPR**  CD8/CD28/4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 598) acgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctga  gaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtga  tatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctg  tactgcagaagcaagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccag  gccccaccaggaaacattaccagccctacgctccgccacgcgacttcgctgcctaccggtccaaaag  gggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtacagacgactcaagag  gaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttct  cccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcgg  tagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcct  cgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttata  gcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtc  cacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 599) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL  YCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKKLLYIFKQPFMRPVQTTQE  EDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP  RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  CAR-T C3 4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 600) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccacagg  ttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggc  ttctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttgag  tggatgggagtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtca  ccatgaccacagacacatccacgagcacagcctacatggagctgaggagcctgagatctgacgacac  ggccgtgtattactgtgcgagaagcgactactacggcccatacttcgactactggggccagggcacc  accctgaccgtgtccagcggcggtggcggatccggcggtggcggatccggcggtggcggatccgata  ttgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgcag  gtctagtcagaccattgtccatagtaatggaaacacctatttggagtggtacctgcagaagccaggc  cagtctccacagctcctgatctataaggtttccaaccggttctctggagtgccagataggttcagtg  gcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctgaggatgttggggttta  ttactgcttccaaggtagccacgtgcctttcaccttcggcggagggaccaaggtggagatcaaacga  actacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctc  tgagaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctg  tgatatctacatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattacc  ctgtactgcaaaaggggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtac  agacgactcaagaggaagacgggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaact  gcgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaac  gagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaa  tgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagat  ggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctt  tatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccac  ggtgataa  (amino acids)  (SEQ ID NO: 601) QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYAMNWVRQAPGQGLEWMGVISTFSGNTNFNQKFKGR  VTMTTDTSTSTAYMELRSLRSDDTAVYYCARSDYYGPYFDYWGQGTTLTVSSGGGGSGGGGSGGGGS  DIVMTQTPLSLSVTPGQPASISCRSSQTIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRF  SGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPFTFGGGTKVEIKRTTTTPAPRPPTPAPTIASQPL  SLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRP  VQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDP  EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP  PR**  C3 CAR gBLOCK 1 sequence:  (DNA)  (SEQ ID NO: 602) atccacgctgttttgacctccatagaagattctagagctagctgtagagcttggtaccgagggccac  catggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccacag  gttcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaagg  cttctggttacacctttaccgactacgccatgaactgggtgcgacaggcccctggacaagggcttga  gtggatgggagtgatcagcaccttcagcggtaacacaaacttcaaccagaagttcaagggcagagtc  accatgaccacagacacatccacgagcacagcctacatggagctgaggagcctgagatctgacgaca  cggccgtgtattactgtgcgagaagcgactactacggcccatacttcgactactggggccagggcac  caccctgaccgtgtccagcggcggtggcggatccggcggtggcggatccggcggtggcggatccgat  attgtgatgacccagactccactctctctgt  C3 CAR gBLOCK 2 sequence:  (DNA)  (SEQ ID NO: 603) tattgtgatgacccagactccactctctctgtccgtcacccctggacagccggcctccatctcctgc  aggtctagtcagaccattgtccatagtaatggaaacacctatttggagtggtacctgcagaagccag  gccagtctccacagctcctgatctataaggtttccaaccggttctctggagtgccagataggttcag  tggcagcgggtcagggacagatttcacactgaaaatcagccgggtggaggctgaggatgttggggtt  tattactgcttccaaggtagccacgtgcctttcaccttcggcggagggaccaaggtggagatcaaac  gaactacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtc  tctgagaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcc  tgtgatatctacatttgggccccgctcgcaggcacatgtg  E6 scFV gBLOCK 1 sequence:  (DNA)  (SEQ ID NO: 604) tgctctgggttccaggttccactggtgacgcggcccagccggccgaggtgcagctggtggagtctgg  gggaggcctggtcaagcctggggggtccctgagactctcctgtgcagcctctggattcaccttcagt  aggtatggcatgagctgggtccgccaggctccagggaagaggctggagtgggtctcaaccattagtg  gcggaggcacctacatatactacccagactcagtgaagggccgattcaccatctccagagacaacgc  caagaacaccctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtacc  agagataactatggccgcaactatgattatggcatggattattggggccagggcaccctggtgaccg  tgagcagcggcggtggcggatccggcggtggcggatccggcggtggcggatcc  E6 scFV gBLOCK 2 sequence:  (DNA)  (SEQ ID NO: 605) ggcggtggcggatccggcggtggcggatccggcggtggcggatccgaaattgtgttgacacagtctc  cagccaccctgtctttgtctccaggggaaagagccaccctcacctgcagcgccaccagcagtgttag  ctacatccactggtaccaacagaggcctggccagagccccaggctcctcatctatagcacctccaac  ctggccagcggcatcccagccaggttcagtggcagtgggtctgggagcgactacactctcaccatca  gcagcctagagcctgaagattttgcagtttattactgtcagcagcgtagcagctcccctttcacctt  tggcagcggcaccaaagtggaaattaaaaccggtcatcatcaccatcaccactgataagtttaaacc  cgctgatcagcctcgactgtgccttctagt  CAR-T C2 CD3z sequence:  (DNA)  (SEQ ID NO: 606) atggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcctgaagtgcagc  tcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcctcaggtttcac  tttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtctactatcagc  tcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaaga  actccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcacgcctcggcgg  cgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagcggaggaggtggc  tcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctccctggctgtgt  ctcccggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgca  ctggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtg  cctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgata  cagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaattaa  gagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctg  agaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatct  acatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgccgcgt  taagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctc  ggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgca  ggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcgg  aatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagat  acgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 607) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLE  WVSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGK  GTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKP  GQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIK  RTTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI  TLYCRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQ  KDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  CAR-T C2 CD28/CD3z sequence:  (DNA)  (SEQ ID NO: 608) atggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcctgaagtgcagc  tcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcctcaggtttcac  tttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtctactatcagc  tcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaaga  actccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcacgcctcggcgg  cgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagcggaggaggtggc  tcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctccctggctgtgt  ctcccggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgca  ctggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtg  cctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgata  cagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaattaa  gagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctg  agaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatct  acatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcagaag  caagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggccccaccaggaaacat  taccagccctacgctccgccacgcgacttcgctgcctaccggtcccgcgttaagttctcccgatcagccgacg  cgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgt  gttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactg  tacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgag  ggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgca  ggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 609) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLE  WVSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGK  GTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKP  GQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIK  RTTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI  TLYCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYKQGQNQLYN  ELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL  YQGLSTATKDTYDALHMQALPPR**  CAR-T C2 4-1BB/CD3z sequence:  (DNA)  (SEQ ID NO: 610) atggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcctgaagtgcagc  tcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcctcaggtttcac  tttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtctactatcagc  tcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaaga  actccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcacgcctcggcgg  cgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagcggaggaggtggc  tcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctccctggctgtgt  ctcccggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgca  ctggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtg  cctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgata  cagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaattaa  gagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctg  agaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatct  acatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcaaaag  gggccgcaaaaaactcctttacatttttaagcagccttttatgaggccagtacagacgactcaagaggaagac  gggtgctcatgccgctttcctgaggaggaggaaggagggtgcgaactgcgcgttaagttctcccgatcagccg  acgcgcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacga  cgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggaggga  ctgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagac  gagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatat  gcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 611) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLE  WVSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGK  GTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKP  GQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIK  RTTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI  TLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLY  NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG  LYQGLSTATKDTYDALHMQALPPR**  CAR-T C2 OX40/CD3z sequence:  (DNA)  (SEQ ID NO: 612) atggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcctgaagtgcagc  tcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcctcaggtttcac  tttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtctactatcagc  tcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaaga  actccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcacgcctcggcgg  cgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagcggaggaggtggc  tcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctccctggctgtgt  ctcccggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgca  ctggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtg  cctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgata  cagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaattaa  gagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctg  agaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatct  acatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgccggag  ggaccagaggctgccccccgatgcccacaagccccctgggggaggcagtttccggacccccatccaagaggag  caggccgacgcccactccaccctggccaagatccgcgttaagttctcccgatcagccgacgcgcctgcttaca  agcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacg  gagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttg  cagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacg  acggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgccctccatatgcaggcacttccacc  acggtgataa  (amino acids)  (SEQ ID NO: 613) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLE  WVSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGK  GTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKP  GQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIK  RTTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI  TLYCRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKIRVKFSRSADAPAYKQGQNQLYNELNL  GRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL  STATKDTYDALHMQALPPR**  CAR-T C2 CD28/OX40/CD3z sequence:  (DNA)  (SEQ ID NO: 614) atggccttgccagtgacggccctgctgctgccattggctcttctgttgcacgctgccaggcctgaagtgcagc  tcgtagagagtggcgggggactggtgaagcccggtggaagcctcagactcagttgcgccgcctcaggtttcac  tttttcaggttacgccatgtcctgggtaagacaggcaccggggaaaggactcgagtgggtgtctactatcagc  tcaggaggcacttatatatattatcctgactctgtaaaaggccgatttacgatttctcgcgacaatgcaaaga  actccctctacctccaaatgaacagtcttagggcagaagacactgctgtatactattgtgcacgcctcggcgg  cgacaactactacgagtactttgacgtgtgggggaaagggactaccgtgacagtttcaagcggaggaggtggc  tcaggtggaggcgggtcaggggggggaggaagtgatattgtgctcacacaatccccagcctccctggctgtgt  ctcccggccaacgcgctacaattacatgtcgggcctccaaaagcgtgagcaccagcggctacagctacatgca  ctggtatcaacagaaaccaggacaaccccccaaactgttgatttatctcgcttcaaacttggagtccggcgtg  cctgcgcgcttttcagggagtgggagcggcacagattttacgctgactatcaaccccgtagaagcaaacgata  cagcgaattattattgtcaacattcccgggaactcccctttacgttcggcgggggcacaaaggtcgaaattaa  gagaaccacgacaaccccggcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctg  agaccagaagcctgtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatct  acatttgggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcagaag  caagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggccccaccaggaaacat  taccagccctacgctccgccacgcgacttcgctgcctaccggtcccggagggaccagaggctgccccccgatg  cccacaagccccctgggggaggcagtttccggacccccatccaagaggagcaggccgacgcccactccaccct  ggccaagatccgcgttaagttctcccgatcagccgacgcgcctgcttacaagcagggccagaaccaactgtac  aacgagctgaatctcggtagacgggaagagtacgacgtgttggacaaacggagaggccgcgacccagaaatgg  gcggcaagcctcgcaggaaaaacccccaggagggactgtacaatgagttgcagaaagataagatggcagaagc  ttatagcgagatcggaatgaagggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtcc  acagcaacaaaagatacgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 615) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSGYAMSWVRQAPGKGLE  WVSTISSGGTYIYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGGDNYYEYFDVWGK  GTTVTVSSGGGGSGGGGSGGGGSDIVLTQSPASLAVSPGQRATITCRASKSVSTSGYSYMHWYQQKP  GQPPKLLIYLASNLESGVPARFSGSGSGTDFTLTINPVEANDTANYYCQHSRELPFTFGGGTKVEIK  RTTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVI  TLYCRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRRDQRLPPDAHKPPGGGSFRTP  IQEEQADAHSTLAKIRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK  NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  CAR-T E6 OX40/CD3z sequence:  (DNA)  (SEQ ID NO: 616) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggggggg  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttg  ggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgccggagg  gaccagaggctgccccccgatgcccacaagccccctgggggaggcagtttccggacccccatccaag  aggagcaggccgacgcccactccaccctggccaagatccgcgttaagttctcccgatcagccgacgc  gcctgcttacaagcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtac  gacgtgttggacaaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaaccccc  aggagggactgtacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaa  gggggaaaggagacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagat  acgtatgacgccctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 617) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTP  APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRR  DQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKIRVKFSRSADAPAYKQGQNQLYNELNLGRREEY  DVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKD  TYDALHMQALPPR**  CAR-T E6 CD28/OX40/CD3z sequence:  (DNA)  (SEQ ID NO: 618) atggccctgcccgtgaccgctttgctgctccccctggcgctgctgctgcacgccgccaggccagagg  tccagctggttgagagtggcggtgggctggttaagcctggcggctccctgcggctgagctgcgccgc  gagtggatttactttcagccgatatgggatgagttgggtgcggcaagctcccgggaagaggctggaa  tgggtctcaacaatctccggggggggcacttacatctattaccccgactcagtcaaggggagattta  ccatttcacgagacaacgctaagaataccctgtatttgcagatgaattctctgagagcagaggacac  agctgtttactattgtacccgcgacaactatggcaggaactacgactacggtatggactattgggga  caagggacattggttacagtgagcagtggcggcgggggcagcggaggaggaggcagcggtggggggg  gcagcgagatagtgctcacgcagtcacccgcgactctcagtctctcacctggggaacgagctaccct  gacgtgctctgctacctcctcagtgtcatatattcactggtatcagcaacggcccgggcagtcccct  agattgctcatttatagtacctctaatctggcctcaggtatccctgcacgattttctggatctggtt  caggttctgattacaccctcactatctctagcctggagcctgaagactttgccgtttattactgcca  gcagaggtctagctccccattcacctttgggagtgggaccaaggttgaaattaaaacgacaaccccg  gcccccagaccaccaacgccagcccccaccatcgccagccaacccctgtctctgagaccagaagcct  gtaggcctgccgccggtggagctgtgcacacaagaggactggatttcgcctgtgatatctacatttg  ggccccgctcgcaggcacatgtggagtgctcctcctctccctggtgattaccctgtactgcagaagc  aagcggtctcggctcctgcattctgattacatgaacatgaccccaagaagaccaggccccaccagga  aacattaccagccctacgctccgccacgcgacttcgctgcctaccggtcccggagggaccagaggct  gccccccgatgcccacaagccccctgggggaggcagtttccggacccccatccaagaggagcaggcc  gacgcccactccaccctggccaagatccgcgttaagttctcccgatcagccgacgcgcctgcttaca  agcagggccagaaccaactgtacaacgagctgaatctcggtagacgggaagagtacgacgtgttgga  caaacggagaggccgcgacccagaaatgggcggcaagcctcgcaggaaaaacccccaggagggactg  tacaatgagttgcagaaagataagatggcagaagcttatagcgagatcggaatgaagggggaaagga  gacgagggaaaggacacgacggcctttatcagggcctgtccacagcaacaaaagatacgtatgacgc  cctccatatgcaggcacttccaccacggtgataa  (amino acids)  (SEQ ID NO: 619) MALPVTALLLPLALLLHAARPEVQLVESGGGLVKPGGSLRLSCAASGFTFSRYGMSWVRQAPGKRLE  WVSTISGGGTYIYYPDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRDNYGRNYDYGMDYWG  QGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLTCSATSSVSYIHWYQQRPGQSP  RLLIYSTSNLASGIPARFSGSGSGSDYTLTISSLEPEDFAVYYCQQRSSSPFTFGSGTKVEIKTTTP  APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRS  KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRRDQRLPPDAHKPPGGGSFRTPIQEEQA  DAHSTLAKIRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGL  YNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR**  MUC1 truncated cytoplasmic sequence  (amino acids)  (SEQ ID NO: 620) SNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY  MUC1 truncated cytoplasmic sequence  (amino acids)  (SEQ ID NO: 621) SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRY  MUC1 truncated cytoplasmic sequence  (amino acids)  (SEQ ID NO: 622) LTLAFREGTINVHDVETQFNQY  MUC1 truncated cytoplasmic sequence  (amino acids)  (SEQ ID NO: 623) SNIKFRPGSVVVQLTLAFREGTIN  Primers  (SEQ ID NO: 624) attctaagcttgggccaccatggaactg  (SEQ ID NO: 625) tctagagtttaaacttactatttacccggagacagggagag  (SEQ ID NO: 626) agtatggcccagccggccgaggtgcagctggtggagtctgg  (SEQ ID NO: 627) tagaaggcacagtcgaggctgatcag  (SEQ ID NO: 628) attctaagcttgggccaccatggaagc  (SEQ ID NO: 629) tctagagtttaaacttactaacactctcccctgttgaagc  (SEQ ID NO: 630) agtatggcccagccggccgaaattgtgttgacacagtctccag  (SEQ ID NO: 631) tagaaggcacagtcgaggctgatcag  (SEQ ID NO: 632) actgtcatatggaggtgcagctggtggagtctg  (SEQ ID NO: 633) actgtctcgagtttaatttccactttggtgccgctgc  (SEQ ID NO: 634) actgtcatatggaggtgcagctggtggagtctg  (SEQ ID NO: 635) actgtaccggttttaatttccactttggtgccgctgc  (SEQ ID NO: 636) cttcttcctcaggagcaagctcaccgtgg  (SEQ ID NO: 637) gagccgtcggagtccagc  (SEQ ID NO: 638) gcacctgaactcctgggg  (SEQ ID NO: 639) tttaatttccactttggtgccg  (SEQ ID NO: 640) cgcggctagcttaagcttggtaccgagggcca  (SEQ ID NO: 641) cgcggcggccgcctgatcagcgggtttaaacttatc 

(167) The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications are intended to fall within the scope of the appended claims. The following examples are offered by way of illustration of the present invention, and not by way of limitation.

EXAMPLES

Example 1— ELISA Competition with NME1 and NME7

(168) PSMGFR peptide was covalently coupled to BSA using Imject Maleimide activated BSA kit (Thermo Fisher). PSMGFR peptide coupled BSA was diluted to 7.5 ug/mL in 0.1M carbonate/bicarbonate buffer pH 9.6 and 50 uL was added to each well of a 96 well plate. After overnight incubation at 4° C., the plate was wash twice with PBS-T and a 3% BSA solution was added to block remaining binding site on the well. After 1h at RT the plate was washed twice with PBS-T and NMElor NME7, diluted in PBS-T+1% BSA, was added at saturating concentration. After 1h at RT the plate was washed 3× with PBS-T and anti-MUC1* antibody (or antibody fragments), diluted in PBS-T+1% BSA, was added (5x molar excess comapred to NME1/NME7). After 1h at RT the plate was washed 3× with PBS-T and goat anti HisTag-HRP, diluted in PBS-T+1% BSA, was added at 1/10000 dilution. After 1h at RT the plate was washed 3× with PBS-T and remaining NME1 or NME7 bound to the PSMGFR peptide was measured at 415 nm using a ABTS solution (Thermo Fisher).

Example 2-Humanization of Anti-MUC1* Extracellular Domain Monoclonal Antibodies

(169) We generated humanized antibodies that bind to the extracellular domain of MUC1* by a process called complementarity determining region, ‘CDR’, grafting. First, homology searches were performed to independently align the heavy chain variable region and light chain variable region nucleotides sequences of mouse monoclonal anti-MUC1* antibody (E6 HC SEQ ID NOS:12-13; LC SEQ ID NOS:65-66 and MN-C2 HC SEQ ID NO:118-119; LC SEQ ID NO: 168-169) against a repertoire of human antibody sequences (IMGT, the international ImMunoGeneTics information system). The sequences with the highest homology were selected. IGHV3-21*01 is a human IgG heavy chain variable region sequence with 82.9% (DNA) and 74.5% (amino acids) identity to MouseMN-E6 heavy chain variable region. IGKV3-11*02 is a human IgG light chain variable region sequence with 68.8% (DNA) and 61.1% (amino acids) identity to MouseMN-E6 light chain variable region. IGHV3-21*04 is a human IgG heavy chain variable region sequence with 85% (DNA) and 81.6% (amino acids) identity to Mouse MN-C2 heavy chain variable region. IGKV7-3*01 is a human IgG light chain variable region sequence with 76.9% (DNA) and 71.3% (amino acids) identity to Mouse MN-C2 light chain variable region. Second, a model of the mouse scFv was generated to select and keep the mouse residues important for the stability of the CDR and framework. Finally, CDRs from the human germlines were replaced by the corresponding mouse CDRs.

(170) Humanized MN-E6 IgG2 Heavy Chain Cloning

(171) The Kozak consensus sequence followed by the IGHV3-21*03 leader sequence, the humanizedMN-E6 heavy chain variable region and the constant region of human IgG2 was synthesized by our request by GenScript, NJ (SEQ ID NOS:52-53. The cDNA was amplified by polymerase chain reaction (PCR) using the following primer: 5′-ATTCTAAGCTTGGGCCACCATGGAACTG-3′ (SEQ ID NO:624) and 5′-TCTAGAGTTTAAACTTACTATTTACCCGGAGACAGGGAGAG-3′ (SEQ ID NO:625). After digestion with HindIII and PmeI restriction enzymes (New England Biolabs), the purified fragment was cloned into the pCDNA 3.1 V5 vector (Life Technologies) digested with the same restriction enzymes.

(172) Humanized MN-E6 heavy chain cDNA was amplified by polymerase chain reaction (PCR) using the following primer: 5′-AGTATGGCCCAGCCGGCCGAGGTGCAGCTGGTGGAGTCTGG-3′ (SEQ ID NO:626) and 5′-TAGAAGGCACAGTCGAGGCTGATCAG-3′ (SEQ ID NO:627). After digestion with SfiI and PmeI restriction enzymes (New England Biolabs), the purified fragment was cloned into the pSECTag2 vector (Life Technologies) digested with the same restriction enzymes.

(173) Humanized MN-E6 Kappa Light Chain Cloning

(174) The Kozak consensus sequence followed by the IGHV3-11*02 leader sequence, the humanizedMN-E6 light chain variable region and the constant region of human Kappa light chain was synthesized by our request by GenScript, NJ (SEQ ID NOS: 107-108). The cDNA was amplified by polymerase chain reaction (PCR) using the following primer: 5′-ATTCTAAGCTTGGGCCACCATGGAAGC-3′ (SEQ ID NO:628) and 5′-TCTAGAGTTTAAACTTACTAACACTCTCCCCTGTTGAAGC-3′ (SEQ ID NO:629). After digestion with HindIII and PmeI restriction enzymes (New England Biolabs), the purified fragment was cloned into the pCDNA 3.1 V5 vector (Life Technologies) digested with the same restriction enzymes.

(175) HumanizedMN-E6 light chain cDNA was amplified by polymerase chain reaction (PCR) using the following primer: 5′-AGTATGGCCCAGCCGGCCGAAATTGTGTTGACACAGTCTCCAG-3′ (SEQ ID NO:630) and 5′-TAGAAGGCACAGTCGAGGCTGATCAG-3′ (SEQ ID NO:631). After digestion with SfiI and PmeI restriction enzymes (New England Biolabs), the purified fragment was cloned into the pSECTag2 vector (Life Technologies) digested with the same restriction enzymes.

(176) Humanized MN-E6 IgG1 Heavy Chain Cloning

(177) HumanizedMN-E6 IgG2 constructs (pCDNA 3.1 V5 and pSECTag2) were digested with BstEII and PmeI (New England Biolabs) to remove the IgG2 heavy chain constant region. The vector with humanizedMN-E6 heavy chain variable region was purified. Human IgG1 heavy chain constant region was synthesized by our request by IDT, IA (SEq ID NOS: 60-61). Both gBLOCKS and the purified vector with humanizedMN-E6 variable region were ligated using the Gibson assembly cloning kit (New England Biolabs).

(178) HumanizedMN-E6 Lambda Light Chain Cloning

(179) HumanizedMN-E6 kappa light chain constructs (pCDNA 3.1 V5 vector and pSECTag2 vector) were digested with KpnI and PmeI (New England Biolabs) to remove the kappa light chain constant region. The vector with humanizedMN-E6 light chain variable region was purified. Human lambda light chain constant region was synthesized by our request by IDT, IA (SEQ ID NO: 115). Both, gBLOCK and the purified vector with humanizedMN-E6 light chain variable region were ligated using the Gibson assembly cloning kit (New England Biolabs).

(180) Humanized MN-C2 IgG1 and IgG2 Heavy Chain Cloning

(181) HumanizedMN-E6 IgG1 and IgG2 heavy chain in pSECTag2 were digested with SfiI and AgeI to remove theMN-E6 variable region. HumanizedMN-E6 IgG1 and IgG2 heavy chain in pCDNA 3.1 V5 were digested with HindIII and AgeI to remove theMN-E6 variable region The vectors with human IgG1 or IgG2 constant region were purified. Humanized MN-C2 heavy chains were synthesized by our request by IDT, IA (SEQ ID NOS:160 and 165). Sequence to be cloned into pCDNA 3.1 V5 contains in 5′ the murine Ig kappa chain leader sequence (SEQ ID NO 160). Both, gBLOCK and purified vector with human IgG1 or IgG2 constant region were ligated using the Gibson assembly cloning kit (New England Biolabs).

(182) Humanized MN-C2 Kappa/Lambda Light Chain Cloning

(183) Two humanized MN-C2 variable region fused to the kappa light chain constant region and two humanized MN-C2 variable region fused to the lambda light chain constant region were synthesized by our request by IDT, IA (SEQ ID NOS: 210 and 213 and SEQ ID NOS: 216 and 219, respectively). pCDNA 3.1 V5 was digested with HindIII and PmeI restriction enzymes (New England Biolabs) and pSEC Tag2 was digested with SfiI and PmeI restriction enzymes (New England Biolabs). Both plasmids were then purified. SEQ ID NOS: 210 and 216 were ligated into digested pCDNA 3.1 V5 and SEQ ID NOS: 213 and 219 were ligated into digested pSEC Tag2 using the Gibson assembly cloning kit (New England Biolabs).

(184) Humanized C3 IgG1 Heavy Chain Cloning

(185) Humanized E6 IgG1 construct (pSECTag2) was digested with SfiI and AgeI (New England Biolabs) to remove the E6 heavy chain variable region. The vector without humanized E6 heavy chain variable region was purified. Humanized C3 heavy chain variable region was synthesized by our request by IDT, IA (SEQ ID NO:457). gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(186) Humanized C3 Kappa Light Chain Cloning

(187) pEF V5-His was digested with BamHI and PmeI (New England Biolabs) and purified. Humanized C3 kappa light chain was synthesized by our request by IDT, IA (SEq ID NO:504). Both, gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(188) Humanized C8 Kappa Light Chain Cloning

(189) pEF V5-His was digested with BamHi and PmeI (New England Biolabs) and purified.

(190) Humanized C8 kappa light chain was synthesized by our request by IDT, IA (SEq ID NO:583). Both, gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

Example 3— Cloning of Humanized scFV of Anti-MUC1* Extracellular Domain Antibodies

(191) Humanized E6 scFV Cloning:

(192) pSEC Tag2 was digested with SfiI and PmeI (New England Biolabs) and purified. Humanized E6 scFV gBLOCKS were synthesized by our request by IDT, IA (SEQ ID NOS: 604-605). Both, gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(193) Humanized E6 scFV cDNA was amplified by polymerase chain reaction (PCR) using the following primers: 5-ACTGTCATATGGAGGTGCAGCTGGTGGAGTCTG-3′ (SEQ ID NO:632) and 5′-ACTGTCTCGAGTTTAATTTCCACTTTGGTGCCGCTGC-3′ (SEQ ID NO:633). After digestion with NdeI and XhoI restriction enzymes (New England Biolabs), the purified fragment was cloned into the pET21b vector (Novagen) digested with the same restriction enzymes. Humanized E6 scFV cDNA was cloned 5′ of the Histidine Tag for protein purification.

(194) Humanized E6 scFV cDNA was amplified by polymerase chain reaction (PCR) using the following primers: 5-ACTGTCATATGGAGGTGCAGCTGGTGGAGTCTG-3′ (SEQ ID NO:634) and 5′-ACTGTACCGGTTTTAATTTCCACTTTGGTGCCGCTGC-3′ (SEQ ID NO:635). After digestion with NdeI and AgeI restriction enzymes (New England Biolabs), the purified fragment was cloned into a modified pET21b vector (Novagen) digested with the same restriction enzymes. The vector was modified to include the StrepTag2 sequence followed by 2 stop codons 5′ of the Histidine Tag. Humanized E6 scFV cDNA was cloned 5′ of the StrepTag2 for protein purification.

(195) Humanized E6, C2, C3 and C8 scFV-Fc Cloning

(196) Humanized E6 IgG1 construct (pSECTag2) was digested with SfiI and SacII (New England Biolabs) to remove the E6 heavy chain variable region and part of the IgG1 heavy chain constant region. The vector without humanized E6 heavy chain variable region was purified. Humanized E6, C2, C3 and C8 scFV gBLOCKS were synthesized by our request by IDT, IA (SEQ ID NO:258-259, 262-263, 266-267 and 270-271). E6, C2, C3 and C8 gBLOCKS and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs) to assemble the corresponding scFV in frame of the human IgG1 Fc region.

(197) Humanized E6 scFV-Fc Y407R Cloning

(198) Humanized E6 scFV-Fc tyrosine 407 was mutated to an arginine (Y407R) by site directed mutagenesis. The Q5 site directed mutagenesis kit (NEB) was used with the following primers: 5′-CTTCTTCCTCAGGAGCAAGCTCACCGTGG-3′ (SEQ ID NO:636) and 5′-GAGCCGTCGGAGTCCAGC-3′ (SEQ ID NO:637)

(199) Humanized E6 scFV-Fc Hingeless Cloning

(200) Hinge region of humanized E6 scFV-Fc was removed by site directed mutagenesis. The Q5 site directed mutagenesis kit (NEB) was used with the following primers: 5′-GCACCTGAACTCCTGGGG-3′ (SEQ ID NO:638) and 5′-TTTAATTTCCACTTTGGTGCCG-3′ (SEQ ID NO:639)

Example 4— Cloning of CAR-T of Anti-MUC1* Extracellular Domain Antibodies

(201) Car E6 Cd28/4-1Bb/Cd3z Cloning:

(202) pCDNA 3.1 V5 was digested with KpnI and PmeI (New England Biolabs) and purified. Full CAR-T E6 (CD8/CD28/4-1BB/CD3z) gBLOCK was synthesized by our request by IDT, IA (SEq ID NO:305). Both, gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(203) Car E6 Cd3z Cloning:

(204) pCDNA 3.1 V5 CAR-T E6 CD8/CD28/4-1BB/CD3z was digested with EcoRV and PmeI (New England Biolabs) to remove cytoplasmic domains. The vector without cytoplasmic domains was purified. CAR-T E6 CD8/CD3z gBLOCK was synthesized by our request by IDT, IA (SEq ID NO:296). Both, gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(205) Car E6 Cd28/Cd3z Cloning:

(206) pCDNA 3.1 V5 CAR-T E6 CD8/CD28/4-1BB/CD3z was digested with EcoRV and PmeI (New England Biolabs) to remove cytoplasmic domains. The vector without cytoplasmic domains was purified. CAR-T E6 CD8/CD28/CD3z gBLOCK was synthesized by our request by IDT, IA (SEq ID NO:299). Both, gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(207) Car E6 4-1Bb/Cd3z Cloning:

(208) pCDNA 3.1 V5 CAR-T E6 CD8/CD28/4-1BB/CD3z was digested with EcoRV and PmeI (New England Biolabs) to remove cytoplasmic domains. The vector without cytoplasmic domains was purified. CAR-T E6 CD8/4-1BB/CD3z gBLOCK was synthesized by our request by IDT, IA (SEq ID NO:302). Both, gBLOCK and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(209) Car C2 Cd28/4-1Bb/Cd3z Cloning:

(210) pCDNA 3.1 V5 CAR-T E6 CD8/CD28/4-1BB/CD3z was digested with KpnI and EcoRV (New England Biolabs) E6 scFV. The vector without E6 scFV was purified. CAR-T C2 gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 308-309). Both, gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(211) CAR Sub-Cloning into Lentiviral Vectors:

(212) All pcDNA 3.1 V5 CAR cDNAs were amplified by polymerase chain reaction (PCR) using the following primers: 5-CGCGGCTAGCTTAAGCTTGGTACCGAGGGCCA-3′ (SEQ ID NO:640) and 5′-CGCGGCGGCCGCCTGATCAGCGGGTTTAAACTTATC-3′ (SEQ ID NO:641).

(213) After digestion with NheI and NotI restriction enzymes (New England Biolabs), the purified fragments were cloned into lentiviral vectors (pCDH-EF1-MCS-IRES GFP and pCDH-CMV-MCS-EF1-copGFP+puro, SBI) digested with the same restriction enzymes.

(214) Car-E6-Fc/8/41Bb/Cd3z Cloning:

(215) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 313 and 314). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(216) Car-E6-Fch/8/41Bb/Cd3z Cloning:

(217) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 317 and 314). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(218) Car-E6-Fc-4-41Bb-Cd3z Cloning:

(219) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 313 and 320). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(220) Car-E6 FcH/4/41Bb/Cd3z Cloning:

(221) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 317 and 320). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(222) Car-E6 IgD/8/41Bb/Cd3z Cloning:

(223) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 325 and 326). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(224) Car-E6 IgD/4/41Bb/Cd3z Cloning:

(225) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 329 and 326). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(226) Car-E6 X4/8/41Bb/Cd3z Cloning:

(227) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 332 and 326). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(228) Car-E6 X4/4/41Bb/Cd3z Cloning:

(229) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 335 and 326). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

(230) Car E6−8+4−4−41Bb-Cd3z Cloning:

(231) pCDH-CMV-MCS-EF1-copGFP+puro (SBI) was digested with NheI and NotI (New England Biolabs) and the vector was purified. gBLOCKs were synthesized by our request by IDT, IA (SEq ID NOS: 312, 338 and 326). The gBLOCKs and the purified vector were ligated using the Gibson assembly cloning kit (New England Biolabs).

Example 5-Lentivirus Production

(232) HEK 293T cells (ATCC) were used to produce lentivirus. The day prior transfection plates (6well plate) were coated with poly-D-lysine and cells seeded so that cell density reaches 90-95% at the time of transfection and cultures in a 5% CO2 atmosphere. The next daycells were transfected with Lipofectamine 3000 (life technologies) and Opti-MEM® I Reduced Serum Medium according to the manufacturer instructions(0.75 ug of lentiviral expression vecotr and 2.25 ug of pPACKH1 packaging mix was used). After 6h incubation, the media was changed and media containing lentivirus was harvested after 24 and 48 hours. Lentivirus was concentrated with Lenti-X concentrator (Clontech) and titer was calculated using the Lenti-X p@4 Rapid Titer Kit (Clontech). Lentivirus was store at −80C in single-use aliquots.

Example 6-Lipofectamine Transient Expression

(233) HEK 293T cells (ATCC) were used to test expression of humanized IgG. The night before transfection, cells were passed at 1/3 dilution (6well plate) and cultures in a 5% CO2 atmosphere. The next day, 1 hour before transfection, the media was change to complete media without antibiotics (DMEM high glucose from ATCC containing 10% fetal calf serum). For transfection, we used Lipofectamine 3000 (life technologies) and Opti-MEM® I Reduced Serum Medium according to the manufacturer instructions. 1.25 ug of the heavy chain construct and 1.25 ug of the light chain construct or 2,5 ug of Fc-fusion constructs was used. After 48h incubation, the media was collected, cleared by centrifugation and used in an ELISA assay to quantify the level of humanized IgG expression and binding to PSMGFR peptide.

Example 7-Polyethylenimine (PEI) Large Scale Transient Expression

(234) HEK 293T cells (ATCC) were used for large scale expression of Fc-fusion protein. The night before transfection, cells were passed (6.5×10.sup.6 cells in 150 mm dish) and cultures in a 5% CO2 atmosphere. The next day, 1 hour before transfection, cell were washed once with PBS pH 7.4 and the media was change to complete media without antibiotics (DMEM high glucose from ATCC containing 10% ultra low IgG fetal calf serum). For transfection, we used Polyethylenimine “Max” (PEI “Max”, Polysciences) and Opti-MEM® I Reduced Serum Medium (25 ug of Fc-fusion constructs+250 ug of PEI). After 72h incubation, the media was collected and stored at −20° C. or cleared by centrifugation/filtration for purification.

Example 8-Jurkat Cells Lentivirus Transduction

(235) Protocol #1: A 50/50 solution (2 mL) of lentivirus was prepared in fresh media, supplemented with 8 ug/mL of polybrene and added to a well of a 6 well plate. Jurkat E6-1 cells (ATCC, TIB-152) were pelleted at 1200 rpm for 5 min at RT and resuspended in fresh media (RPMI containing 10% fetal calf serum and 1% penicillin/streptomycin/amphotericin b). Cells were counted and add 2×10.sup.5 cells to the well containing the virus+Polybrene solution. Incubate for 24-48h and add fresh media and/or split the cells. After 72h, start growing cells with antibiotic selection (puromycin).

(236) Protocol #2: Jurkat E6-1 cells (ATCC, TIB-152) were pelleted at 1200 rpm for 5 min at RT and resuspended in fresh media (RPMI containing 10% fetal calf serum and 1% penicillin/streptomycin/amphotericin b) at 2.5×10.sup.5 cells/mL. Add 2 mL of cells to a 15 mL sterile conical tube, add 1X of Transdux infection reagent (1X, SBI) and lentivirus. Mix gently and incubate at RT for 20 min. Centrifuge cells at 1900 rpm for 30 min at 32° C., remove supernatant, resuspend cells in 2 mL of fresh media and transfer cells to a well of a 6 well plate. Inspect cells for GFP expression after 48h.

Example 9-T Cells Lentivirus Transduction

(237) Highly purified T cells (AllCells) were pelleted at 200 xg for 5 min at RT and resuspended at 1×10.sup.6 cells/mL in fresh media (RPMI1640 containing 10% fetal calf serum and 1% penicillin/streptomycin). Add CD3/CD28 activator Dynabeads (Thermo Fisher, 25 uL for 1×10.sup.6 cells) and seed 24 well plate with 1 mL of cells and add IL2 (Thermo Fisher). Monitor cells daily and split cells if needed. The day before the transduction coat a plate with Retronectin (Takara) and store it overnight at 4° C. The next, remove the Retronectin solution add add a blocking solution (2% BSA in PBS) and incubate 30 min at RT. Remove BSA solution add add PBS until cells are ready. Collect activated T cells and resuspend them at 0.5×10.sup.6 cells/mL in fresh media. Add 1 mL of cells to the retronectin treated plate, 1 mL of lentivirus solution and IL2. Cells were spinoculated by centrifugation of the pate at 1000 xg for 90 min at RT. The plate was return to the incubator overnight. Next, remove 1 mL of media, add 1 mL of virus and repeat spinoculation. Monitor cells and split them if necessarry at a density of 0.5-1×10.sup.6 cells/mL. T cells can be used for cytokine release assay or cytotoxicity assay 48h post transduction.

Example 10-IL2 Detection

(238) IL-2 secretion in media was measured using a human IL-2 ELISA kit (Thermo Fisher). Plates were coated with and anti-IL-2 antibody (coating antibody, 1/100 in PBS). After overnight incubation at 4° C., the plate was wash 3 times with PBS-T and a 4% BSA solution was added to block remaining binding site on the well. After 1h at RT the plate was washed once with PBS-T and conditioned media (CM) and IL-2 standard diluted in PBS+4% BSA, was added. After 2h at RT the plate was washed 3× with PBS-T and anti-human IL-2 (detection antibody) diluted in PBS+4% BSA (1/100), was added. After 2h at RT the plate was washed 5x with PBS-T and Streptavidin-HRP (1/400) was added. After 30 min at RT, the plate was washed 7x with PBS-T (soak 1 min each wash) and.substrate solution was added. The reaction was stopped after 20 min by adding the stop solution and absorbance was read at 450 nm (minus absorbance at 550 nm) within 30 min of stopping.

Example 11-IFN-γ Detection

(239) IFN-γ secretion in media was measured using a human IFN-γ ELISA kit (Biolegend). Plates were coated with and anti-IFN-γ antibody (capture antibody, 1X in coating buffer). After overnight incubation at 4° C., the plate was washed 4 times with PBS-T and blocking solution was added to block remaining binding site on the well. After 1h at RT (shaking at 500 rpm) the plate was washed 4 times with PBS-T and conditioned media (CM) and IFN-γ standard, was added. After 2h at RT with shaking, the plate was washed 4 times with PBS-T and detection antibody (1X), was added. After 1h at RT with shaking, the plate was washed 4 times with PBS-T and Avidin-HRP (1X) was added. After 30 min at RT with shaking, the plate was washed 5 times with PBS-T (soak 1 min each wash) and TMB substrate solution was added. The reaction was stopped after 20 min by adding the stop solution and absorbance was read at 450 nm (minus absorbance at 570 nm) within 15 min of stopping.

Example 12— CAR T Cytotoxicity Assay

(240) Human T cells were isolated from whole blood according to standard protocols. The T cells were then separately transduced twice with lenti virus bearing the CAR constructs, wherein the CAR constructs bear a GFP tag. Following 2-3 days of culture in RPMI 10% FBS and IL-2, the cells were stained with F(ab′)2 to label surface expression of MN-E6, MN-C2, MN-C3 and MN-C8. Cells were then sorted by flow cytometry for Fab-positive, GFP-positive cells. That means that the double positive population had a CAR inserted and that the CAR exposed the correct antibody fragment. The CAR T cells were then ready to be mixed with the MUC1* negative control cells or the target MUC1* positive cancer cells.

(241) The target cells were prepared as follows: Harvest target cells and resuspend cells in serum-free medium containing 15 uM of CMTMr dye (Cell Tracker Orange, 5-and-6-4-chloromethyl benzoyl amino tetramethylrhodamine, Thermo Fisher) at 1-1.5×10.sup.6 cells/mL. Incubate 30 min under growth conditions appropriate to particular cell type. Wash in culture media and transfer stained cells to a new tube and incubate the cells 60 min in media. Wash 2 more times in culture media to get rid of all excess dye. Set up the assay in 24 well plates with 0.5 ml media total volume. Resuspend the target cells (and control target cells) so that there are always 20,000 cells per well (20,000 cells/250 ul). Plate 250 ul in each well. Add 250 ul of the T cells so that the ratio of T cell: target cells=20:1, 10:1, 5:1 or 1:1. . Analyse cells after 24 h and 72h. For suspension target cells, take off the 0.5 ml media from the well and place in tube, wash the well with 0.5 ml media or PBS. For adherent target cells, take off the 0.5 ml media from the well and place in tube, wash the well with 0.5 ml PBS. Add the PBS to the same tube and add 120 ul trypsin to the well. Incubate for 4 min then add 0.5 ml media to neutralize trypsin and place that in the tube as well. Spin cells and resuspend pellet in 100 ul FACS buffer. Spin cells again. Resuspend cells in 100 ul buffer+5 ul anti-CD3 antibody, for 30 min on ice (to stain T cells). After 30 min, wash stained cells 2× with FACS buffer and resuspend in 250 ul buffer. Run the cells through the filter cap of the FACS tube. 10 min prior to analysis, add 10 ul 7AAD dye to each tube and analyze with Fortessa under the Cytotoxicity template.

Example 13-ELISA Expression Level of Humanized IgG

(242) Goat Anti-human Fc specific antibody was diluted to 5 ug/mL in 0.1M carbonate/bicarbonate buffer pH 9.6 and 50 uL was added to each well of a 96 well plate. After overnight incubation at 4° C., the plate was wash twice with PBS-T and a 3% BSA solution was added to block remaining binding site on the well. After 1h at RT the plate was washed twice with PBS-T and conditioned media (CM), diluted in PBS-T+1% BSA, was added at different concentrations. Also, purified human IgG (life technologies), diluted in PBS-T+1% BSA, was added at different concentrations to make a standard curve for determination of the expression level of the humanized IgG or Fc-fusion protein. After 1h at RT the plate was washed 3× with PBS-T and anti-human (H+L) HRP (life technologies) diluted in PBS-T+1% BSA, was added at 1/2500. After 1h at RT the plate was washed 3× with PBS-T and binding of human IgG and humanized IgG was measured at 415 nm using a ABTS solution (ThermoFisher) (FIG. 9 (MN-E6) and FIG. 11 (MN-C2)).

Example 14-ELISA Humanized IgG Binding to PSMGFR Peptide of the MUC1* Extracellular Domain

(243) A synthetic peptide of sequence PSMGFR was covalently coupled to BSA using Imject Maleimide activated BSA kit (Thermo Fisher). PSMGFR coupled BSA was diluted to 7.5 ug/mL in 0.1M carbonate/bicarbonate buffer pH 9.6 and 50 uL was added to each well of a 96 well plate. After overnight incubation at 4° C., the plate was wash twice with PBS-T and a 3% BSA solution was added to block remaining binding site on the well. After 1h at RT the plate was washed twice with PBS-T and conditioned media (CM), diluted in PBS-T+1% BSA, was added at different concentrations. At the same time corresponding mouse IgG was diluted in PBS-T+1% BSA and added at different concentrations as binding control. After 1h at RT the plate was washed 3x with PBS-T and anti-human (H+L) HRP (life technologies) diluted in PBS-T+1% BSA, was added at 1/5000 to detect binding of humanized IgG. Anti-Mouse HRP (life technologies) diluted in PBS-T+1% BSA, was added at 1/2500 to detect binding of mouse IgG. After 1h at RT the plate was washed 3× with PBS-T and binding was measured at 415 nm using a ABTS solution (ThermoFisher) (FIG. 8 (MN-E6) and FIG. 10 (MN-C2)).

Example 15-Stable Cell Lines Generation

(244) CHO-K1 cells (ATCC) were used to create stable cell lines expressing high level of humanized IgG. HEK293 cells (ATCC) were used to create stable cell lines expressing high level of Fc-fusion proteins. The night before transfection, cells were passed at 1/3 dilution (6well plate) and cultures in a 5% CO2 atmosphere. The next day, 1 hour before transfection, the media was change to complete media without antibiotics (F12K or DMEM containing 10% fetal calf serum). For transfection, we used Lipofectamine 3000 (life technologies) and Opti-MEM® I Reduced Serum Medium according to the manufacturer instructions. 1.25 ug of the heavy chain construct and 1.25 ug of the light chain construct or 2.5 ug of Fc-fusion constructs was used. After 24h, cells were trypsinized and plated into a T75 flask (in F12K or DMEM containing 10% fetal calf serum). After 24h, cells were trypsinized, diltuted to 100 cells/mL and 1000cells/mL in F 12K or DMEM containing 10% FCS and selection agent (Zeocin for pSECTag2 or G418 for pCDNA 3.1 V5), plated in 96 well plate (100 uL per well) and cultures in a 5% CO2 atmosphere. After 2-3 weeks, the culture media from single clones were collected, cleared by centrifugation and used in an ELISA assay to quantify the level of humanized IgG expression and binding to PSMGFR peptide. The clones with the highest expression and PSMGFR binding were expanded for large scale expression.

Example 16-scFV Expression

(245) pET21b E6 scFV plasmid (with HisTag or StrepTagII) was transformed into Shuffle T7 express competent cells (NEB). TB broth (Terrific broth) was inoculated with 1/100 of an overnight culture (LB broth−30° C.-200 rpm) and cultured at 30° C./200 rpm. When OD600 reached−1, temperature was reduced to 20° C. and growth was continued. After 2h, recombinant protein expression was induced with 0.2 mM Isopropyl-β-D-thio-galactoside (IPTG, Gold Biotechnology) and culture was stopped after 22h. After harvesting the cells by centrifugation (6000 rpm for 10 min at 4° C.), cell pellet was resupended with running buffer. For Histag protein buffer was: 50 mM Tris pH8.0, 300 mM NaCl and 5 mM imidazole. For StrepTagII protein buffer was 100 mM Tris pH 8.0 and 150 mM NaCl.

Example 17-HisTag EscFV Purification

(246) MgCl2 (0.5 mM), DNAse (0.5 ug/mL, Sigma), PMSF (1 mM, Gold Bitotechnology) and BugBuster (1X, Novagen) was added. Cell suspension was incubated on a rotating platform for 20 min at RT. Insoluble cell debris was removed by centrifugation (20000 rpm for 30 min at 4° c.). The cleared lysate was then applied to a Ni-NTA column (Qiagen) equilibrated with the running buffer. The column was washed before eluting the protein off the column with the running buffer supplemented with 495 mM imidazole. The protein was further purified by size exclusion chromatography (Superdex 200). The fractions containing the protein were pooled, aliquoted and stored at −80° C.

Example 18-Streptagii Escfv Purification

(247) MgCl2 (0.5 mM), DNAse (0.5 ug/mL, Sigma), PMSF (1 mM, Gold Bitotechnology) and BugBuster (1X, Novagen) was added. Cell suspension was incubated on a rotating platform for 20 min at RT. Insoluble cell debris was removed by centrifugation (20000 rpm for 30 min at 4° c.). The cleared lysate was then applied to a Strep-Tactin column (IBA) equilibrated with the running buffer. The column was washed before eluting the protein off the column with the running buffer supplemented with 5 mM d-Desthiobiotin. The protein was further purified by size exclusion chromatography (Superdex 200). The fractions containing the protein were pooled, aliquoted and stored at −80° C.

Example 19-Humanize IgG/Fc-Fusion Purification

(248) Condition media (from transient transfection or stable cell line) was collected, cleared by centrifugation and filtered (0.2 um). The media was then loaded on a protein A (Genscript) or CaptureSelect FcXL (Thermo Fisher) and the protein purified according to manufacturer instructions using acid condition for elution. The eluted protein was then dialyzed against PBS pH 7.4 and further purified by size exclusion chromatography (Superdex 200). The fractions containing the protein were pooled, aliquoted and stored at −80° C.

Example 20-Immunohistochemistry

(249) Human tissue specimens were purchased from Biomax. The tissues were either normal or cancerous as determined by a board certified pathologist. Tissues were anonymized but were labeled with a number, tissue type, stage of cancer and if available, a TNM tumor grading designation. TNM grading is as follows: T is primary tumor. Tx is primary tumor cannot be assessed. TO is no evidence of a tumor. This is carcinoma in situ, intraepithelial or invasion of lamina propia. T1 is tumor invades submucosa. T2 is tumor invades muscularis propia. T3 is tumor invades through muscularis propia into subserosa or into non-peritonealized pericolic or perirectal tissues. T4 is tumor directly invades other organs or structures and/or perforate visceral peritoneum. N is regional lymph nodes. N0 is no regional lymph node metastasis. N1 is metastasis in 1 to 3 regional lymph nodes. N2 is metastatic in 4 or more regional lymph nodes. M is for distant metastasis. M0 means no distant metastasis. M1 is distant metastasis.

(250) Tissues were stained with a primary anti-MUC1* antibody mouse monoclonal MN-C2, MN-E6, humanized MN-E6 scFv-Fc, or humanized MN-E6 scFv-Fc-biotin. If the primary were a mouse monoclonal antibody, then the secondary antibody used was a rabbit anti-mouse HRP-conjugated antibody. If the primary were a humanized antibody, then the secondary was a goat-anti-human HRP conjugated antibody antibody. If the primary were a biotinylated antibody, then the secondary was a streptavidin HRP conjugated antibody.

(251) Tissue specimens were de-paraffinized using xylene and ethanol according to standard protocols. An antigen retrieval procedure was used for some tissues which involved 10 mM Sodium Citrate-0.05% Tween pH 6 buffer (pre boil buffer, keep warm) boil 10′, cool down 20′ in rice cooker, then rinse cold tap water 5 minutes then two 5 min. washes in TBS. Tissues were blocked for 1 hr at RT in 10% NGS plus 5% BSA in TBS. If the primary antibody used was humanized MN-E6scFv, which was conjugated to biotin so that it could be visualized by a secondary antibody, the tissues were pre-blocked with an avidin solution then a biotin solution. Primary antibodies were incubated with tissues overnight at 4 degrees C. in 1% BSA-TBS with gentle orbital rotation. Tissues were rinsed with TBS-T for 5 minutes with gentle rocking. For HRP-conjugate detection only, mounted tissues were incubated in 3% H.sub.2O.sub.2 in TBS for 15 minutes at RT. For tissues incubated with biotinylated primary antibodies, they were then bathed in StreptAvidin for 10 min with Streptavidin-HRP label (Biocare Cat #: HP604 G, H, L), then washed 3 times for 5 minutes at RT in TBS-T with gentle rocking. They were then developed with chromogen (DAB—1 mL diluent; 1 drop DAB substrate) for 5 minutes at RT, then rinsed with running tap water for 5 minutes. They were then counterstained for 1 second hematoxylin then brief dip in 0.08% NH4OH ‘bluing reagent’ followed by 5 minutes in running water. Tissues were then dehydrated and mounted with Cytoseal XYL (1 drop/section) and coverslipped.

(252) All of the references cited herein are incorporated by reference in their entirety.

(253) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention specifically described herein.