SOUTHERN CATTLE TICK VACCINE PRODUCT
20230277638 · 2023-09-07
Inventors
- ADALBERTO A. PEREZ DE LEON (WAKE FOREST, NC, US)
- Robert Miller (McAllen, TX, US)
- Robert E. Briggs (Boone, IA)
- Fred M. Tatum (Nevada, IA)
- Felicito Guerrero (Kerrville, TX, US)
Cpc classification
C07K14/285
CHEMISTRY; METALLURGY
A61K2039/6037
HUMAN NECESSITIES
C07K2319/55
CHEMISTRY; METALLURGY
International classification
A61K39/00
HUMAN NECESSITIES
Abstract
This invention relates to novel fusion peptides and immunogenic compositions containing the fusion peptides useful in the control and prevention of tick infestations. The invention also relates to compositions comprising said fusion peptides, methods of vaccination against tick infestation using said fusion peptides and compositions, and kits for use with such compositions and methods.
Claims
1. A polypeptide comprising at least one copy of a tick Rhipicephalus microplus aquaporin 1 protein (AQP1) fragment having an amino acid sequence as set forth in SEQ ID NO: 16 and at least one copy of a tetanus toxin P2 epitope having an amino acid sequence as set forth in SEQ ID NO: 14.
2. The polypeptide of claim 1, wherein the polypeptide has two copies of the AQP1 protein fragment.
3. The polypeptide of claim 1, wherein the polypeptide has two copies of the P2 epitope.
4. A composition comprising the polypeptide of claim 1.
5. The composition of claim 5, wherein the composition is a host cell, a vaccine, or an immunogenic composition.
6. The composition of claim 5, wherein the composition is an attenuated M. haemolytica strain A1 bacterium, or an attenuated M. haemolytica strain A6 bacterium.
7. A vaccine or immunogenic composition comprising the polypeptide of claim 1, and optionally an adjuvant.
8. A method of provoking an immune response in an animal, the method comprising administering to the animal at least one effective dose of a composition of claim 6.
9. The method of claim 8, wherein the animal is a mammal.
10. A kit comprising the polypeptide of claim 1.
11. A kit comprising the composition of claim 4.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0024]
[0025]
[0026]
[0027]
BRIEF DESCRIPTION OF THE SEQUENCE LISTING
[0028] The nucleotide and amino acid sequences disclosed in the specification are listed in Table 1, below.
TABLE-US-00001 Sequence Identifier Type Description SEQ ID NO: 1 nucleotide M. haemolytica lktCA gene cluster SEQ ID NO: 2 nucleotide down replacement arm SEQ ID NO: 3 nucleotide down arm forward primer TM56 SEQ ID NO: 4 nucleotide down arm reverse primer TM57 SEQ ID NO: 5 nucleotide up replacement arm SEQ ID NO: 6 nucleotide leukotoxin promotor SEQ ID NO: 7 nucleotide lktC-lktA intergenic region SEQ ID NO: 8 nucleotide leukotoxin neutralizing epitope codon- optimized sequence SEQ ID NO: 9 amino acid added leukotoxin neutralizing epitope SEQ ID NO: 10 nucleotide leukotoxin A nucleotides 2192 to 3022 SEQ ID NO: 11 amino acid translation of leukotoxin A after nucleotide 2192 SEQ ID NO: 12 nucleotide ΔlktCAV4 cassette SEQ ID NO: 13 amino acid ΔlktCAV4 cassette SEQ ID NO: 14 amino acid Tetanus Toxin P2 epitope (P2 Epitope) SEQ ID NO: 15 nucleotide Codon-optimized sequence encoding P2 Epitope SEQ ID NO: 16 amino acid RmAQP1 fragment SEQ ID NO: 17 nucleotide Codon-optimized sequence encoding RmAQP1 fragment SEQ ID NO: 18 nucleotide P2P2AQP1fAQP1fΔlktCAV4 cassette SEQ ID NO: 19 amino acid P2P2AQP1fAQP1fΔlktCAV4 cassette SEQ ID NO: 20 amino acid labeled AQP1 peptide SEQ ID NO: 21 amino acid labeled Lkt peptide
DETAILED DESCRIPTION
[0029] The inventors have inserted a polynucleotide encoding a chimeric peptide comprising a tandem repeat of a P2 epitope and of a portion of an RmAQP1 protein in a modified M. haemolytica lktCA gene cluster cassette comprising a polynucleotide encoding an added leukotoxin neutralizing epitope inserted downstream of the native leukotoxin A ribosome binding site and start codon. They have named the resulting polynucleotide P2P2AQP1fAQP1f-ΔlktCAV4 cassette. The inventors have prepared a vaccine using the chimeric polypeptide expressed by this cassette, and successfully used it to reduce tick infestation in cattle.
[0030] M. haemolytica is a gram-negative bacterium which is part of the normal nasal-pharyngeal flora of cattle, sheep, and goats. Under stress and/or concurrent respiratory infection, M. haemolytica can gain access to the lungs and cause fibrinous pneumonia. When compared to the wild-type parent, M. haemolytica possessing inactive leukotoxin are attenuated and elicit greatly reduced lung damage following experimental pulmonary challenge. Yet such modified strains retain the capacity to colonize the upper respiratory tract of cattle (Tatum F M et al., 1998, “Construction of an isogenic leukotoxin deletion modified of Pasteurella haemolytica serotype 1: characterization and virulence,” Microb. Pathog. 24: 37-46). Moreover, cattle vaccinated mucosally with such defined M. haemolytica modified strains expressing and secreting inactive, yet immunogenic, leukotoxin (leuko-toxoid) are capable of generating neutralizing antibodies to leukotoxin that afford them resistant to virulent challenge (Briggs R E et al., 2012, “Mucosal and parenteral vaccination against pneumonic pasteurellosis in cattle with a modified-live in frame lktA deletion modified of Mannheimia haemolytica,” Microb. Pathog. 52: 302-309).
[0031] The leukotoxin (lkt) operon of M. haemolytica codes for four proteins: an internal acyltransferase encoded by lktC; the structural toxin encoded by lktA; an inner membrane protein encoded by lktB; and a membrane fusion protein encoded by lktD. The genes for these four proteins are physically adjacent on the chromosome and are transcribed as lktCA or lktCABD messages.
[0032] U.S. Pat. No. 6,331,303, issued Dec. 18, 2001, discloses P. haemolytica bacterium which expresses no biologically active leukotoxin, expresses a leukotoxin molecule lacking amino acids 34 to 378, and contains no foreign DNA. In 1999, P. haemolytica was renamed as Mannheimia haemolytica.
[0033] US Patent Publication No. 2014/0170190 discloses a modified M. haemolytica strain A1 lktCA gene cluster with a deletion of a polynucleotide fragment consisting of the nucleotides encoding amino acid 4 of leukotoxin C to amino acid 707 of leukotoxin A, and replacement of the native leukotoxin C ribosome binding site (rbs) with an E. coli consensus rbs to generate D153ΔlktCA4-707rbs. The mutated lktCA gene cluster was introduced into wild-type M. haemolytica strains A1 and A6, resulting in attenuated bacteria. The attenuated M. haemolytica A1 and A6 strains were lyophilized, resuspended, and administered intranasally to calves aged 5 to 6 weeks. When administered intranasally, the mixture of attenuated M. haemolytica A1 and A6 strains containing D153ΔlktCA4-707rbs afforded protection to M. haemolytica challenge. When challenged with M. haemolytica A1 strain, nasal administration of M. haemolytica A1 and A6 strains containing D153ΔlktCA4-707rbs afforded an average reduction in lung lesion of 62.0% and 76.7% when compared to sham-inoculated cattle. When challenged with M. haemolytica A6 strain, nasal administration of M. haemolytica A1 and A6 strains containing D153ΔlktCA4-707rbs afforded an average reduction in lung lesion of 85.04% and 14.7% when compared to sham-inoculated cattle. U.S. Pat. No. 9,370,561, issued Jun. 21, 2016 from US Patent Publication No. 2014/0170190, and claims a vaccine comprising live, attenuated M. haemolytica A1 and A6 strains containing nucleic acid deletions in their respective leukotoxin A genes, that provide protective immune response against disease caused by M. haemolytica strains A1 and A6.
[0034] US Patent Application Publication 2019/0381161 discloses an oral vaccine against ruminant respiratory disease, comprising live attenuated M. haemolytica bacteria and a Polyvinylpyrrolidone (PVP). PVP enhances vaccination by oral route via drink.
[0035] At least 13 AQP members have been identified so far and classed into two subsets: those permeated by water and those permeated by water plus other small molecules, such as glycerol and urea. AQP structures are conserved among species, having six transmembrane domains that are connected by two intracellular loops and three extracellular loops. Two asparagine-proline-alanine (NPA) motifs are considered AQP signature motifs and are located at the protein portions that interact to form a pore.
[0036] In silico analyses of the tick AQP1 has identified peptide motifs that are said to be unique to tick AQP1 (Nedekezi C. et al., 2019, “Identification of Ixodid Tick-Specific Aquaporin-1 Potential Anti-tick Vaccine Epitopes: An in-silico Analysis,” Front. Bioeng. Biotechnol. 7: 236).
[0037] Based on multiple sequence alignment, motif analyses, homology modeling, and structural analyses, tick-specific AQP1 peptide motifs were said to be identified. Prediction modeling was used to predict the potential of these motifs to induce B cell-mediated immune responses. Two motifs on the tick AQP1 having GenBank ID QD067142.1 were identified, a motif named M7 comprised residues 106 to 125; and a motif named M8 comprised residues 85 to 104.
[0038] Use of bacterial vectors as vehicles to deliver recombinant antigens emerged in the late 1990s. Bacteria-based antigen delivery vectors exhibit multiple advantages, such as the possibility to control its intrinsic infectious power, its non-integrative properties, ability to regulate the amount and in vivo localization of the antigen, a potential for multiple vaccine delivery routes, potent stimulation of the innate and adaptive immune systems, and relatively low manufacturing costs. Bacterial vectors most frequently used as vaccine vectors are Listeria and Salmonella. Other attenuated bacteria used to express heterologous antigens, are Pseudomonas aeruginosa, Mycobacterium bovis (Bacillus Calmette-Guerin), Vibrio anguillarum, and Vibrio V. cholera (see review by Ding, C. al., “Live Bacterial Vaccine Vector and Delivery Strategies of Heterologous Antigen: A Review,” 2018, Immunology Letters 197: 70-77).
[0039] Selected T cell epitopes from tetanus toxoid (TT) have been extensively studied. They have been shown to be widely recognized in association with a large number of major histocompatibility complex (MHC) class II molecules and to be universally immunogenic in humans and mice (Kaumaya P T, et al, 1993, “Peptide vaccines incorporating a ‘promiscuous’ T-cell epitope bypass certain haplotype restricted immune responses and provide broad spectrum immunogenicity,” J. Mol. Recognit. 6(2):81-94). The tetanus toxin epitope P2 (830-843) has been used as antigen to bind major histocompatibility receptors on T cells, and to enhance the overall immune response. The amino acid sequence of the tetanus toxin epitope P2 is QYIKANSKFIGITEL (set forth in SEQ ID NO: 14). This epitope has been demonstrated to facilitate B and T cell activation as well as proliferation in a number of mammalian species, but its effect in ruminants has not yet been evaluated.
[0040] The instant disclosure relates to a polynucleotide encoding at least one tick aquaporin fragment and at least one toxin epitope P2. Prior to the instant application, the effect of a P2 epitope on B and T cell activation in a ruminant was not known. The possible immunogenic response by ruminants to a chimera comprising a tick aquaporin 1 (AQP1) fragment and a tetanus toxin epitope 2 was also not known prior to the instant application. In an embodiment, the invention relates to a polynucleotide encoding an AQP1 fragment/P2 epitope chimera. In some embodiments of the invention, the polynucleotide encodes one copy of the AQP1 fragment. In some embodiments of the invention, the polynucleotide encodes two copies of the AQP1 fragment. In some embodiments of the invention, the polynucleotide encoding the RmAQP1 fragment has the nucleotide sequence set forth in SEQ ID NO: 17. In some embodiments of the invention, the polynucleotide encoding the P2 epitope has the nucleotide sequence set forth in SEQ ID NO: 15.
[0041] The instant disclosure relates to a modified M. haemolytica lktCA gene cluster cassette comprising a polynucleotide encoding an added leukotoxin neutralizing epitope and at least one copy of a tick AQP1 fragment inserted downstream of the leukotoxin A ribosome binding site and start codon. Prior to the present disclosure, expression of tick aquaporin fragments using a modified M. haemolytica lktCA gene cluster was not known. Prior to the instant application, it was not known if a modified M. haemolytica lktCA gene cluster cassette comprising at least one copy of a tick AQP1 fragment would be useful for the preparation of compositions, vaccines, or immunogenic compositions for administration to animals.
[0042] Prior to the instant disclosure, it was not known whether administration of a vaccine comprising a modified M. haemolytica lktCA gene cluster cassette comprising a polynucleotide encoding an added neutralizing epitope and at least one copy of a tick AQP1 fragment inserted downstream of the lktA ribosome binding site and start codon would elicit an immune response in an animal.
[0043] Disclosed herein are modified lktCA gene cluster cassettes derived from D153 ltkCA gene cluster. The wild type lktCA gene cluster has the nucleotide sequence set forth in SEQ ID NO: 1. In an embodiment, the invention relates to a modified M. haemolytica lktCA gene cluster cassette comprising an insertion of a polynucleotide encoding an additional M. haemolytica leukotoxin neutralizing epitope and at least one copy of a tick AQP1 fragment, where the polynucleotide is inserted downstream of the native leukotoxin A start codon. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette comprises two copies of the tick AQP1 fragment. In some embodiments of the invention, the tick AQP1 fragment in the modified M. haemolytica lktCA gene cluster cassette is an R. microplus AQP1 (RmAQP1) fragment.
[0044] In an embodiment, the invention relates to a modified M. haemolytica lktCA gene cluster cassette comprising in a 5′ to 3′ orientation a leukotoxin promotor polynucleotide; a leukotoxin A ribosome binding site and start codon polynucleotide; a polynucleotide encoding an added leukotoxin neutralizing epitope; a polynucleotide encoding at least one copy of a tick AQP1 fragment; and a polynucleotide encoding at least native leukotoxin A amino acids 732 to 953. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette comprises a polynucleotide encoding one copy of the tetanus toxin P2 epitope. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette comprises a polynucleotide encoding two copies of the P2 epitope. In some embodiments of the invention, the polynucleotide encoding the RmAQP1 fragment has the nucleotide sequence set forth in SEQ ID NO: 17. In some embodiments of the invention, the polynucleotide encoding the P2 epitope has the nucleotide sequence set forth in SEQ ID NO: 15.
[0045] In some embodiments, the modified M. haemolytica lktCA gene cluster cassette comprises a leukotoxin promotor having the nucleotide sequence set forth in SEQ ID NO: 6; a leukotoxin A ribosome binding site and start codon having the nucleotide sequence set forth in SEQ ID NO: 7; an added leukotoxin neutralizing epitope having the amino acid sequence set forth in SEQ ID NO: 9; native leukotoxin A fragment having the amino acid sequence set forth in SEQ ID NO: 10; an RmAQP1 fragment having the amino acid sequence set forth in SEQ ID NO: 16; and a P2 epitope having the amino acid sequence set forth in SEQ ID NO: 14. In some embodiments of the invention, the polynucleotide encoding the added leukotoxin neutralizing epitope in the modified M. haemolytica lktCA gene cluster cassette has the nucleotide sequence set forth in SEQ ID NO: 8. In some embodiments of the invention, the polynucleotide encoding the RmAQP1 fragment in the modified M. haemolytica lktCA gene cluster cassette has the nucleotide sequence set forth in SEQ ID NO: 17. In some embodiments of the invention, the polynucleotide encoding the P2 epitope in the modified M. haemolytica lktCA gene cluster cassette has the nucleotide sequence set forth in SEQ ID NO: 15. In some embodiments, the modified M. haemolytica lktCA gene cluster cassette of the invention has the nucleotide sequence set forth in SEQ ID NO: 18. In some embodiments, the modified M. haemolytica lktCA gene cluster cassette of the invention encodes the amino acid sequence set forth in SEQ ID NO: 19.
[0046] The modified M. haemolytica lktCA gene cluster cassette of the invention, comprising a polynucleotide encoding two copies of the P2 epitope, and 2 copies of a tick AQP1 fragment protected calves against tick infestation challenge with at least 67% efficiency.
[0047] In some embodiments of the invention, the leukotoxin promotor, the lktA ribosome binding site and start codon, the polynucleotide encoding an added leukotoxin neutralizing epitope, and the polynucleotide encoding at least native leukotoxin A amino acids 732 to 953 are from M. haemolytica strain A1 or M. haemolytica strain A6.
[0048] In an embodiment, the invention relates to a composition comprising a modified M. haemolytica lktCA gene cluster cassette comprising a polynucleotide encoding an added leukotoxin neutralizing epitope and at least one copy of a tick AQP1 fragment. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette further comprises a polynucleotide encoding one copy of a tetanus toxin P2 epitope. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette comprises polynucleotides encoding two copies of the P2 epitope and two copies of the tick AQP1 fragment. In some embodiments of the invention, the tick AQP1 fragment in the modified M. haemolytica lktCA gene cluster cassette in an R. microplus AQP1 fragment. In some embodiments of the invention, the composition comprising a modified M. haemolytica lktCA gene cluster cassette of the invention is a polynucleotide, a plasmid, an expression vector, a host cell, a vaccine, or an immunogenic composition. In some embodiments of the invention, the composition comprising a modified M. haemolytica lktCA gene cluster cassette of the invention is a replacement plasmid, an attenuated M. haemolytica strain A1 bacteria, or an attenuated M. haemolytica strain A6 bacteria. In some embodiments of the invention, the composition comprising a modified M. haemolytica lktCA gene cluster cassette comprising a polynucleotide encoding an added leukotoxin neutralizing epitope and a tick AQP1 fragment is a vaccine or immunogenic composition, and optionally comprises an adjuvant.
[0049] In an embodiment, the invention relates to a modified M. haemolytica lktCA gene cluster cassette comprising a polynucleotide encoding an added leukotoxin neutralizing epitope, two copies of a RmAQP1 fragment, and two copies of a P2 epitope. In some embodiments, the modified M. haemolytica lktCA gene cluster cassette of the invention is referred to as a P2P2AQP1fAQP1fΔlktCAV4 cassette. In some embodiments, the invention relates to at least one plasmid comprising the P2P2AQP1fAQP1fΔlktCAV4 cassette. In some embodiments of the invention, the at least one plasmid is a replacement plasmid. In some embodiments, the invention relates to at least one bacteria comprising the P2P2AQP1fAQP1fΔlktCAV4 cassette.
[0050] In the modified M. haemolytica lktCA gene cluster cassette, deletion of lktC gene nucleotides −12 to 504 deletes the lktC ribosome binding site and the entire lktC coding region. Deletion of lktA gene nucleotides 4 through 2191 retains the lktC-lktA intergenic region including the lktA ribosome binding site and start codon, as well as lktA gene nucleotides 2192 to 3022, which include the polynucleotides encoding the leukotoxin glycine rich region and the leukotoxin neutralizing epitope. In some embodiments of the invention the modified lktCA gene cluster cassette contains added nucleotides corresponding to restriction endonuclease recognition sites. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette of the invention contains added nucleotides corresponding to at least one EcoRI restriction endonuclease recognition site. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette contains nucleotides corresponding to at least one MfeI restriction endonuclease recognition site. In some embodiments of the invention, the modified M. haemolytica lktCA gene cluster cassette contains nucleotides corresponding to at least one BamHI restriction endonuclease recognition site. At least one EcoRI, BamHI, or MfeI restriction endonuclease recognition site may be used to facilitate preparation of the modified M. haemolytica lktCA gene cluster cassette, its insertion into plasmids or vectors, or insertion of polynucleotides encoding heterologous antigens into the modified M. haemolytica lktCA gene cluster cassette.
[0051] Vaccines that provide consistent and efficacious protection against R. microplus, and that may be produced in useful quantities are desperately needed.
[0052] In the instant application, a polynucleotide encoding P2 epitope antigens and AQP1 antigens was inserted in a modified M. haemolytica lktCA gene cluster cassette. A polynucleotide encoding a chimeric antigen comprising two copies of the P2 epitope and two copies of an AQP1 fragment was introduced into the ΔlktCAV4 modified M. haemolytica lktCA gene cluster cassette to generate P2P2AQP1AQP1ΔlktCAV4 cassette. This cassette was introduced into a bacterial plasmid, transformed for expression in a laboratory strain of E. coli, where the resulting protein was isolated and used as vaccine product.
[0053] In an embodiment, the invention provides vaccines and immunogenic compositions that, when administered to a subject, elicit an immune response to M. haemolytica and/or R. microplus in the subject, e.g., a protective immune response. Methods of using the immunogenic compositions/vaccines to prevent or attenuate the spread of R. microplus and/or M. haemolytica infection in susceptible individuals and/or groups of susceptible individuals are also provided.
[0054] The vaccines or immunogenic compositions provided herein can be in the form of modified M. haemolytica lktCA gene cluster cassettes comprising P2 epitope and AQP1 antigens, as plasmids, or as vectors or bacteria expressing such cassettes. In some embodiments of the invention, the cassettes involved in evoking an immune response to R. microplus encode at least a fragment of Rm AQP1. In some embodiments of the invention, the cassettes involved in evoking an immune response to R. microplus encode at least a fragment of tetanus toxin P2 epitope. The immunogenic compositions/vaccines provided herein can be used to immunize or treat any mammal, including, but not limited to, cattle, sheep, goats, pigs, bison, elk, camels, dogs, and deer.
[0055] In an embodiment, the invention is directed at a vaccine to control R. microplus tick infestation, particularly in bison, beef, and dairy cattle. The vaccine may be used for injectable, intra-nasal, or oral delivery to the recipient animal, and may be combined with other vaccine components such as Pasteurella multocida, Histophilus somni, and/or viral components such as Bovine herpes virus 1 (BHV-1), parainfluenza virus type 3 (PI3V), and bovine respiratory syncytial virus (BRSV). Depending upon the selected delivery method, protection against M. haemolytica may be an intrinsic property of an R. microplus vaccine taught here.
[0056] In an embodiment, the invention relates to immunogenic compositions/vaccines that can be used to induce an immune response against R. microplus. In an embodiment, the invention relates to methods of administering a vaccine as described herein. The methods involve administering an effective amount of a vaccine sufficient to prevent or lessen the extent of R. microplus infestation in a subject, when the subject is later exposed to R. microplus.
[0057] In an embodiment, the invention relates to a vaccine to control R. microplus infestation, where the vaccine consists essentially of a modified M. haemolytica lktCA gene cluster cassette encoding M. haemolytica leuko-toxoid and a chimera encoding at least one copy of a P2 epitope and at least one copy of a tick AQP1 fragment. In some embodiments of the invention, the vaccine to control R. microplus comprises a modified M. haemolytica lktCA gene cluster cassette of the invention with an inserted recombinant polynucleotide encoding two copies of the P2 epitope and two copies of the tick AQP1 fragment. In some embodiments of the invention, the polynucleotide encoding the P2 epitope has the nucleotide sequence set forth in SEQ ID NO: 15. In some embodiments of the invention, the polynucleotide encoding the tick AQP1 fragment has the nucleotide sequence set forth in SEQ ID NO: 17. In some embodiments of the invention, the vaccine to control R. microplus infestation encodes a polypeptide having the amino acid sequence set forth in SEQ ID NO: 19. In some embodiments of the invention, the vaccine to control R. microplus infestation comprises bacteria with a modified M. haemolytica lktCA gene cluster cassette of the invention, comprising the recombinant polynucleotide of SEQ ID NO: 18.
[0058] In an embodiment, the invention provides methods for preparing a vaccine to control R. microplus. In some embodiments of the invention, such methods include using a modified M. haemolytica lktCA gene cluster cassette comprising a recombinant polynucleotide encoding a tick AQP1 fragment. In some embodiments of the invention, such methods include transforming bacteria with a polynucleotide comprising a modified M. haemolytica lktCA gene cluster cassette encoding a tick AQP1. Transformation can be achieved by any method known in the art, including, for example, electroporation or chemical transformation. A vaccine can be produced using an isolated nucleic acid to transform a bacterial culture. For example, a transformed bacterial culture can overexpress antigens to produce an immune response. In some embodiments, the vaccine to control R. microplus is prepared by inserting a recombinant polynucleotide encoding AQP1 into a modified M. haemolytica lktCA gene cluster cassette of the invention.
[0059] In some embodiments, a vaccine provided herein can include a marker of delivery and expression. For example, a polynucleotide encoding a P2 epitope/tick AQP1 fragment chimera may include a polynucleotide that encodes a fluorescent polypeptide (e.g., a green fluorescent protein, GFP). The fluorescent polypeptide will serve as a marker of expression and delivery of the vaccine to an animal. For example, a marker of delivery and expression can be detected e.g. as antibodies to the marker. For example, GFP antibodies may be detected in sera from immunized animals.
[0060] It is contemplated that virtually any nucleic acid sequence coding for an amino acid sequence that is or includes a P2 epitope/RmAQP1 fragment chimera may be used as described herein. This includes a polynucleotide encoding the amino acid sequence of any portion of the Rm AQP1 polypeptide. The amino acid sequences as described herein may also be shortened on either the amino or carboxy terminus (or both) by one, two, or more amino acids to produce fragments within the context of the invention wherein the fragments produce the same or a similar protective effect. Alternatively, the recombinant P2 epitope/RmAQP1 fragment polypeptide may be a chimera or fusion protein which comprises flanking amino acid sequences which are not adjacent to the native sequence in nature. For example, the adjacent sequences may be corresponding amino acids which are from different but related species; or amino acids which are from different species (e.g. from other bacteria or eukaryotes of interest, e.g. from infectious agents); or from a synthetic sequence, e.g. various tags such as histidine or glutathione S-transferase (GST) tags, linkers, spacers, targeting sequences, etc.).
[0061] Any effective route of administration may be utilized to deliver the vaccines of the invention, such as, for example, orally, nasally, enterally, parenterally, intramuscularly or intravenously, subcutaneously, intradermally, rectally, vaginally, topically, ocularly, pulmonarily, or by contact application. From a practical standpoint, oral, (intra)nasal, parenteral (IM, SubQ, and perhaps intradermal), and ocular may be preferred. In some embodiments, vaccine compositions of the invention may be injected (e.g., via intramuscular, intraperitoneal, intradermal and/or subcutaneous routes); or delivered via the mucosa (e.g., to the oral/alimentary, respiratory, and/or genitourinary tracts). Intranasal administration of vaccines may be particularly useful in some contexts, for example for treatment of pneumonia or otitis media (as nasopharyngeal carriage of pneumococci can be more effectively prevented, thus attenuating infection at its earliest stage). In some embodiments of the invention, it may be desirable to administer different doses of a vaccine by different routes. The vaccines provided herein can be administered using any appropriate method. Administration can be, for example, topical (e.g. transdermal, ophthalmic or intranasal); pulmonary (e.g., by inhalation or insufflation or powders or aerosols); oral, or parenteral (e.g. by subcutaneous, intrathecal, intraventricular, intramuscular, or intraperitoneal injection, or by intravenous drip). Administration can be rapid (e.g., by injection) or can occur over a period of time (e.g., by slow infusion or administration of slow release formulations). In some embodiments, the mode of administration is intraperitoneal. For application in livestock, the preferred mode of administration is oral.
[0062] Vaccine compositions are administered in such amounts and for such time as is necessary to achieve a desired result. As used herein, an “immunogenic” amount of the vaccine composition is an amount which is suitable to elicit an immune response. Thus, the amount effective to treat, attenuate, or prevent disease, as used herein, refers to a nontoxic but sufficient amount of the vaccine composition to treat, attenuate, or prevent disease in any subject. For example, the “therapeutically effective amount” can be an amount to treat, attenuate, or prevent infestation (e.g., tick infestation, R. microplus infestation), etc. The exact amount required to achieve an “immunogenic amount” may vary, depending on the particular component (e.g., polysaccharide, conjugate), and from subject to subject, depending on the species, age, and general condition of the subject, the stage of the disease, the particular pharmaceutical mixture, its mode of administration, and the like.
[0063] The amount of Rm AQP1 antigen or modified M. haemolytica lktCA gene cluster cassette carrying the RM AQP1 antigen in each vaccine dose is selected to allow the vaccine, when administered as described herein, to induce an appropriate immunoprotective response without significant, adverse side effects. An “immuno-protective” or “protective immune” response as used herein is an immune response sufficient to protect an immunized subject from productive infection by a particular pathogen or pathogens to which a vaccine is directed (e.g., R. microplus infestation). Optimal amounts of components for a particular vaccine can be ascertained by standard studies involving observation of appropriate immune responses in subjects. Following an initial vaccination, subjects can receive one or several booster immunizations adequately spaced in time. Such amounts may vary depending upon which antigen or antigens are expressed by the modified M. haemolytica lktCA gene cluster cassette and/or preparations thereof, and may be formulated in a unit dosage form for ease of administration and uniformity of dosage. The expression “unit dosage form,” as used herein, refers to a physically discrete unit of vaccine composition appropriate for the patient to be treated. The specific therapeutically effective dose for any particular patient or organism may depend upon a variety of factors including the severity or degree of risk of infection; the activity of the specific vaccine or vaccine composition employed; other characteristics of the specific vaccine or vaccine composition employed; the age, body weight, general health, sex of the subject, the diet of the subject, the pharmacokinetic condition of the subject, the time of administration (e.g., with regard to other activities of the subject such as eating, sleeping, receiving other medicines including other vaccine doses, etc.), the route of administration, the rate of excretion of the specific vaccine or vaccine composition employed; vaccines used in combination or coincidental with the vaccine composition employed; and like factors well known in the veterinary arts.
[0064] R. microplus vaccines for use in accordance with the present invention may be formulated according to known techniques. An immunogenic amount of a vaccine product can be formulated together with one or more pharmaceutically acceptable carrier materials (organic, inorganic, liquid, or solid). In general, pharmaceutically acceptable carriers include solvents, dispersion media, and the like, which are compatible with pharmaceutical administration. For example, materials that can serve as pharmaceutically acceptable carriers include, but are not limited to sugars such as lactose, glucose, dextrose, and sucrose; starches such as corn starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil, and soybean oil; polyols such as glycerol, propylene glycol, and liquid polyethylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol, and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as sodium lauryl sulfate and magnesium stearate, as well as preservatives, and antioxidants can also be present in the composition, according to the judgment of the formulator (see also Remington's Pharmaceutical Sciences, Fifteenth Edition, E. W. martin (Mack Publishing Co., Easton Pa., 1975).
[0065] Vaccines of the present invention can further comprise one or more additional immunomodulatory components such as, e.g., an adjuvant or cytokine, among others. Non-limiting examples of adjuvants that can be used in the vaccine of the present invention include the RIBI adjuvant system (Ribi Inc., Hamilton, Mont., USA), alum, mineral gels such as aluminum hydroxide gel, oil-in-water emulsions, water-in-oil emulsions such as, e.g., Freund's complete and incomplete adjuvants, Block copolymer (CytRx, Atlanta, Ga., USA), QS-21 (Cambridge Biotech Inc., Cambridge Mass., USA), SAF-M (Chiron, Emeryville Calif., USA), AMPHIGEN, proprietary oil in water adjuvant (Zoetis, Parsippany, N.J., USA), saponin, Quil A (Brenntag Biosector A/S, Ballerup, Denmark), or other saponin fraction, monophosphoryl lipid A, and Avridine lipid-amine adjuvant. Other immunomodulatory agents that can be included in the vaccine of the invention, comprise, e.g., one or more interleukins, interferons, or other known cytokines.
[0066] In some embodiments, at least one booster vaccine is administered after the initial administration of the vaccine of the invention. The booster vaccine may be identical to the vaccine that is initially used to vaccinate the subject. The booster vaccine may be administered as early as four weeks after initial vaccination. In some embodiments, the booster vaccine may be administered at least one year after initial vaccination.
[0067] The immunogenic response from the initial or booster vaccine may protect a naive subject from subsequent full-blown R. microplus infestation when exposed to R. microplus. Alternatively, administration of the initial or booster vaccine is used to provide treatment for an existing R. microplus infestation. The protective response either wholly or partially prevents or arrests the development of symptoms related to R. microplus infestation, in comparison to a non-vaccinated control organism, in which R. microplus infestation is not prevented.
[0068] Vaccines of the present invention can be formulated following accepted convention to include acceptable carriers for animals, including humans (if applicable), such as standard buffers, stabilizers, diluents, preservatives, and/or solubilizers, and can also be formulated to facilitate sustained release. Diluents include water, saline, dextrose, ethanol, glycerol, and the like. Additives for isotonicity include sodium chloride, dextrose, mannitol, sorbitol, and lactose, among others. Stabilizers include albumin, among others. Other suitable vaccine vehicles and additives, including those that are particularly useful in formulating modified live vaccines, are known or will be apparent to those skilled in the art. See, e.g., Remington's Pharmaceutical Science, 18th ed., 1990, Mack Publishing, which is incorporated herein by reference.
[0069] An effective amount of any of the vaccines described herein can be determined by conventional means, starting with a low dose of a polypeptide including the P2 epitope/RmAQP1 fragment chimera, an M. haemolytica replacement plasmid comprising such chimera, or M. haemolytica bacteria expressing such chimera, and then increasing the dosage while monitoring the effects. An effective amount may be obtained after a single administration of a vaccine or after multiple administrations of a vaccine. Known factors can be taken into consideration when determining an optimal dose per animal. These include the presence of other drugs in the animal, the species, size, age, and general condition of the animal, and the like.
[0070] One method of detecting whether an adequate immune response has been achieved is to determine seroconversion and antibody titer in the animal after vaccination. The timing of vaccination and the number of boosters, if any, will preferably be determined by a veterinarian based on analysis of all relevant factors, some of which are described above.
[0071] Suitable doses for vaccines according to the practice of the present invention range generally from about 1×10.sup.7 to about 1.6×10.sup.10 CFU per dose, as may be determined by standard methods. In dairy operations there is an interest in vaccinating cattle as early as 1 day of age. At this very young age, a mucosal delivery route may be preferred. It is also of interest to target the beef segment where 6-8 month old calves are typical recipients of the vaccine.
[0072] The effective dose amount of virus, infectious RNA molecule, plasmid, or viral vector, of the present invention can be determined using known techniques, taking into account factors that can be determined by one of ordinary skill in the art such as the weight of the animal to be vaccinated. By way of example, vaccines may be delivered orally, parenterally, intradermally, subcutaneously, intramuscularly, intranasally or intravenously. Oral delivery may encompass, for example, adding the compositions to the feed or drink of the animals.
[0073] The present invention further provides methods for preparing a vaccine or immunogenic composition comprising a polynucleotide encoding a P2 epitope/RMAQP1 fragment chimeric polypeptide, or a chimeric P2 epitope/RMAQP1 fragment polypeptide, or a P2P2AQP1fAQP1fΔlktCAV4 cassette comprising a polynucleotide encoding a chimeric P2 epitope/RMAQP1 fragment polypeptide, or a replacement plasmid comprising such a cassette, or bacterial strains comprising such a cassette, or vaccines or immunogenic compositions comprising such a cassette.
[0074] The method for preparing such a vaccine may comprise combining an effective amount of a chimeric P2 epitope/RMAQP1 fragment polypeptide, an M. haemolytica replacement plasmid comprising a chimeric P2 epitope/RMAQP1 fragment insert, or bacterial strains described herein, with a carrier acceptable for pharmaceutical or veterinary use.
[0075] Additional features and variations of the invention will be apparent to those skilled in the art from the entirety of this application, including the detailed description, and all such features are intended as aspects of the invention. Likewise, features of the invention described herein can be re-combined into additional embodiments that also are intended as aspects of the invention, irrespective of whether the combination of features is specifically mentioned above as an aspect or embodiment of the invention. Also, only such limitations which are described herein as critical to the invention should be viewed as such; variations of the invention lacking limitations which have not been described herein as critical are intended as aspects of the invention. It will be clear that the invention may be practiced otherwise than as particularly described in the foregoing description and examples. Numerous modifications and variations of the present invention are possible in light of the above teachings and, therefore, are within the scope of the invention.
[0076] The invention is directed at a vaccine to control R. microplus infestation, particularly in beef, dairy cattle, and deer. The vaccine is intended for injectable, intra-nasal, or oral delivery to the recipient animal and may be combined with other vaccine components such as Pasteurella multocida, Mycoplasma bovis, Histophilus somni, and/or viral components such as BHV-1, PI-3V, and BRSV. Depending upon the selected delivery method, protection against M. haemolytica may be an intrinsic property of a vaccine taught here.
[0077] The vaccine may be delivered as a polypeptide product as tested here, as a modified-live vectored product via an attenuated M. haemolytica vaccine strain, as a killed vaccine strain, as a subunit vaccine product, or as a DNA vaccine. The M. haemolytica replacement vector utilized here consists of a gene-knockout modified which targeted the leukotoxin operon. M. haemolytica which does not express an active leukotoxin is dramatically attenuated in lung tissue, but remains capable of colonizing the nasopharynx where it can elicit an immune response. Because leukotoxin itself is an important immunogen, the vaccine strain is designed to express an inactive but immunogenic form of the protein—a genetic toxoid. Within the modified leukotoxin operon was placed an MfeI restriction site specifically for cloning of DNA, allowing heterologous DNA (preferably encoding protective immunogenic epitopes) to be cloned and expressed as a fusion product with the leuko-toxoid. In this case, DNA encoding fragments of tetanus toxin P2 epitope and R. microplus were cloned in-frame into the MfeI restriction site.
[0078] Nucleotide sequences encoding the tetanus toxin P2 epitope and a tick AQP1 fragment were codon-optimized. DNA encoding the chimeric protein was synthesized by Blue Heron Biotech (Bothell, Wash., USA). The 5′ end was designed with nucleotides corresponding to an MfeI restriction endonuclease recognition site, and the 3′ end was designed with nucleotides corresponding to an EcoR1 restriction endonuclease recognition site to allow cloning into a replacement plasmid containing Mfe1 at the cloning site. After cloning, the resultant plasmid was utilized to generate modified Mannheimia haemolytica serotype 1 and serotype 6.
[0079] In some embodiments of the invention, a vaccine provided herein can be delivered as a prophylactic vaccine to reduce the risk of R. microplus infestation to occur. In some instances, a vaccine provided herein can reduce the risk of developing bovine babesiosis and/or anaplasmosis should an R. microplus infection occur.
[0080] Although mucosal vaccination and leukotoxin deficient M. haemolytica are known, inventors are aware of no M. haemolytica vectors successfully combining the concepts disclosed herein.
[0081] In an embodiment, the invention relates to a method for vaccinating an animal, comprising administering a vaccine of the invention to the animal. In some embodiments, the vaccine of the invention comprises a cassette of the invention and a pharmaceutically acceptable carrier, excipient, or vehicle. In some embodiments of the invention, the vaccinated animal is an even toed ungulate ruminant. The vaccinated animal may be a cattle, a sheep, a goat, a deer, a giraffe, an elk, or a bison.
[0082] In an embodiment, the invention relates to a kit for performing methods of eliciting or inducing an immunogenic or protective response against a tick infestation. In some embodiments of the invention, the kit comprises a modified M. haemolytica lktCA gene cluster vector comprising a polynucleotide encoding an added neutralizing epitope, two copies of a P2 epitope, and two copies of an RmAQP1 fragment inserted downstream of the lktC-lktA intergenic region, and upstream of lktA gene nucleotide 2192. In some embodiments of the invention, the kit comprises a polynucleotide encoding a polypeptide with the amino acid sequence set forth in SEQ ID NO: 18. In some embodiments of the invention, the kit comprises a polynucleotide with the nucleotide sequence set forth in SEQ ID NO: 19.
[0083] The terms “antigen,” “antigenic region,” and “immunogen,” may be used interchangeably herein. As used herein, an antigen or immunogen, or epitope is generally a portion of a protein (e.g. a peptide or polypeptide). Antigen is a term used historically to designate an entity that is bound by an antibody, and also to designate the entity that induces the production of the antibody. More current usage limits the meaning of antigen to that entity bound by an antibody, while the word “immunogen” is used for the entity that induces antibody production. Where an entity discussed herein is both immunogenic and antigenic, reference to it as either an immunogen or antigen will typically be made according to its intended utility.
[0084] As used herein, an “antigen” or “immunogen” is a substance that induces a specific immune response in a host animal. The antigen may comprise a whole organism either killed, attenuated or live; a subunit or portion of an organism; a recombinant vector containing an insert with immunogenic properties; a piece or fragment of DNA capable of inducing an immune response upon presentation to a host animal; a polypeptide, an epitope, a hapten, or any combination thereof. Alternately, the immunogen or antigen may comprise a toxin or antitoxin.
[0085] An “immunological response” to a composition or vaccine is the development in the host of a cellular and/or antibody-mediated immune response to a composition or vaccine of interest. Usually, an “immunological response” includes, but is not limited to, one or more of the following effects: the production of antibodies, B cells, helper T cells, and/or cytotoxic T cells, directed specifically to an antigen or antigens included in the composition or vaccine of interest. Preferably, the host will display either a therapeutic or protective immunological response such that resistance to new infection will be enhanced and/or the clinical severity of the disease reduced. Such protection will be demonstrated by either a reduction or lack of symptoms and/or clinical disease signs normally displayed by an infected host, a quicker recovery time and/or a lowered viral titer in the infected host.
[0086] By “animal” is intended mammals, birds, and the like. Animal or host as used herein includes mammals and human. The animal may be selected from the group consisting of cattle, sheep, goats, pigs, bison, elk, camels, dogs, and deer. The term “animal” also includes an individual animal in all stages of development, including newborn, embryonic and fetal stages.
[0087] As used herein, the term “about” is defined as plus or minus ten percent of a recited value. For example, about 1.0 g means 0.9 g to 1.1 g.
[0088] Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms “a”, “an”, and “the” include plural referents unless context clearly indicates otherwise. Similarly, the word “or” is intended to include “and” unless the context clearly indicate otherwise.
[0089] Embodiments of the present invention are shown and described herein. It will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will occur to those skilled in the art without departing from the invention. Various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the included claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents are covered thereby. All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.
EXAMPLES
[0090] Having now generally described this invention, the same will be better understood by reference to certain specific examples, which are included herein only to further illustrate the invention and are not intended to limit the scope of the invention as defined by the claims.
Example 1
Construction Modified M. haemolytica lktCA Gene Cluster Cassette
[0091] A modified M. haemolytica lktCA gene cluster cassette with an insertion of a polynucleotide encoding an additional M. haemolytica leukotoxin neutralizing epitope was prepared.
[0092] The polynucleotide cassette was designed to delete parent chromosomal nucleotides from the beginning of the lktC ribosome binding site to the beginning of the lktA ribosome binding site, thereby removing the entire lktC coding region. A second deletion was designed in-frame with the lktA coding region to remove the nucleotides encoding amino acids 2 to 731. A synthetic codon-optimized polynucleotide encoding the leukotoxin neutralizing epitope, flanked upstream by a synthetic MfeI site and downstream by a synthetic BamH1 site, was inserted in-frame with the second deletion, thereby duplicating the neutralizing epitope in the encoded leukotoxoid product. A schematic of the preparation of the modified M. haemolytica lktCA gene cluster cassette is depicted on
[0093] The nucleotide sequence of the wild-type M. haemolytica D153 lktCA gene cluster is: ttct cttttgctaaatagtgttggtaagtagtcccattttgcacaccaatcgttttcaccttagcaaaatctgtatcttttttcgcaatgaaggcagcagag cttggaaagtaaggctcgctaaataatacttgtttcttacgtggttccgtaatacccatacctgaaattgcagcatcaaattgatttgattaggctt tggattaagctatcaaaaggttggctatggaatgtacaatttgcattcatctctttacagatagcatttgcaatatccacatcaaaaccgataattt ctcccttctcttcggtcatttcaaatggaggatagcttggctccatcacaaatttgatatcttgtgcctgcgcagtaaccacacacccgaataaa agggtcaaaagtgatttttcataaaaagtccctgtgattcattataaggattaccactttaacgcagttactttcttaaaaaaagtcttcttttcataa agtttgttttatgtcatacaaacacatcaaattgagatgtagtttctcaatcctcttgattcctctatctcaaaaaaacaacccaaaagaaaaaaga aaagtatatgttacattaatattacaatgtaattattttgtttaatttccctacattttgtataactttaaaacactcctttttctcttctgattatataaaag acaaaaaatacaatttaagctacaaaaaacaacaaaaaacaacaaaaaacacgacaataagatcgagtaatgattatattatgttataatttttg acctaatttagaataattatcgagtgcaaattATGaatcaatcttattttaacttactaggaaacattacttggctatggatgaactcctccctcc acaaagaatggagctgtgaactactagcacgcaatgtgattcctgcaattgaaaatgaacaatatatgctacttatagataacggtattccgat cgcttattgtagttgggcagatttaaaccttgagactgaggtgaaatatattaaggatattaattcgttaacaccagaagaatggcagtctggtg acagacgctggattattgattgggtagcaccattcggacattctcaattactttataaaaaaatgtgtcagaaataccctgatatgatcgtcagat ctatacgcttttatccaaagcagaaagaattaggcaaaattgcctactttaaaggaggtaaattagataaaaaaacagcaaaaaaacgttttga tacatatcaagaagagctggcaacagcacttaaaaatgaatttaattttattaaaaaatagaaggagacatcccttATGggaactagacttac aaccctatcaaatgggctaaaaaacactttaacggcaaccaaaagtggcttacataaagccggtcaatcattaacccaagccggcagttcttt aaaaactggggcaaaaaaaattatcctctatattccccaaaattaccaatatgatactgaacaaggtaatggtttacaggatttagtcaaagcg gccgaagagttggggattgaggtacaaagagaagaacgcaataatattgcaacagctcaaaccagtttaggcacgattcaaaccgctattg gcttaactgagcgtggcattgtgttatccgctccacaaattgataaattgctacagaaaactaaagcaggccaagcattaggttctgccgaaa gcattgtacaaaatgcaaataaagccaaaactgtattatctggcattcaatctattttaggctcagtattggctggaatggatttagatgaggcct tacagaataacagcaaccaacatgctcttgctaaagctggcttggagctaacaaattcattaattgaaaatattgctaattcagtaaaaacactt gacgaatttggtgagcaaattagtcaatttggttcaaaactacaaaatatcaaaggcttagggactttaggagacaaactcaaaaatatcggtg gacttgataaagctggccttggtttagatgttatctcagggctattatcgggcgcaacagctgcacttgtacttgcagataaaaatgcttcaaca gctaaaaaagtgggtgcgggttttgaattggcaaaccaagttgttggtaatattaccaaagccgtttcttcttacattttagcccaacgtgttgca gcaggtttatcttcaactgggcctgtggctgctttaattgcttctactgtttctcttgcgattagcccattagcatttgccggtattgccgataaattt aatcatgcaaaaagtttagagagttatgccgaacgctttaaaaaattaggctatgacggagataatttattagcagaatatcagcggggaaca gggactattgatgcatcggttactgcaattaataccgcattggccgctattgctggtggtgtgtctgctgctgcagccggctcggttattgcttc accgattgccttattagtatctgggattaccggtgtaatttctacgattctgcaatattctaaacaagcaatgtttgagcacgttgcaaataaaattc ataacaaaattgtagaatgggaaaaaaataatcacggtaagaactactttgaaaatggttacgatgcccgttatcttgcgaatttacaagataat atgaaattcttactgaacttaaacaaagagttacaggcagaacgtgtcatcgctattactcagcagcaatgggataacaacattggtgatttag ctggtattagccgtttaggtgaaaaagtccttagtggtaaagcctatgtggatgcgtttgaagaaggcaaacacattaaagccgataaattagt acagttggattcggcaaacggtattattgatgtgagtaattcgggtaaagcgaaaactcagcatatcttattcagaacgccattattgacgccg ggaacagagcatcgtgaacgcgtacaaacaggtaaatatgaatatattaccaagctcaatattaaccgtgtagatagctggaaaattacagat ggtgcagcaagttctacctttgatttaactaacgttgttcagcgtattggtattgaattagacaatgctggaaatgtaactaaaaccaaagaaac aaaaattattgccaaacttggtgaaggtgatgacaacgtatttgttggttctggtacgacggaaattgatggcggtgaaggttacgaccgagtt cactatagccgtggaaactatggtgctttaactattgatgcaaccaaagagaccgagcaaggtagttataccgtaaatcgtttcgtagaaacc ggtaaagcactacacgaagtgacttcaacccataccgcattagtgggcaaccgtgaagaaaaaatagaatatcgtcatagcaataaccagc accatgccggttattacaccaaagataccttgaaagctgttgaagaaattatcggtacatcacataacgatatctttaaaggtagtaagttcaat gatgcctttaacggtggtgatggtgtcgatactattgacggtaacgacggcaatgaccgcttatttggtggtaaaggcgatgatattctcgatg gtggaaatggtgatgattttatcgatggcggtaaaggcaacgacctattacacggtggcaagggcgatgatattttcgttcaccgtaaaggcg atggtaatgatattattaccgattctgacggcaatgataaattatcattctctgattcgaacttaaaagatttaacatttgaaaaagttaaacataat cttgtcatcacgaatagcaaaaaagagaaagtgaccattcaaaactggttccgagaggctgattttgctaaagaagtgcctaattataaagca actaaagatgagaaaatcgaagaaatcatcggtcaaaatggcgagcggatcacctcaaagcaagttgatgatcttatcgcaaaaggtaacg gcaaaattacccaagatgagctatcaaaagttgttgataactatgaattgctcaaacatagcaaaaatgtgacaaacagcttagataagttaat ctcatctgtaagtgcatttacctcgtctaatgattcgagaaatgtattagtggctccaacttcaatgttggatcaaagtttatcttctcttcaatttgct agagcagcttaatttttaatgattggcaactctatattgtttcacacattatagagttgccgttttattttataaaaggagacaatatggaagctaac catcaaaggaatgatcttggtttagttgccctcactatgttggcacaataccataatatttcgcttaatccggaa; and is set forth in SEQ ID NO: 1.
[0094] A Down-Replacement arm and an Up-Replacement arm were created to introduce the changes in the M. haemolytica lktCA gene cluster. The Down-Replacement arm was generated by amplifying a portion of the M. haemolytica D153 lktCA gene cluster using polymerase chain reaction (PCR). The Down-arm Forward primer TM56 (AAAGGATCCTTTAACGGTGGTG AT; set forth in SEQ ID NO: 3) added nucleotides corresponding to a BamHI restriction endonuclease recognition site at the 5′ end of the Down-replacement arm. The Down-arm Reverse primer TM57 (AAAGAATTCCGGATTAAGCGAAATATTATGGTATTGT; set forth in SEQ ID NO: 4) added nucleotides corresponding to an EcoRI restriction endonuclease recognition site at the 3′ end of the Down-replacement arm. Thus, in a 5′ to 3′ orientation, the Down-Replacement arm contained nucleotides corresponding to a BamHI restriction endonuclease recognition site, followed by nucleotides 3530 to 4360 of the M. haemolytica D153 lktCA gene cluster of SEQ ID NO: 1, followed by nucleotides corresponding to an EcoRI restriction endonuclease recognition site. The nucleotide sequence of the amplified Down-replacement arm is: GGATCCTTTAACGGTGGTGATGGTGTCGATACTATTGACGGTAAC GACGGCAATGACCGCTTATTTGGTGGTAAAGGCGATGATATTCTCGATGGTGGAAAT GGTGATGATTTTATCGATGGCGGTAAAGGCAACGACCTATTACACGGTGGCAAGGG CGATGATATTTTCGTTCACCGTAAAGGCGATGGTAATGATATTATTACCGATTCTGA CGGCAATGATAAATTATCATTCTCTGATTCGAACTTAAAAGATTTAACATTTGAAAA AGTTAAACATAATCTTGTCATCACGAATAGCAAAAAAGAGAAAGTGACCATTCAAA ACTGGTTCCGAGAGGCTGATTTTGCTAAAGAAGTGCCTAATTATAAAGCAACTAAAG ATGAGAAAATCGAAGAAATCATCGGTCAAAATGGCGAGCGGATCACCTCAAAGCAA GTTGATGATCTTATCGCAAAAGGTAACGGCAAAATTACCCAAGATGAGCTATCAAA AGTTGTTGATAACTATGAATTGCTCAAACATAGCAAAAATGTGACAAACAGCTTAG ATAAGTTAATCTCATCTGTAAGTGCATTTACCTCGTCTAATGATTCGAGAAATGTATT AGTGGCTCCAACTTCAATGTTGGATCAAAGTTTATCTTCTCTTCAATTTGCTAGAGCA GCTTAATTTTTAATGATTGGCAACTCTATATTGTTTCACACATTATAGAGTTGCCGTT TTATTTTATAAAAGGAGACAATATGGAAGCTAACCATCAAAGGAATGATCTTGGTTT AGTTGCCCTCACTATGTTGGCACAATACCATAATATTTCGCTTAATCCGGAATTC; and is set forth in SEQ ID NO: 2. Plasmid PBCSKlktDown was generated by subjecting the amplified Down-replacement arm PCR product to digestion with restriction endonuclease enzymes EcoRI and BamHI. After purification of the digested product, it was inserted into the corresponding sites of the pBC SK(-) cloning vector (Stratagene California; La Jolla, Calif., USA).
[0095] The Up-Replacement arm was synthesized by Blue Heron Biotech (Bothell, Wash., USA). In a 5′ to 3′ orientation, the synthesized Up-Replacement arm contained nucleotides corresponding to a BamHI restriction endonuclease recognition site, followed by nucleotides 1 to 807 and 1325 to 1341 of the M. haemolytica D153 lktCA gene cluster nucleotide sequence set forth in SEQ ID NO: 1, followed by nucleotides corresponding to an MfeI restriction endonuclease recognition site, followed by a codon-optimized sequence encoding the added leukotoxin neutralizing epitope, followed by nucleotides corresponding to a BamHI restriction endonuclease recognition site. The nucleotide sequence of the synthesized Up-Replacement arm is: GGATCCGAATTCTCTTTTGCTAAATAGTGTTGGTAAGTAGTCCCATTTTGCACACC AATCGTTTTCACCTTAGCAAAATCTGTATCTTTTTTCGCAATGAAGGCAGCAGAGCTT GGAAAGTAAGGCTCGCTAAATAATACTTGTTTCTTACGTGGTTCCGTAATACCCATA CCTGAAATTGCAGCATCAAATTGTTTTTGTTTTAGGCTTTGGATTAAGCTATCAAAAG GTTGGCTATGGAATGTACAATTTGCATTCATCTCTTTACAGATAGCATTTGCAATATC CACATCAAAACCGATAATTTCTCCCTTCTCTTCGGTCATTTCAAATGGAGGATAGCTT GGCTCCATCACAAATTTGATATCTTGTGCCTGCGCAGTAACCACACACCCGAATAAA AGGGTCAAAAGTGTTTTTTTCATAAAAAGTCCCTGTGTTTTCATTATAAGGATTACCA CTTTAACGCAGTTACTTTCTTAAAAAAAGTCTTCTTTTCATAAAGTTTGTTTTATGTC ATACAAACACATCAAATTGAGATGTAGTTTCTCAATCCTCTTGATTCCTCTATCTCAA AAAAACAACCCAAAAGAAAAAAGAAAAGTATATGTTACATTAATATTACAATGTAA TTATTTTGTTTAATTTCCCTACATTTTGTATAACTTTAAAACACTCCTTTTTCTCTTCT GATTATATAAAAGACAAAAAATACAATTTAAGCTACAAAAAACAACAAAAAACAAC AAAAAACACGACAATAAGATCGAGTAATGATTATATTATGTTATAATTTTTGACCTA ATTTAGAATAATTATAGGAGACATCCCTTATGCAATTGGTAATTACAAATAGCAAAA AAGAAAAAGTAACAATTCAAAATTGGTTTCGTGAAGCAGATTTCGCTAAAGAAGTT CCAAATTATAAAGCAACGAAGGATGAAAAAATTGAAGAAATTATTGGACAAAATGG AGAACGTATTACAAGTAAACAAGTAGATGACTTAATCGCAAAAGGTAACGGAAAAA TTACTCAGGATGAATTATCGAAGGTGGTAGATAACTATGAAGGATCC; and is set forth in SEQ ID NO: 5. Plasmid pBCSKlktUp-Down was generated by inserting the synthetic Up-Replacement arm into BamH1-digested pBCSKlktDown. The correct orientation of the Up-Replacement arm was determined using standard Sanger DNA sequencing (performed at the Iowa State University DNA facilities in Ames, Iowa, USA). The resulting pBCSKlktUp-Down plasmid contains the ΔlktCAV4 cassette.
[0096] A depiction of the modified lktCA gene cluster cassette is shown in
[0097] The nucleotide sequence of the native leukotoxin promotor region is: TTCTCTTTTGCT AAATAGTGTTGGTAAGTAGTCCCATTTTGCACACCAATCGTTTTCACCTTAGCAAAA TCTGTATCTTTTTTCGCAATGAAGGCAGCAGAGCTTGGAAAGTAAGGCTCGCTAAAT AATACTTGTTTCTTACGTGGTTCCGTAATACCCATACCTGAAATTGCAGCATCAAATT GTTTTTGTTTTAGGCTTTGGATTAAGCTATCAAAAGGTTGGCTATGGAATGTACAATT TGCATTCATCTCTTTACAGATAGCATTTGCAATATCCACATCAAAACCGATAATTTCT CCCTTCTCTTCGGTCATTTCAAATGGAGGATAGCTTGGCTCCATCACAAATTTGATAT CTTGTGCCTGCGCAGTAACCACACACCCGAATAAAAGGGTCAAAAGTGTTTTTTTCA TAAAAAGTCCCTGTGTTTTCATTATAAGGATTACCACTTTAACGCAGTTACTTTCTTA AAAAAAGTCTTCTTTTCATAAAGTTTGTTTTATGTCATACAAACACATCAAATTGAG ATGTAGTTTCTCAATCCTCTTGATTCCTCTATCTCAAAAAAACAACCCAAAAGAAAA AAGAAAAGTATATGTTACATTAATATTACAATGTAATTATTTTGTTTAATTTCCCTAC ATTTTGTATAACTTTAAAACACTCCTTTTTCTCTTCTGATTATATAAAAGACAAAAAA TACAATTTAAGCTACAAAAAACAACAAAAAACAACAAAAAACACGACAATAAGAT CGAGTAATGATTATATTATGTTATAATTTTTGACCTAATTTAGAATAATTAT; and is set forth in SEQ ID NO: 6. The sequence of the native lktC-lktA intergenic region is AAGGAGAC ATCCCTT; and is set forth in SEQ ID NO: 7.
[0098] The codon-optimized nucleotide sequence encoding the added leukotoxin neutralizing epitope is: CAATTGGTAATTACAAATAGCAAAAAAGAAAAAGTAACAATTCAAAATT GGTTTCGTGAAGCAGATTTCGCTAAAGAAGTTCCAAATTATAAAGCAACGAAGGAT GAAAAAATTGAAGAAATTATTGGACAAAATGGAGAACGTATTACAAGTAAACAAGT AGATGACTTAATCGCAAAAGGTAACGGAAAAATTACTCAGGATGAATTATCGAAGG TGGTAGATAACTATGAAGGATCC; and is set forth in SEQ ID NO: 8. The amino acid sequence of the added leukotoxin neutralizing epitope is: QLVITNSKKEKVTIQNWFREAD FAKEVPNYKATKDEKIEEIIGQNGERITSKQVDDLIAKGNGKITQDELSKVVDNYEGS; and is set forth in SEQ ID NO: 9. The nucleotide sequence of lktA nucleotides 2192 to 3022 is: CCTTTAACGGTGGTGATGGTGTCGATACTATTGACGGTAACGACGGCAATGACCG CTTATTTGGTGGTAAAGGCGATGATATTCTCGATGGTGGAAATGGTGATGATTTTAT CGATGGCGGTAAAGGCAACGACCTATTACACGGTGGCAAGGGCGATGATATTTTCG TTCACCGTAAAGGCGATGGTAATGATATTATTACCGATTCTGACGGCAATGATAAAT TATCATTCTCTGATTCGAACTTAAAAGATTTAACATTTGAAAAAGTTAAACATAATC TTGTCATCACGAATAGCAAAAAAGAGAAAGTGACCATTCAAAACTGGTTCCGAGAG GCTGATTTTGCTAAAGAAGTGCCTAATTATAAAGCAACTAAAGATGAGAAAATCGA AGAAATCATCGGTCAAAATGGCGAGCGGATCACCTCAAAGCAAGTTGATGATCTTA TCGCAAAAGGTAACGGCAAAATTACCCAAGATGAGCTATCAAAAGTTGTTGATAAC TATGAATTGCTCAAACATAGCAAAAATGTGACAAACAGCTTAGATAAGTTAATCTCA TCTGTAAGTGCATTTACCTCGTCTAATGATTCGAGAAATGTATTAGTGGCTCCAACTT CAATGTTGGATCAAAGTTTATCTTCTCTTCAATTTGCTAGAGCAGCTTAATTTTTAAT GATTGGCAACTCTATATTGTTTCACACATTATAGAGTTGCCGTTTTATTTTATAAAAG GAGACAATATGGAAGCTAACCATCAAAGGAATGATCTTGGTTTAGTTGCCCTCACTA TGTTGGCACAATACCATAATATTTCGCTTAATCCGGAA; and is set forth in SEQ ID NO: 11.
[0099] The amino acid sequence of the polypeptide resulting from the translation of the M. haemolytica nucleotides 3′ of the inserted heterologous polynucleotide is ELVITNSKKEKVTIQNWFREADFAKEVPNYKATKDEKIEEIIGQNGERITSKQVDDLIAK GNGKITQDELSKVVDNYEGSFNGGDGVDTIDGNDGNDRLFGGKGDDILDGGNGDDFID GGKGNDLLHGGKGDDIFVHRKGDVKDLTFEKVKHNLVITNSKKEKVTIQNWFREADFA KEVPNYKATKDEKIEEIIGQNGERITSKQVDDLIAKGNGKITQDELSKVVDNYELLKHSK NVTNSLDKLISSVSAFTSSNDSRNVLVAPTSMLDQSLSSLQFARAA*, and is set forth in SEQ ID NO: 10.
[0100] The nucleotide sequence of the M. haemolytica ΔlktCAV4 cassette is GAATTCTCTTTT GCTAAATAGTGTTGGTAAGTAGTCCCATTTTGCACACCAATCGTTTTCACCTTAGCA AAATCTGTATCTTTTTTCGCAATGAAGGCAGCAGAGCTTGGAAAGTAAGGCTCGCTA AATAATACTTGTTTCTTACGTGGTTCCGTAATACCCATACCTGAAATTGCAGCATCA AATTGTTTTTGTTTTAGGCTTTGGATTAAGCTATCAAAAGGTTGGCTATGGAATGTAC AATTTGCATTCATCTCTTTACAGATAGCATTTGCAATATCCACATCAAAACCGATAA TTTCTCCCTTCTCTTCGGTCATTTCAAATGGAGGATAGCTTGGCTCCATCACAAATTT GATATCTTGTGCCTGCGCAGTAACCACACACCCGAATAAAAGGGTCAAAAGTGTTTT TTTCATAAAAAGTCCCTGTGTTTTCATTATAAGGATTACCACTTTAACGCAGTTACTT TCTTAAAAAAAGTCTTCTTTTCATAAAGTTTGTTTTATGTCATACAAACACATCAAAT TGAGATGTAGTTTCTCAATCCTCTTGATTCCTCTATCTCAAAAAAACAACCCAAAAG AAAAAAGAAAAGTATATGTTACATTAATATTACAATGTAATTATTTTGTTTAATTTCC CTACATTTTGTATAACTTTAAAACACTCCTTTTTCTCTTCTGATTATATAAAAGACAA AAAATACAATTTAAGCTACAAAAAACAACAAAAAACAACAAAAAACACGACAATA AGATCGAGTAATGATTATATTATGTTATAATTTTTGACCTAATTTAGAATAATTATAG GAGACATCCCTTATGaattgGTAATTACAAATAGCAAAAAAGAAAAAGTAACAATTCA AAATTGGTTTCGTGAAGCAGATTTCGCTAAAGAAGTTCCAAATTATAAAGCAACGA AGGATGAAAAAATTGAAGAAATTATTGGACAAAATGGAGAACGTATTACAAGTAAA CAAGTAGATGACTTAATCGCAAAAGGTAACGGAAAAATTACTCAGGATGAATTATC GAAGGTGGTAGATAACTATGAAggatccTTTAACGGTGGTGATGGTGTCGATACTATTG ACGGTAACGACGGCAATGACCGCTTATTTGGTGGTAAAGGCGATGATATTCTCGATG GTGGAAATGGTGATGATTTTATCGATGGCGGTAAAGGCAACGACCTATTACACGGT GGCAAGGGCGATGATATTTTCGTTCACCGTAAAGGCGATGGTAATGATATTATTACC GATTCTGACGGCAATGATAAATTATCATTCTCTGATTCGAACTTAAAAGATTTAACA TTTGAAAAAGTTAAACATAATCTTGTCATCACGAATAGCAAAAAAGAGAAAGTGAC CATTCAAAACTGGTTCCGAGAGGCTGATTTTGCTAAAGAAGTGCCTAATTATAAAGC AACTAAAGATGAGAAAATCGAAGAAATCATCGGTCAAAATGGCGAGCGGATCACCT CAAAGCAAGTTGATGATCTTATCGCAAAAGGTAACGGCAAAATTACCCAAGATGAG CTATCAAAAGTTGTTGATAACTATGAATTGCTCAAACATAGCAAAAATGTGACAAAC AGCTTAGATAAGTTAATCTCATCTGTAAGTGCATTTACCTCGTCTAATGATTCGAGA AATGTATTAGTGGCTCCAACTTCAATGTTGGATCAAAGTTTATCTTCTCTTCAATTTG CTAGAGCAGCTTAATTTTTAATGATTGGCAACTCTATATTGTTTCACACATTATAGAG TTGCCGTTTTATTTTATAAAAGGAGACAATATGGAAGCTAACCATCAAAGGAATGAT CTTGGTTTAGTTGCCCTCACTATGTTGGCACAATACCATAATATTTCGCTTAATCCGG AATTC; and it is set forth in SEQ ID NO: 12.
[0101] The amino acid sequence of the M. haemolytica ΔlktCAV4 cassette is MQLVITNSKKE KVTIQNWFREADFAKEVPNYKATKDEKIEEIIGQNGERITSKQVDDLIAKGNGKITQDEL SKVVDNYEGSFNGGDGVDTIDGNDGNDRLFGGKGDDILDGGNGDDFIDGGKGNDLLH GGKGDDIFVHRKGDGNDIITDSDGNDKLSFSDSNLKDLTFEKVKHNLVITNSKKEKVTIQ NWFREADFAKEVPNYKATKDEKIEEIIGQNGERITSKQVDDLIAKGNGKITQDELSKVVD NYELLKHSKNVTNSLDKLISSVSAFTSSNDSRNVLVAPTSMLDQSLSSLQFARAA*; and is set forth in SEQ ID NO: 13.
[0102] To add a selectable marker and a temperature-sensitive origin of replication, the M. haemolytica ΔlktCAV4 cassette was inserted in the plasmid pCT109GA189-Kan. Plasmid pCT109GA189-Kan (described in Briggs, R. E. and Tatum, F. M., 2005, “Generation and Molecular Characterization of New Temperature-Sensitive Plasmids Intended for Genetic Engineering of Pasteurellaceae,” Appl. Environ. Microbiol. 71(11): 7187-7195) and plasmid pBCSKlktUp-Down were digested with restriction endonuclease enzyme XbaI, treated with Shrimp alkaline phosphatase, and ligated to each other to generate the replacement plasmid pBCΔlktCAV4-pCT109GA189-Kan.
[0103] To generate modified M. haemolytica D153 (serotype 1) and M. haemolytica D174 (serotype 6) bacteria containing the ΔlktCAV4 cassette, the replacement plasmid pBCΔlktCAV4-pCT109GA189-Kan was introduced into M. haemolytica D153 (serotype 1) and M. haemolytica D174 (serotype 6) using electroporation as described by Briggs, R. E., et al. (“Characterization of a Restriction Endonuclease, Phal, from Pasteurella haemolytica Serotype A1 and Protection of Heterologous DNA by a cloned Pha I methyltransferase gene,” 1994, Appl. Environ. Microbiol. 60(6): 2006-2010) except that the replacement plasmid was not subjected to passage through E. coli strain Phal Mtase. The two M. haemolytica strains transformed with the replacement plasmid were treated by the steps described in Tatum, F. M. and Briggs R. E. (“Construction of In-Frame aroA Deletion Modifieds of Mannheimia haemolytica, Pasteurella multocida, and Haemophilus somnus by Using a New Temperature-Sensitive Plasmid,” 2005, Appl. Environ. Microbiol. 71(11): 7196-7202) to generate the modified M. haemolytica modified products D153ΔlktCAV4 and D174ΔlktCAV4 containing the modified M. haemolytica lktCA cassette. These modified M. haemolytica strains D153ΔlktCAV4 and D174ΔlktCAV4 are useful as antigen-expression vectors, and as vaccine products.
Example 2
Generation of Anti-Tick Vaccine Product
[0104] A polynucleotide fragment encoding a chimeric protein comprising a tandem repeat of the P2 epitope and a tandem repeat of the RmAQP1 fragment was inserted into the unique MfeI restriction endonuclease recognition site of the M. haemolytica ΔlktCAV4 cassette to generate the P2P2AQP1fAQP1fΔlktCAV4 cassette.
[0105] The amino acid sequence of the tetanus toxin epitope P2 is QFQYIKANSKFIGITE; and is set forth in SEQ ID NO: 14. The codon-optimized nucleotide sequence of the tetanus toxin epitope P2 used to generate the P2P2AQP1fAQP1fΔlktCAV4 cassette is caattccaatacattaaagc aaattcaaaattcattggcattacggaa; and is set forth in SEQ ID NO: 15. The sequence of a 53 amino acid segment encompassing an RmAQP1 extracellular domain (RmAQP1f) used to generate the P2P2AQP1fAQP1fΔlktCAV4 cassette is LALVFATYKDAIEHFDQGIRQVTGEKATAGIFAT YPRPHVSTLTCFIDQVIAT; and is set forth in SEQ ID NO: 16. The codon-optimized nucleotide sequence of the RmAQP1f is ttggctttagtttttgcaacctacaaagatgctattgaacattttgatcagggta ttcgtcaagttacaggtgaaaaagcaaccgcaggtatttttgcaacctatcctcgtccacatgtaagtactttaacttgttttattgatcaagtaatt gccact; and is set forth in SEQ ID NO: 17.
[0106] Polynucleotide fragments encoding tandem repeats of the P2 epitope and the AQP1 fragment were synthesized with nucleotides corresponding to MfeI and EcoR1 restriction enzyme recognition sites added at the 5′ end and 3′ end, respectively. The polynucleotide fragments encoding the P2 and AQP1 fragment tandem repeats were custom synthesized by Blue Heron Biotech (Bothel, Wash., USA). These P2 and AQP1 fragments were sequentially inserted into the MfeI site of the ΔlktCAV4 cassette using standard cloning procedures to generate the P2P2AQP1AQP1ΔlktCAV4 cassette. Each polynucleotide addition was confirmed by standard DNA sequencing. The nucleotide sequence of the P2P2AQP1AQP1ΔlktCAV4 cassette is caattccaatacattaaagcaaattcaaaattcattggcattacggaacaattccaatacattaaagcaaattcaaaattcattgg cattacggaacaattggctttagtttttgcaacctacaaagatgctattgaacattttgatcagggtattcgtcaagttacaggtgaaaaagcaac cgcaggtatttttgcaacctatcctcgtccacatgtaagtactttaacttgttttattgatcaagtaattgccactgaattggctttagtttttgcaacc tacaaagatgctattgaacattttgatcagggtattcgtcaagttacaggtgaaaaagcaaccgcaggtatttttgcaacctatcctcgtccacat gtaagtactttaacttgttttattgatcaagtaattgccactgaattggtaattacaaatagcaaaaaagaaaaagtaacaattcaaaattggtttc gtgaagcagatttcgctaaagaagttccaaattataaagcaacgaaggatgaaaaaattgaagaaattattggacaaaatggagaacgtatta caagtaaacaagtagatgacttaatcgcaaaaggtaacggaaaaattactcaggatgaattatcgaaggtggtagataactatgaaggatcct ttaacggtggtgatggtgtcgatactattgacggtaacgacggcaatgaccgcttatttggtggtaaaggcgatgatattctcgatggtggaaa tggtgatgattttatcgatggcggtaaaggcaacgacctattacacggtggcaagggcgatgatattttcgttcaccgtaaaggcgatgtaaa agatttaacatttgaaaaagttaaacataatcttgtcatcacgaatagcaaaaaagagaaagtgaccattcaaaactggttccgagaggctgat tttgctaaagaagtgcctaattataaagcaactaaagatgagaaaatcgaagaaatcatcggtcaaaatggcgagcggatcacctcaaagca agttgatgatcttatcgcaaaaggtaacggcaaaattacccaagatgagctatcaaaagttgttgataactatgaattgctcaaacatagcaaa aatgtgacaaacagcttagataagttaatctcatctgtaagtgcatttacctcgtctaatgattcgagaaatgtattagtggctccaacttcaatgtt ggatcaaagtttatcttctcttcaatttgctagagcagcttaa; and is set forth in SEQ ID NO: 18.
[0107] The P2P2AQP1AQP1ΔlktCAV4 cassette was amplified by PCR and inserted into the pet-Sumo protein expression system (Invitrogen Thermo Fisher Scientific; Waltham, Mass., USA), and expressed in E. coli cells using standard cloning techniques. The protein expression levels were determined by Western blotting using an in-house-generated mouse monoclonal antibody specific to M. haemolytica leukotoxin. This monoclonal antibody binds to the leukotoxoid portion of the hybrid protein, and can be detected with labeled anti-mouse antibody. The amino acid sequence of the protein expressed by the P2P2AQP1AQP1ΔlktCAV4 cassette is QFQYIKANSKFIGITEQFQYIKANSKFIGITEQLALV FATYKDAIEHFDQGIRQVTGEKATAGIFATYPRPHVSTLTCFIDQVIATELALVFATYKD AIEHFDQGIRQVTGEKATAGIFATYPRPHVSTLTCFIDQVIATELVITNSKKEKVTIQNWF READFAKEVPNYKATKDEKIEEIIGQNGERITSKQVDDLIAKGNGKITQDELSKVVDNYE GSFNGGDGVDTIDGNDGNDRLFGGKGDDILDGGNGDDFIDGGKGNDLLHGGKGDDIFV HRKGDVKDLTFEKVKHNLVITNSKKEKVTIQNWFREADFAKEVPNYKATKDEKIEEIIG QNGERITSKQVDDLIAKGNGKITQDELSKVVDNYELLKHSKNVTNSLDKLISSVSAFTSS NDSRNVLVAPTSMLDQSLSSLQFARAA*, and is set forth in SEQ ID NO: 19.
[0108] Upon expression, the recombinant product produced by the P2P2AQP1AQP1ΔlktCAV4 cassette was contained primarily in inclusion bodies. Purification of the recombinant peptide was accomplished using B-Per Reagent (Pierce, Rockford, Ill., USA) according to the manufacturer's directions. The purified recombinant peptide was resuspended in phosphate buffered saline and quantitative estimations of protein concentration was assessed by comparing the recombinant preparations to bovine serum albumin standards run on SDS PAGE after coomassie blue staining, and by the “Bradford” protein assay (BioRad, Hercules, Calif., USA).
[0109]
[0110] The polypeptide produced by the P2P2AQP1fAQP1fΔlktCAV4 cassette was separated from the cell culture, and stored at −80° C. until used.
Example 3
Cattle Vaccination and Challenge
[0111] Calves were vaccinated with the polypeptide produced by the P2P2AQP1fAQP1f-ΔlktCAV4 cassette mixed with Montanide ISA50V2.
[0112] Prior to vaccination, and 70 days, 105 days, and 135 days post vaccination blood was collected for serum production. The P2-P2-Aquapep-Aquapep-ΔlktCAV4 cassette was resuspended in PBS, and mixed with Montanide ISA50V2. An emulsion was prepared by mixing the cassette in PBS with Montanide ISA50V2 using two Leur-Lock-connected syringes. A syringe containing 2 ml of the emulsion was prepared for each calf. A first booster vaccination was administered after 4 weeks, and a second booster vaccination was administered 4 weeks later. A first tick infestation was performed 2 weeks after the second booster, and a second tick infestation was performed 4 weeks later.
[0113] Starting 21 days after infestation, the ticks were counted each day up to day 26. The cumulative tick count determined is shown in
[0114] Thus, the antigen expressed by the P2P2AQP1fAQP1fΔlktCAV4 cassette presented a reduction in tick infestation with time as compared to control.
Example 4
Antibody Response
[0115] Antibody response to the AQP1 peptide and the leukotoxin epitope was positive for all vaccinated animals.
[0116] Indirect ELISA assays were conducted using immobilized biotinylated biosynthetic peptides commercially synthesized by Peptide 2.0 (Chantilly, Va., USA). N-terminal biotin and a hinge region were added to the polypeptide having the amino acid sequence set forth in SEQ ID NO 16 to produce the labeled AQP1 peptide: SGSGALVFATYKDAIEHFDQGIRQV TGEKATAGIFATYPRPHVSTLTCFIDQVIAT (set forth in SEQ ID NO: 20). N-terminal biotin and a hinge region were added to a peptide containing a leukotoxin neutralizing epitope to result in labeled Lkt peptide: SGSGFREADFAKEVPNYKATKDEKIEEIIGQNGERI (set forth in SEQ ID NO: 21). The peptides were applied at 1 uM/well to streptavidin plates (Pierce Catalog #15120). Sera samples obtained from each calf at days 0, 70, 105, and 135 post inoculation were tested at 1:50 dilution in quadruplicate Alkaline phosphatase labelled rabbit anti-bovine IgG whole molecule were used as secondary antibody at 1:1000 dilution (Sigma catalog #A0705). PNP (Sigma catalog #N2770) was used as substrate. Results were reported as OD450(test date) minus OD450(day0).
[0117] The results obtained with AQP1 peptide and anti-leukotoxin peptide are shown on
[0118] Delivery of the vaccine resulted in demonstrable antibody responses against both antigens of interest in the vaccine. The measured antibodies correlated with protection against experimental infestation with Rhipicephalus microplus.
Example 5
Deer Vaccination
[0119] Deer were vaccinated with the polypeptide produced by the P2P2AQP1AQP1-lktCAV4 cassette and the lktCAV4 cassette to evaluate antibody response in a cervid host.
[0120] The P2-P2-Aquapep-Aquapep-lktCAV4 polypeptide produced by the P2P2AQP1AQP1-lktCAV4 cassette and polypeptide produced by the lktCAV4 cassette were suspended in PBS, and a water-in-oil-in-water emulsion was prepared with Montanide ISA 201VG adjuvant. The preparation was at a final concentration of 50 micrograms polypeptide per 1 ml.
[0121] A 2 ml volume was delivered subcutaneously to each deer, and booster vaccinations were administered at weeks 3, 5, and 8. Blood was collected for serum on the day of primary immunization (day 0), and on weeks 2, 3, 5, 7, 8, 10, and 13. Indirect ELISA assays provide antibody titers over time. This data will show that delivery of the vaccine results in demonstrable antibody responses against both antigens of interest in the vaccine, and that the measured antibodies correlate with protection against experimental infestation with Rhipicephalus microplus.
Example 6
Cattle Vaccination
[0122] Calves (Bos taurus) were vaccinated with the polypeptide produced by the P2P2AQP1AQP1-lktCAV4 cassette and with the polypeptide produced by the lktCAV4 cassette.
[0123] The P2-P2-Aquapep-Aquapep-lktCAV4 and -lktCAV4 polypeptides were suspended in PBS, and a water-in-oil-in-water emulsion was prepared with Montanide ISA 201VG adjuvant. The preparation was at a final concentration of 50 micrograms polypeptide per 1 ml.
[0124] A 2 ml volume was delivered subcutaneously to each calf, and booster vaccinations were administered at weeks 3 and 5. Blood was collected for serum on the day of primary immunization (day 0), and on weeks 2, 3, and 5 post-vaccination.
[0125] As of 1 Mar. 2021, this study is ongoing and is currently in week 7. Future events will include a final booster vaccination at week 8, and blood collection for serum on weeks 7, 8, 10, and 13. Indirect ELISA assays will be used to evaluate antibody titers over time, and A tick challenge with Rhipicephalus microplus will commence 2 weeks after the final booster vaccination.
[0126] The effectiveness of the vaccine will be tested as in Examples 3 and 4.