Preparation and use of anti-MET-and-RON bispecific antibody and antibody-drug conjugate thereof
11753477 · 2023-09-12
Assignee
Inventors
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K47/6801
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
A61K39/00111
HUMAN NECESSITIES
C07K2317/60
CHEMISTRY; METALLURGY
A61K47/6851
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61K47/6879
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
Abstract
Provided herein are a preparation method and use of an anti-MET-and-RON bispecific antibody and an antibody-drug conjugate thereof. The anti-MET-and-RON bispecific antibody includes an anti-MET antibody fragment and an anti-RON antibody fragment which are linked to each other through a specific chemical “knobs-into-holes” structure.
Claims
1. An anti-MET-and-RON bispecific antibody, comprising an anti-MET antibody fragment and an anti-RON antibody fragment which are linked to each other through a chemical “knobs-into-holes” structure, wherein in the anti-RON antibody fragment, amino acid No. 393 in an amino acid sequence thereof is mutated from T to W, and in the anti-MET antibody fragment, amino acid No. 440 in an amino acid sequence thereof is mutated from Y to V, meanwhile CH1 in a heavy chain variable region thereof and CL in a light chain variable region thereof are interchanged; wherein the bispecific antibody comprises a domain that specifically recognizes and binds to an antigen MET on a cell surface, wherein the domain comprises a heavy chain variable region and a light chain variable region of an anti-MET specific antibody, the heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27, and the light chain variable region comprising the amino acid sequence of SEQ ID NO: 28; wherein the heavy chain variable region comprises: CDRH1, which comprises the amino acid sequence of SEQ ID NO: 7; CDRH2, which comprises the amino acid sequence of SEQ ID NO: 8; and CDRH3, which comprises the amino acid sequence of SEQ ID NO: 9; the light chain variable region comprises: CDRL1, which comprises the amino acid sequence of SEQ ID NO: 10; CDRL2, which comprises the amino acid sequence of SEQ ID NO: 11; and CDRL3, which comprises the amino acid sequence of SEQ ID NO: 12.
2. The bispecific antibody according to claim 1, further comprising a domain that specifically recognizes and binds an antigen RON on a cell surface, wherein the domain comprises a heavy chain variable region and light chain variable region of an anti-RON specific antibody, the heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 31, and the light chain variable region comprising the amino acid sequence of SEQ ID NO: 32; wherein the heavy chain variable region comprises: CDRH1, which comprises the amino acid sequence of SEQ ID NO: 19; CDRH2, which comprises the amino acid sequence of SEQ ID NO: 20; and CDRH3, which comprises the amino acid sequence of SEQ ID NO: 21; the light chain variable region comprises: CDRL1, which comprises the amino acid sequence of SEQ ID NO: 22; CDRL2, which comprises the amino acid sequence of SEQ ID NO: 23; and CDRL3, which comprises the amino acid sequence of SEQ ID NO: 24.
3. An antibody binding fragment, comprising antigen binding domains in SEQ ID NO: 27 and SEQ ID NO: 28.
4. An anticancer drug comprising the bispecific antibody of claim 1.
5. An anticancer drug comprising the antibody binding fragment of claim 3.
6. An antibody-drug conjugate, comprising the bispecific antibody of claim 1 conjugated to a chemotherapeutic drug, or a fusion protein formed by fusing the bispecific antibody with a cytotoxic protein, wherein the antibody-drug conjugate enables the antibody to be targeted and bound to a MET and/or RON protein on a surface of a target cell, and enables the anti-MET-and-RON bispecific antibody and the drug to be engulfed together into the target cell by endocytosis.
7. An anticancer drug comprising the antibody-drug conjugate of claim 6.
8. An anti-MET specific antibody, comprising a domain that specifically recognizes and binds to an antigen MET on a cell surface, wherein the domain comprises a heavy chain variable region and a light chain variable region of the anti-MET specific antibody, the heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27, and the light chain variable region comprising the amino acid sequence of SEQ ID NO: 28.
9. An antibody-drug conjugate, comprising the anti-MET specific antibody of claim 8 conjugated to a chemotherapeutic drug, or a fusion protein formed by fusing the antibody with a cytotoxic protein, wherein the antibody-drug conjugate enables the antibody to be targeted and bound to a MET protein on a surface of a cancer cell, and enables the anti-MET specific antibody and the drug be engulfed together into the cancer cell by endocytosis, to effectively inhibit or reduce proliferation of the cancer cell.
10. An anticancer drug comprising the antibody-drug conjugate of claim 9.
11. The antibody binding fragment of claim 3, further comprising antigen binding domains in SEQ ID NO: 31 and SEQ ID NO: 32.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION OF THE EMBODIMENTS
(10) The following is a detailed description of the present application.
(11) Although the formulation and use of various embodiments of the present application are discussed in detail below, it should be appreciated that the present application provides many embodiments that may be implemented and used in various specific environments. The specific embodiments discussed herein only illustrate specific ways of producing and using the present application, and do not limit the scope of the present application.
(12) To facilitate the understanding of the present application, many terms are defined below. Meanings of the terms defined herein are consistent with those meanings commonly understood by those skilled in the art to which the present application pertains. Terms such as “a” and “an” are not meant to refer to only a single entity, but meant to include general categories that may be used to illustrate a specific example. The terms herein are used to describe specific embodiments, but their usage does not limit the present application except those as outlined in the claims.
(13) The inventor of the present application has developed many bispecific antibodies targeting MET and RON receptor domains, which have shown biological effects and tumor treatment effects in preclinical models. After a bispecific antibody that recognizes MET and RON receptor domains is conjugated to a chemical drug, it can efficiently deliver a cytotoxic drug to tumor cells and kill the cancer cells in a targeted way.
(14) The anti-MET-and-RON bispecific antibody disclosed herein are used to treat various cancers, such as non-small cell lung cancer, breast cancer, ovarian cancer, prostate cancer, cervical cancer, colorectal cancer, lung cancer, pancreatic cancer, gastric cancer, and head and neck cancer. Exposing cancer cells to an effective therapeutic dose of the antibody can inhibit or reduce proliferation of cancer cells. In some embodiments, ability of the antibody to inhibit proliferation of cancer cells can reach 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100%.
(15) When it comes to nucleotides, terms such as the sequence referred to in the expression “substantially as SEQ ID NO: (#)”, “sequence similar to . . . ”, “nucleotide sequence”, and similar terms refer to a sequence corresponding substantially to any part of SEQ ID NO:1 defined herein. These terms refer to synthetic and naturally-derived molecules having a sequence with a same biological, immunological, experimental or other functional activity, such as in hybridization of nucleic acid fragments, or ability to encode all or part of a RON.sup.PSI antibody. Of course, these terms are meant to highlight linear orders in sequences thereof.
(16) The term “homology” refers to the degree to which two nucleic acids are complementary. Homology includes partial homology and complete homology. A partially complementary sequence is a sequence that can partially inhibit hybridization of a fully complementary sequence with a target nucleic acid, and is referred to by functional term “substantially homologous”. As known to those skilled in the art, homology may be measured by hybridization or other measurement methods (for example, competitive PCR detection), and when low homology is detected, the degree of hybridization may also be measured.
(17) An oligonucleotide sequence “substantially homologous” with an anti-MET antibody, an anti-RON antibody, and an anti-MET-and-RON bispecific antibody of SEQ ID NO: # is defined herein as a sequence that, when having more than 100 bp, exhibits greater than or equal to 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% homology with oligonucleotide sequence SEQ ID NO: #. Generally, conservative amino acid substitutions will be used to modify a sequence within the listed percentages. Conservative amino acid substitutions are well known in the art.
(18) The term “gene” refers to a unit that encodes a functional protein, a polypeptide or an oligopeptide. As well known in the art, this functional term is meant to include at least a partial genomic sequence, a cDNA sequence or a fragment or a combination thereof, and a gene product including a gene product that may have been artificially altered. A purified gene, nucleic acid, protein, etc. is meant to refer to a product obtained after it is separated from at least one contaminating nucleic acid or protein normally associated therewith.
(19) The term “vector” refers to a nucleic acid molecule that transfers a DNA fragment from one cell to another cell. Vectors may be further classified into vectors designed to replicate a specific sequence, or expression vectors of a promoter that may be combined with a specific sequence, or vectors designed to guide such a promoter into a nucleus. A vector may exist independent of a host cell chromosome, or may be integrated into a host cell chromosome.
(20) The terms “host cell”, “recombinant cell” or “recombinant host” refer to a cell that has been genetically engineered to contain an exogenous nucleic acid fragment or a modified fragment, whether or not it is a prokaryotic or eukaryotic cell. Therefore, a genetically engineered cell or a recombinant cell is different from a natural cell that does not contain a recombinant gene.
(21) The term “fusion protein” refers to a hybrid protein expressed by a nucleic acid molecule containing at least two gene nucleotide sequences. For example, a fusion protein may include a polypeptide bound to an affinity matrix and another polypeptide.
(22) The term “antibody” is meant to include polyclonal and monoclonal antibody agents, as well as hybrid antibodies, engineered antibodies, F(ab′)2 fragments, F(ab) fragments, Fv fragments, single domain antibodies, chimeric antibodies, and humanized antibody agents, and functional fragments with immunological binding properties of antibody molecules.
(23) The term “monoclonal antibody” refers to an antibody composition having a homologous population of antibodies. The term is not limited to the type or source of an antibody, nor the way it is prepared. The term is meant to include complete immunoglobulins and fragments thereof, such as Fab, F(ab′)2, Fv and functional fragments with immunological binding properties of antibody molecules. In the present application, many hybridomas that have unique binding properties to a receptor domain of MET. For example, these hybridomas induce MET-specific endocytosis in MET expressing cells such as cancer cells. An example is, as used herein, hybridoma PCM-C1D8 and antibody PCM-C1D8 produced therefrom.
(24) Methods of preparing monoclonal antibodies are known in the art. Suitable immune vectors are usually large, slow-metabolized macromolecules, such as proteins, polysaccharides, polylactic acid, polyglycolic acid, polymerized amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles. These vectors are well known to those skilled in the art. In addition, an antigen may be combined with bacterial toxoids, such as toxoids from diphtheria, tetanus, cholera, etc., to enhance immunogenicity thereof.
(25) Monoclonal antibodies are usually prepared by Kohler and Milstein's method (Nature (1975) 256:495-497) or a modified method thereof. Mice, hamsters or rats are usually immunized. Spleen and/or large lymph nodes are separated into individual cells. Then B cells and/or the separated spleen cells are induced to fuse with myeloma cells to form hybridomas (usually cells that do not express endogenous antibody heavy and/or light chains) which are then cultured in a selective medium (such as hypoxanthine, aminopterin, thymidine medium, “HAT”). Monoclonal hybridomas are obtained after limiting dilution, and the ability of the monoclonal hybridomas to produce antibodies that specifically bind to RON. Selected monoclonal antibody-secreting hybridoma cells are then cultured in vitro (for example, in a tissue culture flask or a hollow fiber reactor) or in vivo (for example, in ascites in mice).
(26) The term “antibody fragment” refers to a part of an antibody, such as F(ab′)2, F(ab).sub.2, Fab′, Fab, etc. Regardless of a structure thereof, an antibody fragment can bind to a same antigen. For example, an anti-RON monoclonal antibody fragment binds to an epitope on RON.
(27) The term “antibody fragment” refers to a synthetic or genetically engineered polypeptide capable of binding to a specific antigen, such as a polypeptide including a light chain variable region, an “Fv” fragment including a light chain variable region and a heavy chain variable region, and recombinant single chain polypeptide molecules, in which the light chain variable region and the heavy chain variable region are linked by a peptide chain linker (“scFv protein”) and a smallest recognition unit including an amino acid residue that mimics a hypervariable region.
(28) The term “chimeric antibody” refers to a recombinant protein having a variable domain and a complementarity determining region derived from a rodent antibody, while the rest part of the antibody molecule is derived from a human antibody.
(29) The term “humanized antibody” refers to an immunoglobulin amino acid sequence variant or fragment thereof capable of binding to a predetermined antigen, and it includes an FR region and a complementarity determining region (CDR) substantially having a human immunoglobulin amino acid sequence. It substantially has a non-human immunoglobulin amino acid sequence or a sequence engineered to be capable of binding to a preselected antigen. Humanized antibodies are also commonly referred to as “mosaic” antibodies, which have a heavy chain and a light chain, or CDRs in variable regions of both a heavy chain and a light chain.
(30) The term “antibody-drug conjugate” refers to an antibody derivative prepared by conjugating an antibody or an antibody fragment thereof, including an antibody capable of binding to a protein domain of MET and/or RON, to a cytotoxic drug, a cytostatic agent and/or a therapeutic agent. The term “therapeutic agent” refers to an agent that exerts cytotoxic, cytostatic and/or immunomodulatory effects on cancer cells or activated immune cells. Non-limiting examples of therapeutic agents include cytotoxic agents, chemotherapeutic agents, cytostatic agents, and immunomodulators. The term “chemotherapeutic agent” refers to a compound that may be used to treat cancer. The term “cytotoxic effect” refers to the depletion, elimination and/or killing of target cells using the present application. The term “cytotoxic agent” refers to an agent of the present application that has cytotoxic and cytostatic effects on target cells. The term “cytostatic effect” refers to the use of the present application to inhibit cell proliferation. The term “cytostatic agent” refers to an agent of the present application that has a cytostatic effect on cells, and can inhibit growth and/or proliferation of specific cells.
(31) As discussed herein, a minor change in an amino acid sequence of an antibody or an immunoglobulin polypeptide is considered. For example, it is assumed that a change in an amino acid sequence maintains at least 75%, or even 80%, 90%, 95%, 96%, 97%, 98%, 99% and 100% homologous with a human framework region of a heavy chain variable domain. Specifically, in the present application, if a humanized antibody maintains at least 95%, 96%, 97%, 98%, 99% or 100% homologous with a non-CDR part of a human variable domain and a constant domain, then the humanized antibody is considered to be fully humanized.
(32) Certain changes in amino acid sequences are considered to be conservative amino acid substitutions. Conservative substitutions are substitutions between amino acids with similar side chains. Amino acids are generally divided into the following categories: (1) non-polar: alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; (2) acidic: aspartic acid, glutamic acid; (3) basic: lysine, arginine, histidine; (4) polar: lysine, asparagine, glutamine, cysteine acid, serine, threonine, tyrosine. Other amino acids families include: serine and threonine which belong to an aliphatic-hydroxyl family; asparagine and glutamine which belong to an amide-containing family; alanine, valine, leucine and isoleucine which belong to a aliphatic group; phenylalanine, tryptophan and tyrosine belong to an aromatic group. Therefore, it may be reasonably contemplated that replacing leucine with isoleucine or valine alone, replacing aspartic acid with glutamic acid, replacing threonine with serine, or replacing amino acids with structurally related amino acids will not have significant influence on the binding or properties of obtained molecules, especially when the replacement does not involve amino acids in a framework region.
(33) By measuring specific activity of a polypeptide derivative, it may be easily determined whether an amino acid change results in a functional peptide. Those skilled in the art can easily prepare a fragment or an analog of an antibody or an immunoglobulin molecule, including substitutions at amino and carboxy terminals, including preparation of a fusion protein with, for example, a cytotoxic protein. It is also possible to identify a structural domain and a functional domain by comparing nucleotide and/or amino acid sequence data (as herein shown) and/or sequence databases. Computerized comparison methods may be used to identify a sequence motif or a predicted protein conformation domain produced in other proteins of known structure and/or function. Generally, conservative amino acid substitutions do not substantially change structural features of a parental sequence (for example, a substituted amino acid should not tend to destroy a helix produced in a parental sequence, or destroy other types of auxiliary structures that characterizes a parental sequence).
(34) The terms “cell” and “cell culture” are used interchangeably and refer to mostly, but not always, a cell in a single cell suspension or attached to a plate or tissue, including its progeny. The terms “transformants” and “transformed cells” include main subject cells and cultures derived therefrom, regardless of the number of the transformed. In addition, due to intentional or unintentional mutations, the DNA content of all progeny may not be exactly the same. The progeny includes mutant progeny having a same function or biological activity as those selected from originally transformed cells.
(35) The terms “protein”, “polypeptide” or “peptide” refer to compounds containing amino acids linked by peptide bonds and are used interchangeably.
(36) The term “endogenous” means originating from a substance within cells. An endogenous substance is produced by metabolic activities of cells. However, an endogenous substance may be produced by manipulating cell metabolism, for example, by enabling cells to express genes encoding the substance.
(37) The term “exogenous” means originating from a substance outside cells. However, an exogenous substance may be internalized in cells by those skilled in the art using any of a variety of known metabolic or induction methods.
(38) The term “gene” is used to refer to a coding unit of a functional protein, a polypeptide or a peptide. As understood by those skilled in the art, this functional term includes a genomic sequence, a cDNA sequence or a fragment or a combination thereof, and a gene product, including a gene product that may have been artificially altered. Purified genes, nucleic acids, proteins, and the like, when recognized and separated from at least one contaminating nucleic acid or protein that is normally associated with them, are used to identify these entities. The term “sequence” as used herein is used to refer to nucleotides or amino acids, whether natural or artificial, such as modified nucleic acids or amino acids. When “transcribed nucleic acids” are described, 5′ and 3′ ends of those sequence regions located near a coding region are such that a deoxyribonucleotide sequence corresponds to a length of a full-length mRNA of a protein. The term “gene” is meant to refer to a cDNA and a genomic form of a gene. A gene can produce a variety of RNA species, which are produced by differential splicing of primary RNA transcripts. cDNAs that are spliceosomes of a same gene will include regions with an identical sequence or completely homologous (indicating presence of same exons or same exons parts on two cDNAs) and completely non-identical regions (for example, indicating presence of exon “A” on cDNA I, and cDNA 2 containing exon “B”). Because these two cDNAs include regions with identical sequences, they will be hybridized with a probe obtained from the entire gene or part of the gene containing two cDNA sequences. Therefore, the two spliceosomes are basically homologous with this probe.
(39) The term “vector” is used to refer to a nucleic acid molecule that transfers a DNA fragment from one cell to another cell. The term “vector” as used herein is also meant to refer to an expression vector, which relates to recombinant DNA molecules containing a desired coding sequence and other appropriate nucleic acid sequences necessary for expression of the coding sequence in a specific host organism. A nucleic acid sequence necessary for expression in a prokaryote usually includes a promoter, an operon (optional), and a ribosome binding site, usually together with other sequences. It is known that eukaryotic cell can use promoters, enhancers, terminators, and polyadenylic acid signals to facilitate expression of the coding sequences.
(40) The term “pharmaceutically acceptable” means that a component is suitable for human and/or animal use without excessive adverse side effects (such as toxicity, irritation, and allergic reactions) commensurate with a reasonable benefit/risk ratio.
(41) The term “safe and effective amount” refers to an amount of a component sufficient to produce a desired therapeutic response without excessive adverse side effects (such as toxicity, irritation or allergic reactions) commensurate with a reasonable benefit/risk ratio at the time of use. “Therapeutically effective amount” refers to an amount of a drug of the present application effective to produce a desired therapeutic response, for example, an amount of a drug effective to delay growth of cancer or sarcoma or lymphoma or cause a cancer to shrink or not to metastasize. A specific safe and effective amount or a therapeutically effective amount will vary depending on factors such as a specific condition being treated, a patient's physical condition, a type of mammal being treated, duration of treatment, nature of complication treatment (if any), a specific formula and a structure of a compound or a derivative thereof used, etc.
(42) The term “pharmaceutically acceptable salt” refers to an acid or a base salt used to prepare a compound. Examples of pharmaceutically acceptable salts include, but are not limited to, basic residues of mineral or organic acid salts, such as amines; and alkali or organic salts of acidic residues (such as phenols). It is preferably a salt prepared from an organic or inorganic acid. Preferred acid salts are chloride bromine, sulfate, nitrate, phosphate, sulfonate, formate, maleate, citric acid, benzoate, hydrochloride, ascorbic acid, etc. Preferred phenolic salts are alkaline earth metal salts, sodium salts, potassium salts or lithium salts.
(43) The term “drug carrier” refers to a pharmaceutically acceptable solvent, suspension or carrier for delivering an anti-MET and/or RON antibody, and a fragment and/or an antibody-drug conjugate (ADC) thereof, or a compound, to an animal or a human body. A carrier may be a liquid or a solid which is selected according to a planned mode of administration. Proteins and liposomes are also drug carriers.
(44) The term “cancer” refers to all types of cancer or malignancies found in humans and mammals, including cancers and sarcomas that express RON. Examples of cancers are brain cancer, breast cancer, cervical cancer, pancreatic cancer, skin cancer, prostate cancer, liver cancer, bladder cancer, colon cancer, head and neck cancer, kidney cancer, lung cancer, non-small cell lung cancer, melanoma, mesothelioma, ovarian cancer, sarcoma, gastric cancer, uterine cancer, medulloblastoma, etc.
(45) Preparation of a monoclonal antibody that specifically recognizes MET: A MET protein was used as an immunogen to immunize a mouse. Hybridoma cells that recognized a MET receptor domain and could induce cancer cells to undergo strong MET protein endocytosis and monoclonal antibodies produced by the hybridoma cells were selected. A hybridoma named PCM-C1D8 and an antibody produced by it were selected as main candidates.
(46) Humanization of PCM-C1D8: Sequences synthesized by a humanized design and including complementarity determining regions (CDRs) of five heavy chains and five light chains from PCM-C1D8 were respectively transplanted into human IgG1/k frameworks for antibody humanization to produce twenty-five different humanized IgG1/k molecules. Specificity, sensitivity, and affinity of each humanized PCM-C1D8 were analyzed. Humanized PCM-C1D8 was finally selected as the main antibody developed.
(47) Preparation of a monoclonal antibody that specifically recognizes RON: A RON protein was used as an immunogen to immunize a mouse. Hybridoma cells that recognized a RON receptor domain and could induce cancer cells to undergo strong RON protein endocytosis and monoclonal antibodies produced by the hybridoma cells were selected. A hybridom a named PCM-5B14 and an antibody produced by it were selected as main candidates.
(48) Humanization of PCM-5B14: Sequences synthesized by a humanized design and including complementarity determining regions (CDRs) of five heavy chains and five light chains from PCM-5B14 were respectively transplanted into human IgG1/k frameworks for antibody humanization to produce twenty-five different humanized IgG1/k molecules. Specificity, sensitivity, and affinity of each humanized PCM5B14 were analyzed. Humanized PCM-5B14 was finally selected as the main antibody developed.
(49) Preparation of an anti-MET-and-RON bispecific antibody: Modifications made to prepare an anti-MET-and-anti-RON bispecific antibody mainly included: in an anti-RON antibody fragment, amino acid No. 393 in an amino acid sequence thereof was mutated from T to W; in an anti-MET antibody fragment, amino acid No. 440 in an amino acid sequence thereof was mutated from Y to V, and meanwhile CH1 in a heavy chain variable region thereof and CL in a light chain variable region thereof were interchanged. A bispecific antibody synthesized was PCMbs-MR.
(50) Experimental evidence that PCMbs-MR induces MET and/or RON endocytosis on surfaces of cancer cells: Fifteen cancer cell lines with different expression levels of MET and/or RON from human breast cancer, colon cancer, lung cancer, and pancreatic cancer and so on were used to analyze effectiveness of PCMbs-MR in inducing MET and/or RON endocytosis on surfaces of cancer cells. Representative results confirming that PCMbs-MR strongly induces MET and/or RON endocytosis are shown in
(51) Formation of antibody-drug conjugates (ADCs) by conjugating PCMbs-MR to a plurality of cytotoxic drugs and conjugating effects thereof: Humanized PCMbs-MR was selected to be conjugated to drugs. Chemotherapeutic agents used included doxorubicin, a maytansinoids derivative (DM1), monomethyl auristatin E (MMAE), and docamicin. A product obtained by conjugating PCMbs-MR to MMAE, namely bispecific antibody PCMdt-MMAE, was finally selected as an ADC model for further research (
(52) Maximum tolerated dose of PCMdt-MMAE in animal experiments: Different doses of PCMdt-MMAE were respectively injected into mice, and changes in body weights and others of the animals were observed. Results in
(53) Efficacy of PCMdt-MMAE targeted delivery of MMAE in killing cancer cells in vitro and in eliminating xenograft tumors in vivo: In-vitro experiments using cell lines of multiple human cancers such as breast cancer, colon cancer, lung cancer and pancreatic cancer and so on confirmed effects of PCMdt-MMAE on killing cancer cells (
(54) Strong induction of internalization of MET and RON by a bispecific antibody produced against MET and RON receptors: A bispecific antibody produced with anti-MET antibody PCM-C1D8 and anti-RON antibody PCM-5B14, which was named PCMbs-MR, could strongly induce endocytosis of MET and RON proteins on cancer cells.
(55) Preparation of an antibody-drug conjugate (ADC) by conjugating the bispecific antibody PCMbs-MR to a drug: The bispecific antibody PCMbs-MR was conjugated to drugs including chemotherapeutic drugs such as doxorubicin, a maytansinoid derivatives (DM1), monomethyl auristatin E (MMAE), and docarmycin. An ADC product (PCMdt-MMAE) formed by conjugating PCMbs-MR to MMAE was taken as a first choice for further research.
(56) Therapeutic effects of PCMdt-MMAE in killing cancer cells in vitro and in eliminating xenograft tumors in vivo: By using human tumor cell lines such as breast cancer, colon cancer, lung cancer, and pancreatic cancer and so on, it was confirmed that PCMdt-MMAE could effectively kill cancer cells in vitro. Xenograft tumor models of cell lines from human breast cancer, colon cancer, lung cancer, and pancreatic cancer verified a highly effective anti-cancer therapeutic effect of PCMdt-MMAE in vivo.
(57) The results of the above research indicate that the production of anti-MET and/or RON monoclonal antibodies that specifically recognize MET and/or RON domains provides a new pharmacological basis for the use of PCMdt-MMAE to induce the endocytosis of MET and/or RON on tumor cells to thereby realize targeted drug delivery.
(58) TABLE-US-00001 DNA sequences: CDRs from PCM-C1D8 VH (heavy chain variable region): CDR1: (SEQ ID NO: 1) AACTTTGGTATACAC (15 nt) CDR2: (SEQ ID NO: 2) GTGATATGGGGTGATGGAATCACAACCTATAATTCAGTTCTCAAATCC (48 nt) CDR3: (SEQ ID NO: 3) TCTTATTTTTTGGGAGCTATGGTCTAC (27 nt) CDRs from PCM-C1D8 VL (light chain variable region): CDR1: (SEQ ID NO: 4) AAGGCCAGTCAGAGTGTGGGTACTGCTGTAGCC (33 nt) CDR2: (SEQ ID NO: 5) TCGGCATCCACCCGGTACACT (21 nt) CDR3: (SEQ ID NO: 6) CAACAATATAGCACTTCTCGGACG (24 nt) Amino acid sequences: CDRs from PCM5B14 VH (heavy chain variable region): CDR1: (SEQ ID NO: 7) NFGIH (5 aa) CDR2: (SEQ ID NO: 8) VIWGDGITTYNSVLKS (16 aa) CDR3: (SEQ ID NO: 9) SYFLGAMVY (9 aa) CDRs from PCM5B14 VL (light chain variable region): CDR1: (SEQ ID NO: 10) KASQSVGTAVA (11 aa) CDR2: (SEQ ID NO: 11) SASTRYT (7 aa) CDR3: (SEQ ID NO: 12) QQYSTSRT (8 aa) DNA sequences: CDRs from PCM5B14 VH (heavy chain variable region): CDR1: (SEQ ID NO: 13) GGCTACACCTTCACAGACTATCACATGGAT (30 nt) CDR2: (SEQ ID NO: 14) GACATCAACCCAAACAATGGCGGCGCCATCTACAATCAGAAGTTTAAGG GC (51 nt) CDR3: (SEQ ID NO: 15) TCTCACTACGATTATGCTGGAGGAGCTTGGTTCGCTTAC (39 nt) CDRs from PCM5B14 VL (light chain variable region): CDR1: (SEQ ID NO: 16) AAGAGCTCCCAGAGCCTGCTGTTCTCCGGCAACCAGAAGAATTACC TGGCT (51 nt) CDR2: (SEQ ID NO: 17) TGGGCTTCTACCAGAGCTAGC (21 nt) CDR3: (SEQ ID NO: 18) CAGCAGTACTATAGCTTCCCAAGAACC (27 nt) Amino acid sequences: CDRs from PCM5B14 VH (heavy chain variable region): CDR1: (SEQ ID NO: 19) GYTFTDYHMD (10 aa) CDR2: (SEQ ID NO: 20) DINPNNGGAIYNQKFKG (17 aa) CDR3: (SEQ ID NO: 21) SHYDYAGGAWFAY (13 aa) CDRs from PCM5B14 VL (light chain variable region): CDR1: (SEQ ID NO: 22) KSSQSLLFSGNQKNYLA (17 aa) CDR2: (SEQ ID NO: 23) WASTRAS (7 aa) CDR3: (SEQ ID NO: 24) QQYYSFPRT (9 aa)
Full-length DNA sequence of heavy chain variable region of PCM-C1D8 (SEQ ID NO: 25): Kozak—Leading peptide—VH (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4)-CHs (CH1-CH2-CH3)-Stop code
(59) TABLE-US-00002 Kozak: (SEQ ID NO: 33) GCCGCCACCATGGGTTGGTCATGTATTATTCTGTTTCTGGTGGCTACTG CTACCGGCGTGCATTCC VH: (SEQ ID NO: 34) CAGGTGCAGCTGGTCCAGTCTGGGGCTGAAGTGAAGAAGCCCGGCGCCA CCGTGAAGATCAGCTGCAAGGTGTCCAACTTTGGTATACACTGGGTGCA GCAGGCTCCTGGCAAGGGCCTCGAGTGGATGGGCGTGATATGGGGTGAT GGAATCACAACCTATAATTCAGTTCTCAAATCCCGGGTGACCATCACAG CTGACACCTCTACAGATACCGCCTATATGGAGCTGAGCTCCCTGAGATC CGAGGACACAGCCGTGTACTATTGCGCCCGGTCTTATTTTTTGGGAGCT ATGGTCTACTGGGGACAGGGCACACTGGTGACCGTGAGCCGG (112 aa) CH1: (SEQ ID NO: 35) GCTTCCACCAAGGGCCCTAGCGTGTTTCCACTGGCCCCCTCTTCCAAGT CTACAAGCGGAGGAACCGCCGCTCTGGGATGTCTGGTGAAGGATTACTT CCCAGAGCCCGTGACCGTGTCTTGGAACAGCGGCGCTCTGACAAGCGGC GTGCACACATTTCCTGCCGTGCTGCAGTCCTCTGGCCTGTACTCCCTGA GCTCCGTGGTGACAGTGCCATCTAGCTCCCTGGGCACACAGACCTATAT CTGCAACGTGAATCACAAGCCAAGCAATACCAAGGTGGACAAGAAGGTG (98 aa)
Full-length DNA sequence of light chain variable region of PCM-C1D8 (SEQ ID NO: 26): Kozak—leading peptide—VL (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4)—CL-Stop code
(60) TABLE-US-00003 Kozak: (SEQ ID NO: 36) GCCGCCACCATGGGCTGGTCATGTATTATTCTGTTTCTGGTCGCAACTG CTACTGGGGTGCATAGC VL: (SEQ ID NO: 37) GAAATCGTGATGACTCAGTCTCCCGGAACCCTGTCCCTGTCTCCAGGCG AGCGGGCCACCCTGTCCTGCAAGGCCAGTCAGAGTGTGGGTACTGCTGT AGCCTGGTATCAGCAGAAGCCAGGCCAGGCTCCCAGGCTGCTGATCTAC TCGGCATCCACCCGGTACACTGGCATCCCCGACAGGTTCAGCGGCTCCG GCTCTGGCACAGACTTCACCCTGACAATCTCTAGACTGGAGCCTGAGGA CTTCGCCGTGTACTATTGCCAACAATATAGCACTTCTCGGACGTTTGGC CAGGGCACAAAGCTGGAGATCAAG (106 aa) CL: (SEQ ID NO: 38) CGGACCGTGGCCGCTCCCAGCGTGTTCATCTTTCCCCCTTCCGACGAGC AGCTGAAGTCCGGCACAGCTTCTGTGGTGTGCCTGCTGAACAACTTCTA CCCCAGGGAGGCCAAGGTCCAGTGGAAGGTGGATAACGCTCTGCAGAGC GGCAATTCCCAGGAGTCTGTGACCGAGCAGGACAGCAAGGATTCCACAT ATTCTCTGTCTAGCACCCTGACACTGTCTAAGGCCGATTACGAGAAGCA CAAGGTGTATGCTTGTGAAGTCACCCACCAGGGTCTGTCATCACCCGTC ACTAAGTCTTTTAACCGAGGCGAATGCTGA (107 aa) Full-length amino acid sequence of heavy chain variable region of PCM-C1D8: (SEQ ID NO: 27) AATMGWSCIILFLVATATGVHSQVQLVQSGAEVKKPGATVKISCKVSNF GIHWVQQAPGKGLEWMGVIWGDGITTYNSVLKSRVTITADTSTDTAYME LSSLRSEDTAVYYCARSYFLGAMVYWGQGTLVTVSR Full-length amino acid sequence of light chain variable region of PCM-C1D8: (SEQ ID NO: 28) AATMGWSCIILFLVATATGVHSEIVMTQSPGTLSLSPGERATLSCKASQ SVGTAVAWYQQKPGQAPRLLIYSASTRYTGIPDRFSGSGSGTDFTLTIS RLEPEDFAVYYCQQYSTSRTFGQGTKLEIK
Full-length DNA sequence of heavy chain variable region of PCM5B14 (SEQ ID NO: 29): Kozak—Leading peptide—VH (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4)-CHs (CH1-CH2-CH3)-Stop code
Kozak-Leading peptide—VH (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4)-CHs (CH1-CH2-CH3)-Stop code
(61) TABLE-US-00004 Kozak: (SEQ ID NO: 33) GCCGCCACCATGGGTTGGTCATGTATTATTCTGTTTCTGGTGGCTACTG CTACCGGCGTGCATTCC VH: (SEQ ID NO: 39) CAGGTGCAGCTGGTCCAGTCTGGGGCTGAAGTGAAGAAGCCCGGCGCCA CCGTGAAGATCAGCTGCAAGGTGTCCGGCTACACCTTCACAGACTATCA CATGGATTGGGTGCAGCAGGCTCCTGGCAAGGGCCTCGAGTGGATGGGC GACATCAACCCAAACAATGGCGGCGCCATCTACAATCAGAAGTTTAAGG GCCGGGTGACCATCACAGCTGACACCTCTACAGATACCGCCTATATGGA GCTGAGCTCCCTGAGATCCGAGGACACAGCCGTGTACTATTGCGCCCGG TCTCACTACGATTATGCTGGAGGAGCTTGGTTCGCTTACTGGGGACAGG GCACACTGGTGACCGTGAGCCGG (122 aa) CH1: (SEQ ID NO: 40) GCTTCCACCAAGGGCCCTAGCGTGTTTCCACTGGCCCCCTCTTCCAAGT CTACAAGCGGAGGAACCGCCGCTCTGGGATGTCTGGTGAAGGATTACTT CCCAGAGCCCGTGACCGTGTCTTGGAACAGCGGCGCTCTGACAAGCGGC GTGCACACATTTCCTGCCGTGCTGCAGTCCTCTGGCCTGTACTCCCTGA GCTCCGTGGTGACAGTGCCATCTAGCTCCCTGGGCACACAGACCTATAT CTGCAACGTGAATCACAAGCCAAGCAATACCAAGGTGGACAAGAAGGTG (98 aa)
Full-length DNA sequence of light chain variable region of PCM5B14 (SEQ ID NO: 30): Kozak—leading peptide—VL (FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4)—CL Stop code
(62) TABLE-US-00005 Kozak: (SEQ ID NO: 36) GCCGCCACCATGGGCTGGTCATGTATTATTCTGTTTCTGGTCGCAACTG CTACTGGGGTGCATAGC VL: (SEQ ID NO: 41) GAAATCGTGATGACTCAGTCTCCCGGAACCCTGTCCCTGTCTCCAGGCG AGCGGGCCACCCTGTCCTGCAAGAGCTCCCAGAGCCTGCTGTTCTCCGG CAACCAGAAGAATTACCTGGCTTGGTATCAGCAGAAGCCAGGCCAGGCT CCCAGGCTGCTGATCTACTGGGCTTCTACCAGAGCTAGCGGCATCCCCG ACAGGTTCAGCGGCTCCGGCTCTGGCACAGACTTCACCCTGACAATCTC TAGACTGGAGCCTGAGGACTTCGCCGTGTACTATTGCCAGCAGTACTAT AGCTTCCCAAGAACCTTTGGCCAGGGCACAAAGCTGGAGATCAAG CL: (SEQ ID NO: 42) CGGACCGTGGCCGCTCCCAGCGTGTTCATCTTTCCCCCTTCCGACGAGC AGCTGAAGTCCGGCACAGCTTCTGTGGTGTGCCTGCTGAACAACTTCTA CCCCAGGGAGGCCAAGGTCCAGTGGAAGGTGGATAACGCTCTGCAGAGC GGCAATTCCCAGGAGTCTGTGACCGAGCAGGACAGCAAGGATTCCACAT ATTCTCTGTCTAGCACCCTGACACTGTCTAAGGCCGATTACGAGAAGCA CAAGGTGTATGCTTGTGAAGTCACCCACCAGGGTCTGTCATCACCCGTC ACTAAGTCTTTTAACCGAGGCGAATGCTGA (107 aa) Full-length amino acid sequence of heavy chain variable region of PCM5B14: (SEQ ID NO: 31) AATMGWSCIILFLVATATGVHSQVQLVQSGAEVKKPGATVKISCKVSGY TFTDYHMDWVQQAPGKGLEWMGDINPNNGGAIYNQKFKGRVTITADTST DTAYMELSSLRSEDTAVYYCARSHYDYAGGAWFAYWGQGTLVTVSR Full-length amino acid sequence of light chain variable region of PCM5B14: (SEQ ID NO: 32) AATMGWSCIILFLVATATGVHSEIVMTQSPGTLSLSPGERATLSCKSSQ SLLFSGNQKNYLAWYQQKPGQAPRLLIYWASTRASGIPDRFSGSGSGTD FTLTISRLEPEDFAVYYCQQYYSFPRTFGQGTKLEIK
(63)
(64)
(65)
(66) As shown in
(67) As shown in
(68)
(69)
(70)
(71)
(72) It can be expected that any of the embodiments discussed in this specification may be implemented by any method, kit, and reagent of the present application, or combinations thereof, and vice versa.
(73) It must be clearly noted that the specific embodiments described herein are illustrated by examples rather than by ways of limiting the present application. Main features of the present application may be used in various embodiments without departing from the scope of the present application. Those skilled in the art will find out, or be able to determine merely by means of routine experimentation, many equivalents to the specific steps described herein. Such equivalents are considered to be within the scope of the present application and are covered by the claims.
(74) All publications and patent applications mentioned in this specification reflect the current technical status of the field to which the present application pertains. All these publications and patent applications are incorporated herein by reference, to an extent the same as a degree of relevance of each independent publication or patent application to the present application.
(75) The word “a” or “an”, when used in conjunction with the terms “comprise”, “include”, or any varied forms thereof, in the claims and/or specification, can mean “one” but also has a meaning the same as “one or more”, “at least one”, “one or more than one”. The term “or” used in the claims means “and/or”, unless it is clearly indicated that it only means an alternative or that alternatives are mutually exclusive, although the disclosed contents support the meanings of it meaning only an alternative and “and/or”. The term “approximately” throughout this disclosure is used to describe a value that includes an inherent variation in errors of a device and a method used to determine the value, or a variation that exists between subjects in a study.
(76) As used in this specification and claims, the words “contain” (and any form of “contain”), “have” (and any form of “have”), “include” (and any form of “include”) or “comprise” (and any form of “comprise”) are inclusive or open-ended, and do not exclude additional, unmentioned elements or method steps. As used herein, the phrase “substantially consists of . . . ” limits a scope of a claim to specified substances or steps as well as those basic and novel features that do not materially affect the claimed subject matter. As used herein, the phrase “consists of . . . ” does not include any of elements, steps, or ingredients not specified in a claim, except, for example, interference generally related to the elements or limitation.
(77) The term “or a combination thereof” used herein refers to all permutations and combinations of items listed before the term. For example, “A, B, C, or a combination thereof” is meant to include at least one of A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, it is also meant to include BA, CA, CB, CBA, BCA, ACB, BAC or CAB. Continuing this example, it is obvious that it is meant to include combinations of repeated one or more items or terms, such as BB, AAA, AB, BBC, AAABCC CC, CBBAAA, CABABB, etc. Those skilled in the art will appreciate that there is generally no limit to the number of items or terms in any combination, unless it is obviously indicated from the context.
(78) As used herein, words expressing approximation such as but not limited to “about”, “essential” or “substantially” refer to such a situation where when such a modification is used it is interpreted to not necessarily be absolute or precise, but be considered to be close enough to a situation considered to be usable by those skilled in the art as the current situation. The extent to which the specification may be changed depends on an extent of a change made which allows those skilled in the art to believe that a changed feature still has a required property and an ability of an unaltered feature. In general, consistent with the previous discussion, a value modified by an approximate word such as “about” can vary from an asserted value by at least ±1%, 2%, 3%, 4%, 5%, 6%, 7%, 10%, 12% or 15%.
(79) According to the disclosure of the present application, all the compositions and/or methods disclosed and claimed herein may be prepared and implemented through appropriate experiments. Although the compositions and methods of the present application have been described in terms of preferred embodiments, it is obvious to those skilled in the art that without departing from the concept, spirit and scope of the present application, the compositions and/or methods as well as steps of the methods or orders of the steps of the methods described herein may be changed. All such similar substitutions and modifications obvious to those skilled in the art are considered to be within the spirit, scope and concept of the present application defined by the appended claims.